COMPOSITIONS AND METHODS FOR INHIBITING BIOLFILM DEPOSITION AND PRODUCTION
20190328643 ยท 2019-10-31
Inventors
Cpc classification
A61Q11/00
HUMAN NECESSITIES
A61P1/02
HUMAN NECESSITIES
A61P43/00
HUMAN NECESSITIES
A61P13/02
HUMAN NECESSITIES
C12Y302/01059
CHEMISTRY; METALLURGY
A61K2300/00
HUMAN NECESSITIES
A61K38/1729
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61P9/14
HUMAN NECESSITIES
C12Y302/01084
CHEMISTRY; METALLURGY
A61K38/47
HUMAN NECESSITIES
A61K31/045
HUMAN NECESSITIES
A61K38/47
HUMAN NECESSITIES
A61K31/618
HUMAN NECESSITIES
C12Y302/01003
CHEMISTRY; METALLURGY
A61K38/1729
HUMAN NECESSITIES
A61K31/352
HUMAN NECESSITIES
A61K9/0056
HUMAN NECESSITIES
A01N65/38
HUMAN NECESSITIES
A61P15/00
HUMAN NECESSITIES
International classification
A61K8/64
HUMAN NECESSITIES
A61Q11/00
HUMAN NECESSITIES
A61K9/00
HUMAN NECESSITIES
A61K38/16
HUMAN NECESSITIES
A61P1/02
HUMAN NECESSITIES
A61K38/47
HUMAN NECESSITIES
Abstract
The invention provides a method for combating biofilm, said method comprising contacting a biofilm with a composition comprising an effective amount of antimicrobial peptide biofilm enzyme combinations, preferably in the form of a fusion protein. The biofilm may be on an animate or inanimate surface and both medical and non-medical uses and methods are provided. In one aspect the invention provides a composition for use in the treatment or prevention of a biofilm in a subject, particularly in the oral cavity.
Claims
1. A multi-component composition comprising at least one antimicrobial peptide (AMP) and at least one biofilm degrading enzyme which act synergistically to degrade biofilm structures and inhibit biofilm deposition, said composition biologically acceptable carrier for delivery of said composition.
2. The composition as claimed in claim 1 wherein the AMP is selected from protegrin 1, RC-101 and the AMPs listed in Table 1.
3. The composition as claimed in claim 1 wherein the biofilm degrading enzyme is selected from mutanase, dextranase, glucoamylase, glucanase, deoxyribonuclease I, DNAase, dispersin B, glycoside hydrolases, and the enzymes listed in Table 2.
4. The composition as claimed in claim 1 wherein said AMP and said biofilm degrading enzyme are produced recombinantly and form a fusion protein.
5. The composition of claim 1, wherein said composition comprises 2 biofilm degrading enzymes which are mutanase and dextranase and said AMP is PG-1
6. The composition of claim 5 wherein said dextranase to mutanase ratio in said composition is 5:1.
7. The composition of claim 6 further comprising glucoamylase.
8. The composition as claimed in claim 1 further comprising an antimicrobial/antibiotic.
9. The composition as claimed in claim 1, further comprising fluoride and, or CHX.
10. The composition of claim 1, wherein said carrier is chewing gum.
11. The composition of claim 1, wherein said carrier is an oral rinse.
12. The composition of claim 1, wherein said carrier is a biologically compatible buffer.
13. A chewing gum comprising the composition of claim 1.
14. An oral rinse comprising the composition of claim 1.
15. The oral rinse of claim 11, comprising Listerine.
16. A method of degrading and/or removing biofilm comprising contacting a surface harboring said biofilm with the multicomponent composition of claim 1, said composition having a bactericidal effect, and synergistically reducing or eliminating said biofilm comprising one or more undesirable microorganisms, wherein when said biofilm is present in or on an animal subject in need of said reduction or elimination.
17. A method of degrading and/or removing biofilm comprising contacting a surface harboring said biofilm with the multicomponent composition of claim 5, said composition having a bactericidal effect, and synergistically reducing or eliminating said biofilm comprising one or more undesirable microorganisms, wherein when said biofilm is present in or on an animal subject in need of said reduction or elimination.
18. A method of degrading and/or removing biofilm comprising contacting a surface harboring said biofilm with the multicomponent composition of claim 6, said composition having a bactericidal effect, and synergistically reducing or eliminating said biofilm comprising one or more undesirable microorganisms, wherein when said biofilm is present in or on an animal subject in need of said reduction or elimination.
19. The method of claim 16, wherein said biofilm is present in the mouth.
20. The method of claim 16, wherein said biofilm is present on an implanted medical device.
21. The method of claim 16, wherein the biofilm is present in an internal or external body surface selected from the group consisting of a surface in a urinary tract, a middle ear, a prostate, vascular intima, heart valves, skin, scalp, nails, teeth and an interior of a wound.
22. The composition of claim 1, wherein said AMP and said enzyme are produced in a plant plastid, said composition further comprising a plant remnant.
23. The composition of claim 21, wherein said plant is a tobacco or a lettuce plant.
24. The composition of claim 21, wherein said at least one AMP and said at least one enzyme are expressed in a lettuce plant as a fusion protein.
25. The composition of claim 1 wherein said composition comprises PG-1 and dextranase and mutanase in a 5:1 ratio.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
DETAILED DESCRIPTION OF THE INVENTION
[0029] Many infectious diseases in humans are caused by virulent biofilms, including those occurring within the mouth (e.g. dental caries and periodontal diseases). Dental caries (or tooth decay) continues to be the single most costly and prevalent biofilm-associated oral disease in the US and worldwide. It afflicts children and adults alike, and is a major reason for emergency room visits leading to absenteeism from work and school. Unfortunately, the prevalence of dental caries is still high (>90% of US adult population) and it remains the most common chronic disease afflicting children and adolescents, particularly from a poor socio-economic background. Furthermore, poor oral health often leads to systemic consequences and impacts overall health. Importantly, the cost to treat the ravages of this disease (e.g. carious lesions and pulpal infection) exceeds $40 billion/yr in the US alone. Fluoride is the mainstay of dental caries prevention. However, its widespread use offers incomplete protection against the disease. Fluoride is effective in reducing demineralization and enhancing demineralization of early carious lesions, but has limited effects against biofilms. Conversely, current antimicrobial modalities for controlling caries-causing biofilms are largely ineffective.
[0030] There is an urgent need to develop efficacious therapies to control virulent oral biofilms. In accordance with the present invention, methods for low-cost production and delivery of therapeutically effective plant-expressed biopharmaceuticals superior to current antibiofilm/anti-caries modalities are provided.
Definitions
[0031] As used herein, antimicrobial peptides are small peptides having any bacterial activity. RC-101 is an analogue of retrocyclin, a cyclic octadecapeptide, which can protect human CD4+ cells from infection by T- and M-tropic strains of HIV-1 in vitro and prevent HIV-1 infection in human cervicovaginal tissue. The ability of RC-101 to prevent HIV-1 infection and retain full activity in the presence of vaginal fluid makes it a good candidate for other topical microbicide applications, especially in oral biofilms. The sequence of RC-101 is provided in Plant Biotechnol J. 2011 January; 9(1): 100-115 which is incorporated herein by reference.
[0032] C16G2 is a novel synthetic antimicrobial peptide with specificity for S. mutans,
[0033] Protegrin-1 (PG) is a cysteine-rich, 18-residue -sheet peptide. It has potent antimicrobial activity against a broad range of microorganisms, including bacteria, fungus, virus, and especially some clinically relevant, antibiotic-resistant bacteria. For example, bacterial pathogens E. coli and fungal opportunist C. albicans are effectively killed by PG in laboratory testing. The sequence of PG-1 is provided in Plant Biotechnol J. 2011 January; 9(1): 100-115 which is incorporated herein by reference.
[0034] Additional antimicrobial peptides include those set forth below in Table 1 below.
TABLE-US-00001 TABLE 1 Peptide sequences (single-letter amino acid code) of CSP, CSP.sub.C16-containing STAMPs, and STAMP components Peptide Amino acid sequencea Molecular wt (observed) CSP SGSLSTFFRLFNRSFTQALGK 2,364.9 CSP.sub.C16 TFFRLFNRSFTQALGK (SEQ ID NO: 3) 1,933.3 G2 KNLRIIRKGIHIIKKYb (SEQ ID NO: 4) 1,993.5 C16G2 TFFRLFNRSFTQALGKGGGKNLRIIRKGIHIIKKYb 4,079.0 (SEQ ID NO: 5) CSP.sub.M8 TFFRLFNR (SEQ ID NO: 6) 1,100.6 M8G2 TFFRLFNRGGGKNLRIIRKGIHIIKKYb 3,246.9 (SEQ ID NO: 7) S6L3-33 FKKFWKWFRRF (SEQ ID NO: 8) 1,677.5 C16-33 TRRRLFNRSFTQALGKSGGGFKKFWKWFRRF 3,849.0 (SEQ ID NO: 9) M8-33 TFFRLFNRSGGGFKKFWKWFRRF (SEQ ID NO: 10) 3,016.9 a Linker regions between targeting and killing peptides are underlined.
b Peptide C-terminal amidation.
[0035] A biofilm is a complex structure adhering to surfaces that are regularly in contact with water, consisting of colonies of bacteria and usually other microorganisms such as yeasts, fungi, and protozoa that secrete a mucilaginous protective coating in which they are encased. Biofilms can form on solid or liquid surfaces as well as on soft tissue in living organisms, and are typically resistant to conventional methods of disinfection. Dental plaque, the slimy coating that fouls pipes and tanks, and algal mats on bodies of water are examples of biofilms. Biofilms are generally pathogenic in the body, causing such diseases as dental caries, cystic fibrosis and otitis media.
[0036] Biofilm degrading enzymes include, without limitation, exo-polysaccharide degrading enzymes such as dextranase, mutanase, DNAse, endonuclease, deoxyribonuclease I, dispersin B, and glycoside hydrolases, such as 1.fwdarw.3)--D-glucan hydrolase, although use of chloroplast codon optimized sequences encoding dextranase and mutanase are preferred, the skilled person is well aware of many different biofilm degrading enzymes in the art. Additional enzyme sequences for use in the fusion proteins of the invention are provided below.
[0037] As used herein, the terms administering or administration of an agent, drug, or peptide to a subject includes any route of introducing or delivering to a subject a compound to perform its intended function. The administering or administration can be carried out by any suitable route, including orally, topically, intranasally, parenterally (intravenously, intramuscularly, intraperitoneally, or subcutaneously), or rectally. Administering or administration includes self-administration and the administration by another.
[0038] As used herein, the terms disease, disorder, or complication refers to any deviation from a normal state in a subject.
[0039] As used herein, by the term effective amount amount effective, or the like, it is meant an amount effective at dosages and for periods of time necessary to achieve the desired result.
[0040] As used herein, the term inhibiting or preventing means causing the clinical symptoms of the disease state not to worsen or develop, e.g., inhibiting the onset of disease, in a subject that may be exposed to or predisposed to the disease state, but does not yet experience or display symptoms of the disease state.
[0041] As used herein, the term expression in the context of a gene or polynucleotide involves the transcription of the gene or polynucleotide into RNA. The term can also, but not necessarily, involves the subsequent translation of the RNA into polypeptide chains and their assembly into proteins.
[0042] A plant remnant may include one or more molecules (such as, but not limited to, proteins and fragments thereof, minerals, nucleotides and fragments thereof, plant structural components, etc.) derived from the plant in which the protein of interest was expressed. Accordingly, a composition pertaining to whole plant material (e.g., whole or portions of plant leafs, stems, fruit, etc.) or crude plant extract would certainly contain a high concentration of plant remnants, as well as a composition comprising purified protein of interest that has one or more detectable plant remnants. In a specific embodiment, the plant remnant is rubisco.
[0043] In another embodiment, the invention pertains to an administrable composition for treating or preventing biofilm formation in situ (e.g., in the mouth) and on biomedical devices useful for surgical implantation such as stents, artificial joints, and the like. In this embodiment, the devices are coated with the composition to inhibit unwanted biofilm deposition on the device. The composition comprises a therapeutically-effective amount of one or more antimicrobial peptides (AMP) and one or more enzymes having biofilm degrading activity in combination, each of said AMP and enzyme thereof having been expressed by a plant and a plant remnant and acting synergisticall to degrade said biofilm. In certain embodiments the AMP(s) and enzymes(s) are expressed from separate plastid transformation vectors. In other embodiments, the plastid transformation vectors comprising polycistronic coding sequences where both the AMP and the enzymes are expressed from a single vector.
[0044] Proteins expressed in accord with certain embodiments taught herein may be used in vivo by administration to a subject, human or animal in a variety of ways. The pharmaceutical compositions may be administered orally, topically, subcutaneously, intramuscularly or intravenously, though oral topical administration is preferred.
[0045] Oral compositions produced by embodiments of the present invention can be administrated by the consumption of the foodstuff that has been manufactured with the transgenic plant producing the plastid derived therapeutic protein. The edible part of the plant, or portion thereof, is used as a dietary component. The therapeutic compositions can be formulated in a classical manner using solid or liquid vehicles, diluents and additives appropriate to the desired mode of administration. Orally, the composition can be administered in the form of tablets, capsules, granules, powders, gums, and the like with at least one vehicle, e.g., starch, calcium carbonate, sucrose, lactose, gelatin, etc. The therapeutic protein(s) of interst may optionally be purified from a plant homogenate. The preparation may also be emulsified. The active ingredient is often mixed with excipients which are pharmaceutically acceptable and compatible with the active ingredient. Suitable excipients are, e.g., water, saline, dextrose, glycerol, ethanol or the like and combination thereof. In addition, if desired, the compositions may contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents, or adjuvants. In a preferred embodiment the edible plant, juice, grain, leaves, tubers, stems, seeds, roots or other plant parts of the pharmaceuticalproducing transgenic plant is ingested by a human or an animal thus providing a very inexpensive means of treatment of disease.
[0046] In a specific embodiment, plant material (e.g. lettuce material) comprising chloroplasts expressing AMPs and biofilm degrading enzymes and combinations thereof, is homogenized and encapsulated. In one specific embodiment, an extract of the lettuce material is encapsulated. In an alternative embodiment, the lettuce material is powderized before encapsulation. As mentioned previously, the biofilm degrading proteins may also be purified from the plant following expression.
[0047] In alternative embodiments, the compositions may be provided with the juice of the transgenic plants for the convenience of administration. For said purpose, the plants to be transformed are preferably selected from the edible plants consisting of tomato, carrot and apple, among others, which are consumed usually in the form of juice.
[0048] According to another embodiment, the subject invention pertains to a transformed chloroplast genome that has been transformed with a vector comprising a heterologous gene that expresses a combination of peptides as disclosed herein.
[0049] Of particular present interest is a transformed chloroplast genome transformed with a vector comprising a heterologous gene that expresses one or more AMP and biofilm degrading enzyme or a combination thereof, polypeptide. In a related embodiment, the subject invention pertains to a plant comprising at least one cell transformed to express a peptide as disclosed herein.
[0050] Reference to genetic sequences herein refers to single- or double-stranded nucleic acid sequences and comprises a coding sequence or the complement of a coding sequence for polypeptide of interest. Degenerate nucleic acid sequences encoding polypeptides, as well as homologous nucleotide sequences which are at least about 50, 55, 60, 65, 60, preferably about 75, 90, 96, or 98% identical to the cDNA may be used in accordance with the teachings herein polynucleotides. Percent sequence identity between the sequences of two polynucleotides is determined using computer programs such as ALIGN which employ the FASTA algorithm, using an affine gap search with a gap open penalty of 12 and a gap extension penalty of 2. Complementary DNA (cDNA) molecules, species homologs, and variants of nucleic acid sequences which encode biologically active polypeptides also are useful polynucleotides.
[0051] Variants and homologs of the nucleic acid sequences described above also are useful nucleic acid sequences. Typically, homologous polynucleotide sequences can be identified by hybridization of candidate polynucleotides to known polynucleotides under stringent conditions, as is known in the art. For example, using the following wash conditions: 2SSC (0.3 M NaCl, 0.03 M sodium citrate, pH 7.0), 0.1% SDS, room temperature twice, 30 minutes each; then 2SSC, 0.1% SDS, 50 C. once, 30 minutes; then 2SSC, room temperature twice, 10 minutes each homologous sequences can be identified which contain at most about 25-30% basepair mismatches. More preferably, homologous nucleic acid strands contain 15-25% basepair mismatches, even more preferably 5-15% basepair mismatches.
[0052] Species homologs of polynucleotides referred to herein also can be identified by making suitable probes or primers and screening cDNA expression libraries. It is well known that the T.sub.m of a double-stranded DNA decreases by 1-1.5 C. with every 1% decrease in homology (Bonner et al., J. Mol. Biol. 81, 123 (1973). Nucleotide sequences which hybridize to polynucleotides of interest, or their complements following stringent hybridization and/or wash conditions also are also useful polynucleotides. Stringent wash conditions are well known and understood in the art and are disclosed, for example, in Sambrook et al., MOLECULAR CLONING: A LABORATORY MANUAL, 2.sup.nd ed., 1989, at pages 9.50-9.51.
[0053] The following materials and methods are provided to facilitate the practice of the present invention.
Microorganisms and Growth Conditions
[0054] Streptococcus mutans UA159 serotype c (ATCC 700610), Actinomyces naeslundii ATCC 12104, Streptococcus gordonii DL-1 and Candida albicans SC5314 were used in present study. These strains were selected because S. mutans is a well-established virulent cariogenic bacteria [Ajdi D et al, 2002]. S. gordonii is a pioneer colonizer of dental biofilm, and A. naeslundii is also detected during the early stages of dental biofilm formation and may be associated with development of root caries [Dige I et al, 2009]. C. albicans is a fungal organism that colonizes human mucosal surfaces, and it is also detected in dental plaque from toddlers with early childhood caries [Hajeshengallis E et al, 2015]. All strains were stored at 80 C. in tryptic soy broth containing 20% glycerol. Blood agar plates were used for cultivating S. mutans, S. gordonii and A. naeslundii. Sabouraud agar plates were used for C. albicans. All these strains were grown in ultra-filtered (10 kDa molecular-weight cut-off membrane; Prep/Scale, Millipore, MA) buffered tryptone-yeast extract broth (UFTYE; 2.5% tryptone and 1.5% yeast extract, pH 7.0) with 1% glucose to mid-exponential phase (37 C., 5% CO2) prior to use.
Creation of Transplastomic Lines Expressing Different Tagged GFP Fusion Proteins
[0055] The transplastomic plants expressing GFP fused with CTB, PTD, retrocyclin and protegrin were created as described in previous studies [Limaye et al 2006; Kwon et al 2013; Xiao et al 2016; Lee et al 2011]. Transplastomic lines expressing GFP fusion proteins were confirmed using Southern blot assay as described previously [Verma et al 2008]. Also, expression of GFP tagged proteins were confirmed by visualizing green fluorescence from the leaves of each construct under UV illumination.
Purification of Tag-Fused GFP Proteins
[0056] Purification of GFP fusions Protegrin-1 (PG1) and Retrocyclin (RC101) from transplastomic tobacco was accomplished by organic extraction followed by hydrophobic chromatography done previously (Lee et al, 2011). About 0.2-1 gm of lyophilized leaf material was taken and reconstituted in 10-20 ml of plant extraction buffer (0.2M Tris HCl pH 8.0, 0.1M NaCl, 10 mM EDTA, 0.4M sucrose, 0.2% Triton X supplemented with 2% Phenylmethylsulfonylfluoride and 1 protease inhibitor cocktail). The resuspension was incubated in ice for 1 hour with vortex homogenization every 15 min. The homogenate was then spun down at 75000 g at 4 C. for 1 hour (Beckman LE-80K optima ultracentrifuge) to obtain the clarified lysate. The lysate was subjected to pretreatment with 70% saturated ammonium sulfate and .sup.th volume of 100% ethanol, followed by vigorous shaking for 2 min (Yakhnin et al, 1998). The treated solution was spun down at 2100 g for 3 min. The upper ethanol phase was collected and the process was repeated with 1/16.sup.th volume of 100% ethanol. The pooled ethanol phases were further treated with .sup.rd volume of 5M NaCl and .sup.th volume of 1-butanol, homogenized vigorously for 2 min and spun down at 2100 g for 3 min. The lowermost phase was collected and loaded onto a 7 kDa MWCO zeba spin desalting column (Thermo scientific) and desalted as per manufacturer's recommendations.
[0057] The desalted extract was then subjected to hydrophobic interaction chromatography during the capture phase for further purification. The desalted extract was injected into a Toyopearl butyl650S hydrophobic interaction column (Tosoh bioscience) which was run on a FPLC unit (Pharmacia LKB-FPLC system). The column was equilibriated with 2.3 column volumes of salted buffer (10 mM Tris-HCl, 10 mM EDTA and 50% saturated ammonium sulfate) to a final 20% salt saturation to facilitate binding of GFP onto the resin. This was followed by a column wash with 5.8 column volumes of salted and unsalted buffer mix and then eluted with unsalted buffer (10 mM Tris-HCl, 10 mM EDTA). The GFP fraction was identified based on the peaks observed in the chromatogram and collected. The collected fractions were subjected to a final polishing step by overnight dialysis. After dialysis the purified proteins were lyophilized (labconco lyophilizer) in order to concentrate the finished product and then stored in 20 C.
Quantification of Purified GFP Fusions
[0058] Quantification of GFP-RC101 and GFP-PG1 was done by both western blot and fluorescence based methods. The lyophilized purified proteins were resuspended in sterile 1PBS and the total protein was determined by Bradford method. The purified protein was then quantified by SDS-PAGE method by loading denatured protein samples along with commercial GFP standards (Vector labs) onto a 12% SDS gel and then western blotting was done using 1:3000 dilution of mouse Anti-GFP antibody (Millipore) followed by probing with 1:4000 dilution of secondary HRP conjugated Goat-Anti Mouse antibody (Southern biotech).
[0059] The purified proteins were also quantified using GFP fluorescence. The protein samples were run on a 12% SDS gel under native conditions. After the run, the gel was placed under a UV lamp and then photographed. The GFP concentration in both western and native fluorescence methods was determined by densitometric analysis using Image J software with commercial GFP standards in order to obtain the standard curve. Purity was determined based on GFP quantitation with respect to total protein values determined in Bradford method.
Uptake of Purified Tag-Fused GFP Proteins by Human Periodontal Cell Lines
[0060] As previously described (Xiao, et al 2016), to determine the uptake of four tags, CTB, PTD, PG1 and RC101, in different human periodontal cell lines, including human periodontal ligament stem cells (HPDLS), maxilla mesenchymal stem cells (MMS), human head and neck squamous cell carcinoma cells (SCC-1), gingiva-derived mesenchymal stromal cells (GMSC), adult gingival keratinocytes (AGK) and osteoblast cells (OBC), briefly, each human cell line cells (210.sup.4) were cultured in 8 well chamber slides (Nunc) at 37 C. overnight, followed by incubation with purified GFP-fused tags: CTB-GFP (8.8 g), PTD-GFP (13 g), GFP-PG1 (1.2 g) and GFP-RC101 (17.3 ag) in 100 al PBS supplemented 1% FBS at 37 C. for 1 hour. After fixing with 2% paraformaldehyde at RT for 10 min and washing with PBS for three times, all cells were stained with antifade mounting medium with DAPI (Vector laboratories, Inc). For negative control, cells were incubated with commercial GFP (2 g) in PBS with 1% FBS at 37 C. for 1 hour. All fixed cells were imaged using confocal microscopy. The images were observed under 100 objective, and at least 10-15 GFP-positive cells were recorded for each cell line in three independent analysis.
Evaluation of Antibacterial Activity
[0061] The killing kinetics of AMPs (Gfp-PG1 and Gfp-RC101) against S. mutans were analyzed by time-lapse killing assay. S. mutans were grown to log phase and diluted to 10.sup.5 CFU/ml in growth medium. GFP-PG1 and GFP-RC101 were added to S. mutans suspensions at concentrations of 0 to 10 g/ml and 0 to 80 g/ml, respectively. At 0, 1, 2, 4, 8 and 24 h, samples were taken and serially diluted in 0.89% NaCl, then spread on agar plates and colonies were counted after 48 h. Absorbance at 600 nm was also checked at each time point. S. gordonii, A. naeslundii and C. albicans suspensions were mixed with Gfp-PG1 at concentration of 10 g/ml, and at 0, 1 and 2 h, aliquots were taken out for enumeration of CFU.
[0062] The effects of AMP on the viability of S. mutans cells were also assessed by time-lapsed measurements. S. mutans were grown to log phase and harvested by centrifugation (5500 g, 10 min) and the pellet was washed once with sodium phosphate-buffered saline (PBS) (pH 7.2), re-suspended in PBS and adjusted to a final concentration of 110.sup.5 CFU/ml. GFP-PG1 was added to S. mutans suspensions at concentrations of 10 g/ml and 2.5 M propidium iodide-PI (Molecular Probe Inc., Eugene, Oreg., USA) was added for labeling dead cells. 5 l of mixtures were loaded on an agarose pad for confocal imaging. Confocal images were acquired using Leica SP5-FLIM inverted single photon laser scanning microscope with a 100 (numerical aperture, 1.4) Oil immersion objective. The excitation wavelengths were 488 nm and 543 nm for GFP and PI, respectively. The emission filter for GFP was a 495/540 OlyMPFC1 filter, while PI was a 598/628 OlyMPFC2 filter. For the time-lapse series, images in the same field of view were taken at 0, 10, 30, and 60 min and created by ImageJ 1.44 (Http://rsbweb.nih.gov/ij/download.html). Morphological observations of S. mutans treated with AMP were also examined by scanning electron microcopy (SEM). S. mutans were grown to log phase and diluted to 10.sup.5 CFU/ml in PBS. Bacteria suspension was mixed with GFP-PG1 (final concentration of 10 g/ml) for 1 h at 37 C. After treatment, the bacteria were collected by filtration using 0.4 m Millipore filters. The deposits were fixed in 2.5% glutaraldehyde and 2.0% paraformaldehyde in 0.1 M cacodylate buffer (pH 7.4) for 1 hour at room temperature and processed for SEM (Quanta FEG 250, FEI, Hillsboro, Oreg.) observation. Untreated or bacteria treated with buffer only served as controls.
Evaluation of Anti-Biofilm Activity
[0063] A well-characterized EPS-matrix producing oral pathogen, S. mutans UA159, was used to form biofilms on saliva-coated hydroxyapatite disc surfaces. Briefly, hydroxyapatite discs (1.25 cm in diameter, surface area of 2.70.2 cm2, Clarkson, Chromatography Products, Inc., South Williamsport, Pa.) were coated with filter-sterilized, clarified human whole saliva (sHA) [Xiao J et alo, 2012]. S. mutans was grown in UFTYE medium with 1% (w/v) glucose to mid-exponential phase (37 C., 5% CO.sub.2). Each sHA disc was inoculated with 10.sup.5 CFU of actively growing S. mutans cells per ml in UFTYE medium containing 1% (w/v) sucrose, and inoculated at 37 C. and 5% CO.sub.2 for 19 h. Before inoculum, the sHA discs were topically treated with GFP-PG1 solution (10 ug) for 30 min. The inhibition effect of GFP-PG1 treatment on 3D biofilm architectures were observed via confocal imaging. Briefly, EPS was labeled using 2.5 M Alexa Fluor 647-labeled dextran conjugate (10 kDa; 647/668 nm; Molecular Probes Inc.), while the bacteria cells were stained with 2.5 M SYTO9 (485/498 nm; Molecular Probes Inc.). The imaging was performed using Leica SP5 microscope with 20 (numerical aperture, 1.00) water immersion objective. The excitation wavelength was 780 nm, and the emission wavelength filter for SYTO 9 was a 495/540 OlyMPFEC1 filter, while the filter for Alexa Fluor 647 was a HQ655/40M-2P filter. The confocal image series were generated by optical sectioning at each selected positions and the step size of z-series scanning was 2 m. Amira 5.4.1 software (Visage Imaging, San Diego, Calif., USA) was used to create 3D renderings of biofilm architecture [Xiao J et al. 2012, Koo H et al. 2010].
[0064] To examine the effects of the PG1 on biofilms formed with S. mutans for 19 h on sHA discs, we examined the 3D architecture of the EPS-matrix and in situ cell viability using time-lapse confocal microscopy following biofilms incubation with 1) Control, 2) EPS-degrading enzymes only, 3) PG1 only, or 4) PG1 and EPS-degrading enzymes for up to 60 minutes. The EPS-degrading enzymes used here were dextranase and mutanase, which were capable of digesting the EPS derived from S. mutans by hydrolyzing -1,6 glucosidic linkages and -1,3 glucosidic linkages [Hayacibara et al. 2004]. Dextranase produced from Penicillium sp. was commercially purchased from Sigma (St. Louis, Mo.) and mutanase produced from Trichoderma harzianum was kindly provided by Dr. William H. Bowen (Center for Oral Biology, University of Rochester Medical Center). Dextranase and mutanase were mixed at ratio of 5:1 before applying to biofilms [Mitsue F. Hayacibara et al. 2004]. Alexa Fluor 647-labeled dextran conjugate was used to label the EPS-matrix, while SYTO 9 and PI were used to label live cells and dead cells. Biofilms were examined using confocal fluorescence imaging at 0, 10 30 and 60 min, and subjected to AMIRA/COMSTAT/ImageJ analysis. The total biomass of EPS matrix, live and dead cells in each series of confocal images was quantified using COMSTAT and ImageJ. The ratio of live to the total bacteria at each time point was calculated, and the survival rate of live cells (relative to live cells at 0 min) was plotted. The initial number of viable cells at time point 0 min was considered to be 100%. The percent-survival rate was determined by comparing to time point 0 min.
Microbiological Assays
[0065] At selected time point (19 h), biofilms were removed, homogenized via sonication and subject to microbiological analyses as detailed previously [Xiao J et al. 2012, Koo H et al. 2010]; our sonication procedure does not kill bacteria cells while providing optimum dispersal and maximum recoverable counts. Aliquots of biofilm suspensions were serially diluted and plated on blood agar plates using an antomated Eddy Jet Spiral Plater (IUL, SA, Barcelona, Spain). Meanwhile, propidium monoazide (PMA) combined with quantitative PCR (PMA-qPCR) was used for analysis of S. mutans cell viability as describe Klein M I et al. [Klein M I et al. 2012]. The combination of PMA and qPCR will quantify only the cells with intact membrane (i.e. viable cells) because the PMA cross-linked to DNA of dead cells and extracellular DNA modifies the DNA and inhibits the PCR amplification of the extracted DNA. Briefly, biofilm pellets were resuspended with 500 l TE (50 mM Tris, 10 mM EDTA, pH 8.0). Using a pipette, the biofilm suspensions were transferred to 1.5 ml microcentrifuge tubes; then mixed with PMA. 1.5 l PMA (20 mM in 20% dimethyl sulfoxide; Biotium, Hayward, Calif.) was added to the biofilm suspensions. The tubes were incubated in the dark for 5 min, at room temperature, with occasional mixing. Next, the samples were exposed to light for 3 min (600-W halogen light source). After photo-induced cross-linking, the biofilm suspensions were centrifuged (13,000 g/10 min/4 C.) and the supernatant was discarded. The pellet was resuspended with 100 l TE, following by incubation with 10.9 l lysozyme (100 mg/ml stock) and 5 l mutanylysin (5U/l stock) (37 C./30 min). Genomic DNA was then isolated using the MasterPure DNA purification kit (Epicenter Technologies, Madison, Wis.). Ten pictograms of genomic DNA per sample and negative controls (without DNA) were amplified by MyiQ real-time PCR detection system with iQ SYBR Green supermix (Bio-Rad Laboratories Inc., CA) and S. mutans specific primer (16S rRNA) [Klein M I et al 2010].
Statistical Analysis
[0066] Data are presented as the meanstandard deviation (SD). All the assays were performed in duplicate in at least two distinct experiments. Pair-wise comparisons were made between test and control using Student's t-test. The chosen level of significance for all statistical tests in present study was P<0.05.
[0067] The following examples are provided to illustrate certain embodiments of the invention. They are not intended to limit the invention in any way.
Example I
Creation and Characterization of Transplastomic Lines
[0068] All fusion tags (CTB, PTD, protegrin, retrocyclin) were fused to the green fluorescent protein (smGFP) at N-terminus to evaluate their efficiency and specificity. Fusion constructs encoding these fusion proteins were cloned into chloroplast transformation vectors which were then used to transform plants of interest as described in U.S. patent application Ser. No. 13/101,389 which is incorporated herein by reference. To create plants expressing GFP fusion proteins, tobacco chloroplasts were transformed using biolistic particle delivery system. As seen in the
[0069] To scale up the biomass of each GFP tagged plant leaf material, each homoplasmic line was grown in a temperature- and humidity-controlled greenhouse. Fully grown mature leaves were harvested in late evenings to maximize the accumulation of GFP fusion proteins driven by light-regulated regulatory sequences. To further increase the content of the fusion proteins on a weight basis, frozen leaves were freeze-dried at 40 C. under vacuum. In addition to the concentration effect of proteins, lyophilization increased shelf life of therapeutic proteins expressed in plants more than one year at room temperature [Daniell et al 2015; 2016]. Therefore, in this study, lyophilized and powdered plant cells expressing GFP-fused tag proteins were used for oral delivery to mice.
Expression and Purification of GFP Fused Antimicrobial Peptides from Transplastomic Tobacco.
[0070] Tobacco leaves expressing GFP fused antimicrobial peptides RC101 and PG1 were harvested from greenhouse and subsequently lyophilized for protein extraction and purification. The average expression level of GFP-RC101 was found to be 8.8% of total protein in crude extracts while expression of GFP-PG1 was that of 3.8% of total protein based on densitometry. The difference in expression levels was similar to what was reported previously (Lee et al 2011, Gupta et al, 2015).
[0071] Purification of GFP fused to different antimicrobial peptides (RC101 and PG1) was done in order to test the microbicidal activity against both planktonic and biofilm forming S. mutans. Lyophilized tobacco material expressing different GFP fusions was used for extractions and subsequent downstream processing (See
[0072] Antibacterial Activity of AMPs We first examined the antimicrobial activity of GFP-PG1 using dose-response time-kill studies as shown in
Inhibition of Biofilm Initiation by AMPs
[0073] Preventing the formation of pathogenic oral biofilms is challenging because drugs need to exert therapeutic effects following topical applications. To determine whether GFP-PG1 can disrupt the initiation of the biofilm, we treated saliva coated apatitic (sHA) surface (tooth surrogate) with a single topical treatment of GFP-PG1 for 30 min, and then incubated with actively growing S. mutans cells in cariogenic (sucrose-rich) conditions. We observed substantial impairment of biofilm formation by S. mutans with minimal accumulation of EPS-matrix on the GFP-PG1 treated sHA surface (
Disruption of Pre-Formed Biofilm by AMP with or without EPS-Degrading Enzymes
[0074] Disruption of formed biofilms on surfaces is challenging. Disruption of cariogenic biofilms is particularly difficult because drugs often fail to reach clusters of pathogenic bacteria (such as S. mutans) because of the surrounding exopolysaccharides (EPS)-rich matrix that enmeshes and protects them [Bowen and Koo, 2011]. EPS-degrading enzymes such as dextranase and mutanase could help digest the matrix of cariogenic biofilms, although they are devoid of antibacterial effects. We first optimized the dextranase and/or mutanase required for EPS-matrix disruption without affecting the cell viability (data not shown). As shown in
[0075] To explore this concept, Streptococcus mutans biofilms were pre-formed on sHA surface, and treated topically with GFP-PG1 and EPS-degrading enzymes (Dex/Mut) either alone or in combination. Time-lapsed confocal imaging and quantitative computational analyses were conducted to analyze EPS-matrix degradation and live/dead bacterial cells within biofilms (
Uptake of GFP Fused with Different Tags by Human Periodontal Cells.
[0076] Purified GFP fusion proteins when incubated with human cultured cells, including HPDLS, MMS, SCC-1, GMSC, AGK and osteoblast cells (OBC) revealed interesting results. Although only one representive image of each cell line is presented, uptake studies were performed in triplicate and at least 10-15 images were recorded under confocal microscopy. Without a fusion tag, GFP did not enter any tested human cell line. Both CTB-GFP and PTD-GFP effectively penetrated all tested cell types, although their localization patterns differed. Upon incubation with CTB-GFP, GFP signals localized primarily to the periphery of HPDLSC and MMSC, uniformly small cytoplasmic puncta in SSC-1, AGK, OBC and large cytoplasmic foci in GMSC. PTD-GFP was observed as small cytoplasmic foci in MMSC, variably sized cytoplasmic puncta in HPDLSC, GMSC, AGK, OBC and both the cytoplasm and the periphery of SCC-1 cells. PG1-GFP is the most efficient tag in entering all tested human cells because GFP could be localized at tenfold lower concentrations than any other fusion proteins. PG1-GFP showed exclusively cytoplasmic localization in HPDLSC, SCC-1, GMSC and AGK cells and localized to both the periphery and cytosol in MMSC, but it is only localized to the periphery of OBC. RC101-GFP was localized in SCC-1, GMSC, AGK and OBC, but its localization in HPDLSC was negligible and was undetectable in MMSC cells.
Discussion and Conclusions
[0077] The assembly of cariogenic oral biofilms is a prime example of how pathogenic bacteria accumulate on a surface (teeth), as an extracellular EPS matrix develops. Prevention of cariogenic biofilm formation requires disruption of bacterial accumulation on the tooth surface with a topical treatment. Chlorhexidine (CHX) is considered gold standard for topical antimicrobial therapy (Flemmig and Beikler 2011; Marsh et al 2011; Caufield et al 2001). CHX effectively suppresses mutans streptococci levels in saliva, but it has adverse side effects including tooth staining and calculus formation, and is not recommended for daily preventive or therapeutic use (Autio-Gold 2008). As an alternative, several antimicrobial peptides (AMP) have been developed and tested against oral bacteria, and have shown potential effects against biofilms (albeit with reduced effects vs planktonic cells) (as reviewed by Silva et al., 2012) Unfortunately, most of these studies tested antibiofilm efficacy using continuous, prolonged biofilm exposure to AMPs (several hours) rather than topical treatment regimen as used clinically. Furthermore, synthetic AMPs are expensive to produce making them unaffordable for dental applications. Here, we show a plant-produced AMP, which demonstrates potent effects in controlling biofilm formation with a single, short-term topical treatment of a tooth-surrogate surface.
[0078] Developed cariogenic biofilms are characterized by bacteria embedded in EPS matrix, making biofilm treatment and removal extremely difficult (Paes Leme et al 2006; Koo et al 2013). EPS-rich matrix promotes microbial adhesion, cohesion and protection as well as hindering diffusion (Koo et al 2013; Flemming and Wingender 2010. EPS matrix creates spatial and microenvironmental heterogeneity in biofilms, modulating the growth and protection of pathogens against antimicrobials locally as well as a highly adhesive scaffold that ensures firm attachment of biofilms on tooth surfaces (Flemming and Wingender 2010; Peterson et al. 2015). CHX is far less effective against formed cariogenic biofilms (Hope and Wilson, 2004; Van Strydonck et al 2012; Xiao et al., 2012). The EPS are comprised primarily of a mixture of insoluble (with high content of 1,3 linked glucose) and soluble (mostly 1,6 linked glucose) glucans (Bowen and Koo 2011). Thus, the possibility of using EPS-matrix degrading dextranase or mutanase (from fungi) to disrupt biofilm and prevent dental caries has been explored and included in commercially available over-the-counter mouthwashes (e.g. Biotene PBF). However, topical applications of enzyme alone have generated moderate anti-biofilm/anti-caries effects clinically (Hull 1980), possibly due to lack of antibacterial action and reduced enzymatic activity in the mouth (Balakrishnan et al 2000). Interestingly, a recent in vitro study has shown that a chimeric glucanase comprised of fused dextranase and mutanase is more effective in disrupting plaque-biofilms than either enzymes alone (Jiao et al 2014). However, an approach of combining antimicrobial agents with both EPS-matrix degrading enzymes into a single therapeutic system has not yet been developed, likely due to difficulties associated with cost and formulations. In this study we demonstrate that PG1 together with matrix-degrading enzymes act synergistically and effectively to disrupt cariogenic biofilms. This feasible and efficacious topical antibiofilm approach is capable of simultaneously degrading the biofilm matrix scaffold and killing embedded bacteria using antimicrobial peptides combined with EPS-digesting enzymes.
[0079] Retention of high level antimicrobial activity by protegrin along with GFP fusion opens the door for a number of clinical applications to enhance oral health, beyond disruption of biofilms. In addition to biofilm disruption, enhancing wound healing in the gum tissues is an important clinical need. We recently reported that both protegrin and retrocyclin can enter human mast cells and induce degranulation, an important step in the wound healing process (Gupta et al 2015). Therefore, antimicrobial peptides protegrin and retrocyclin play an important role in killing bacteria in biofilms and initiate wound healing through degranulation of mast cells. In addition, it is important to effectively deliver growth hormones or other proteins to enhance cell adhesion, stimulate osteogenesis, angiogenesis, bone regeneration, differentiation of osteoblasts or endothelial cells. Previously identified cell penetrating peptides have several limitations. CTB enters all cell types via the ubiquitous GM1 receptor and this requires pentameric form of CTB. PTD on the other hand does not enter immune cells (Xiao et al 2016).
[0080] In this study we tested ability of PG1-GFP or RC101-GFP to enter periodontal and gingival cells. PG1-GFP is the most efficient tag in entering periodontal or gingival human cells because GFP signal could be detected even at ten-fold lower concentrations than any other fusion proteins. Although there were some variations in intracellular localization, PG1-GFP effectively entered HPDLSC, SCC-1, GMSC, AGK, MMSC and OBC. In contrast RC101-GFP entered SCC-1, GMSC, AGK and OBC but its localization in HPDLSC and MMSC cells were poor or undetectable. Therefore, this study has identified a novel role for protegrin in delivering drugs to osteoblasts, periodontal ligament cells, gingival epithelial cells or fibroblasts to enhance oral health. It is feasible to release protein drugs synthesized in plant cells by mechanical grinding and protein drugs bioencapsulated in lyophilized plant cells embedded in chewing gums provides an ideal mode of drug delivery for their slow and sustained release for longer duration. This overcomes a major limitation of current oral rinse formulationsshort duration of contact of antimicrobials on the gum/dental surface.
[0081] Beyond topical applications, protein drugs fused with protegrin expressed in plant cells can be orally delivered to deeper layers of gum tissues in a non-invasive manner and increase patient compliance. Protein drugs bioencapsulated in plants can be stored for many years at room temperature without losing their efficacy (Su et al 2015; Daniell et al 2016). The high cost of current protein drugs is due to their production in prohibitively expensive fermenters, purification, cold transportation/storage, short shelf life and sterile delivery methods. All these challenges could be eliminated using this novel drug delivery concept to enhance oral health. Recent FDA approval of plant cells for production of protein drugs (Walsh 2014) augurs well for clinical advancement of this novel concept.
REFERENCES
[0082] Agrawal P, Verma D, Daniell H. 2011. Expression of Trichoderma reesei -mannanase in tobacco chloroplasts and its utilization in lignocellulosic woody biomass hydrolysis. PLoS One. 6:e29302. [0083] Ajdi D, McShan W M, McLaughlin R E, Savic G, Chang J, Carson M B, Primeaux C, Tian R, Kenton S, Jia H, Lin S, Qian Y, Li S, Zhu H, Najar F, Lai H, White J, Roe B A, Ferretti J J. 2002. Genome sequence of Streptococcus mutans UA159, a cariogenic dental pathogen. Proc Natl Acad Sci USA 99:14434-14439. [0084] Autio-Gold J. 2008. The role of chlorhexidine in caries prevention. Oper Dent. 33(6):710-6. [0085] Banas J A, Vickerman M M. 2003. Glucan-binding proteins of the oral streptococci. Crit Rev Oral Biol Med. 14(2):89-99. [0086] Balakrishnan M, Simmonds R S, Tagg J R. 2000. Dental caries is a preventable infectious disease. Aust Dent J. 45:235-45. [0087] Bowen W H. 1972. The effect of dextranase on caries activity in monkeys (macaca irus). Caries Res. 6:75-6. [0088] Bowen W H and Koo H. 2011. Biology of Streptococcus mutans-Derived glucosyltransferases: Role in extracellular matrix formation of cariogenic biofilms. Caries Res 45:69-86. [0089] Burne R A. 1998. Oral streptococci . . . products of their environment. J Dent Res. 77(3):445-52. [0090] Caufield P W, Dasanayake A P, Li Y. 2001. The antimicrobial approach to caries management. J Dent Educ 65:1091-5. [0091] Chen J, Falla T J, Liu H, Hurst M A, Fujii C A, Mosca D A, Embree J R, Loury D J, Radel P A, Cheng Chang C, Gu L, Fiddes J C. 2000. Development of protegrins for the treatment and prevention of oral mucositis: structure-activity relationships of synthetic protegrin analogues. Biopolymers. 55:88-98. [0092] da Silva B R, de Freitas V A, Nascimento-Neto L G, Carneiro V A, Arruda F V, de Aguiar A S, Cavada B S, Teixeira E H. 2012. Antimicrobial peptide control of pathogenic microorganisms of the oral cavity: a review of the literature. Peptides 36: 315-321. [0093] Daniell H, Lin C S, Yu M, Chang W J. 2016. Chloroplast genomes: diversity, evolution and applications in genetic engineering. Genome Biology, in press [0094] DeGray G, Rajasekaran K, Smith F, Sanford J, Daniell H. 2001. Expression of an antimicrobial peptide via the chloroplast genome to control phytopathogenic bacteria and fungi. Plant Physiol. 127(3):852-62. [0095] Dige I, Raarup M K, Nyengaard J R, Kilian M, Nyvad B. 2009. Actinomyces naeslundii in initial dental biofilm formation. Microbiology 155:2116-2126. [0096] Dye B A, Hsu K L, Afful J. 2015. Prevalence and Measurement of Dental Caries in Young Children. Pediatr Dent 37: 200-216. [0097] Flemmig T F, Beikler T. 2011. Control of oral biofilms. Periodontol 2000. 55:9-15. [0098] Flemming H C, Wingender J. 2010. The biofilm matrix. Nat Rev Microbiol. 8:623-33. [0099] Giles F J, Miller C B, Hurd D D, Wingard J R, Fleming T R, Sonis S T, Bradford W Z, Pulliam J G, Anaissie E J, Beveridge R A, Brunvand M M, Martin P J; PROMPT-CT Trial Investigators. 2003. A phase III, randomized, double-blind, placebo-controlled, multinational trial of iseganan for the prevention of oral mucositis in patients receiving stomatotoxic chemotherapy (PROMPT-CT trial). Leuk Lymphoma. 44:1165-72. [0100] Guggenheim B, Regolati B, Schmid R, Mhlemann HR. 1980. Effects of the topical application of mutanase on rat caries. Caries Res. 14:128-35. [0101] Guo L, McLean J S, Yang Y, Eckert R, Kaplan C W, Kyme P, Sheikh O, Varnum B, Lux R, Shi W, He X. 2015. Precision-guided antimicrobial peptide as a targeted modulator of human microbial ecology. Proc Natl Acad Sci USA 112: 7569-7574. [0102] Gupta, Kshitij, Akhil Kotian, Hariharan Subramanian, Henry Daniell, and Hydar All. Activation of Human Mast Cells by Retrocyclin and Protegrin Highlight Their Immunomodulatory and Antimicrobial Properties. Oncotarget 6, no. 30 (Oct. 6, 2015): 28573-87. doi: 10.18632/oncotarget.5611. [0103] Hajishengallis E, Parsaei M, Klein M I, Koo H. 2015. Advances in the microbial etiology and pathogenesis of early childhood caries. Molecular Oral Microbiology doi: 10.1111/omi.12152. [0104] Hall-Stoodley L, Costerton J W, Stoodley P. 2004. Bacterial biofilms: from the natural environment to infectious diseases. Nat Rev Microbiol 2: 95-108. [0105] Hayacibara M F, Koo H, Vacca-Smith A M, Kopec L K, Scott-Anne K, Cury J A, Bowen W H. 2004. The influence of mutanase and dextranase on the production and structure of glucans synthesized by streptococcal glucosyltransferases. Carbohydrate Research 339: 2127-2137. Hope C K and Wilson M. 2004. Analysis of the effects of chlorhexidine on oral biofilm vitality and structure based on viability profiling and an indicator of membrane integrity. Antimicrob Agents Chemother 48:1461-8. [0106] Hull P S. 1980. Chemical inhibition of plaque. J Clin Periodontol. 7:431-42. [0107] Jin S, Daniell H. 2015. The Engineered Chloroplast Genome Just Got Smarter. Trends Plant Sci 20:622-640 [0108] Jiao Y L, Wang S J, Lv M S, Jiao B H, Li W J, Fang Y W, Liu S. 2014. Characterization of a marine-derived dextranase and its application to the prevention of dental caries. J Ind Microbiol Biotechnol. 41:17-26. [0109] Jones C G. 1997. Chlorhexidine: is it still the gold standard? Periodontol 2000 15: 55-62. Jin S, Kanagaraj A, Verma D, Lange T, Daniell H. 2011. Release of hormones from conjugates: chloroplast expression of -glucosidase results in elevated phytohormone levels associated with significant increase in biomass and protection from aphids or whiteflies conferred by sucrose esters. Plant Physiol. 155:222-35. [0110] Kassebaum N J, Bernab6 E, Dahiya M, Bhandari B, Murray C J, Marcenes W. 2015. Global burden of untreated caries: A systematic review and metaregression. J Dent Res. 94:650-658. [0111] Kohli N, Westerveld D R, Ayache A C, Verma A, Shil P, Prasad T, Zhu P, Chan S L, Li Q, Daniell H. 2014. Oral delivery of bioencapsulated proteins across blood-brain and blood-retinal barriers. Mol Ther. 22:535-46. [0112] Klein M I, Scott-Anne K M, Gregoire S, Rosalen P L, Koo H. Molecular approaches for viable bacterial population and transcriptional analyses in a rodent model of dental caries. Molecular Oral Microbiology 27: 350-361. [0113] Klein M I, DeBaz L, Agidi S, Lee H, Xie G, Lin A H M, Hamaker B R, Lemos J A, Koo H. 2010. Dynamics of Streptococcus mutans transcriptome in response to starch and sucrose during biofilm development. PLoS One: e1347840. [0114] Koo H, Falsetta M L, Klein M I. 2013. The exopolysaccharide matrix: a virulence determinant of cariogenic biofilm. J Dent Res. 92:1065-73. [0115] Koo H, Xiao J, Klein M I, Jeon J G. 2010. Exopolysaccharides produced by Streptococcus mutans glucosyltransferases modulate the establishment of microcolonies within multispecies biofilms. J Bacteriol 192:3024-3032. [0116] Kwon K C, Verma D, Singh N D, Herzog R, Daniell H. 2013. Oral delivery of human biopharmaceuticals, autoantigens and vaccine antigens bioencapsulated in plant cells. Adv Drug Deliv Rev. 65(6):782-99. [0117] Kwon K C, Nityanandam R, New J S, Daniell H. 2013. Oral delivery of bioencapsulated exendin-4 expressed in chloroplasts lowers blood glucose level in mice and stimulates insulin secretion in beta-TC6 cells. Plant Biotechnol J. 11:77-86. [0118] Odd F C. 1988. Candida and candidosis. 2.sup.nd ed. Bailliere Tindall, London, United Kingdom. [0119] Peterson B W, He Y, Ren Y, Zerdoum A, Libera M R, Sharma P K, van Winkelhoff A J, Neut D, Stoodley P, van der Mei H C, Busscher H J. 2015. Viscoelasticity of biofilms and their recalcitrance to mechanical and chemical challenges. FEMS Microbiol Rev 39: 234-245. [0120] Lakshmi P S, Verma D, Yang X, Lloyd B, Daniell H. 2013. Low cost tuberculosis vaccine antigens in capsules: expression in chloroplasts, bio-encapsulation, stability and functional evaluation in vitro. PLoS One. 8:e54708. [0121] Lai J R, Huck B R, Weisblum B, Gellman S H. 2002. Design of non-cysteine-containing antimicrobial beta-hairpins: structure-activity relationship studies with linear protegrin-1 analogues. Biochemistry. 41:12835-42. [0122] Lee S B, Li B, Jin S, Daniell H. 2011. Expression and characterization of antimicrobial peptides Retrocyclin-101 and Protegrin-1 in chloroplasts to control viral and bacterial infections. Plant Biotechnol J. 9:100-15. [0123] Ma Z, Wei D, Yan P, Zhu X, Shan A, Bi Z. 2015. Characterization of cell selectivity, physiological stability and endotoxin neutralization capabilities of -helix-based peptide amphiphiles. Biomaterials. 52:517-30. [0124] Marsh P D, Moter A, Devine D A. 2011. Dental plaque biofilms: communities, conflict and control. Periodontology 2000. 55:16-35. [0125] Morassutti, Carla, Francesca De Amicis, Barbara Skerlavaj, Margherita Zanetti, and Stefano Marchetti. Production of a Recombinant Antimicrobial Peptide in Transgenic Plants Using a Modified VMA Intein Expression System. FEBS Letters 519: 141-46. [0126] Ohashi, Tomoo, Stephane D. Galiacy, Gina Briscoe, and Harold P. Erickson. An Experimental Study of GFP-Based FRET, with Application to Intrinsically Unstructured Proteins. Protein Science: A Publication of the Protein Society 16, no. 7 (July 2007): 1429-38. doi: 10.1110/ps.072845607. [0127] Otsuka R, Imai S, Murata T, Nomura Y, Okamoto M, Tsumori H, Kakuta E, Hanada N, Momoi Y. 2015. Application of chimeric glucanase comprising mutanase and dextranase for prevention of dental biofilm formation. Microbiol Immunol. 59:28-36. [0128] Paes Leme A F, Koo H, Bellato C M, Bedi G, Cury J A. 2006. The role of sucrose in cariogenic dental biofilm formation-new insight. J Dent Res. 85:878-87. [0129] Sassi A B, Bunge K E, Hood B L, Conrads T P, Cole A M, Gupta P, Rohan L C. 2011. Preformulation and stability in biological fluids of the retrocyclin RC-101, a potential anti-HIV topical microbicide. AIDS Res Ther. 8:27. [0130] Sassi A B, Cost M R, Cole A L, Cole A M, Patton D L, Gupta P, Rohan L C. 2011. Formulation development of retrocyclin 1 analog RC-101 as an anti-HIV vaginal microbicide product. Antimicrob Agents Chemother. 55:2282-9. [0131] Skosyrev, Vitaly S., Natalja V. Rudenko, Alexander V. Yakhnin, Vasily E. Zagranichny, Lubov I. Popova, Mikhail V. Zakharov, Andrey Yu Gorokhovatsky, and Leonid M. Vinokurov. EGFP as a Fusion Partner for the Expression and Organic Extraction of Small Polypeptides. Protein Expression and Purification 27, no. 1 (January 2003): 55-62. [0132] Trotti A, Garden A, Warde P, Symonds P, Langer C, Redman R, Pajak T F, Fleming T R, Henke M, Bourhis J, Rosenthal D I, Junor E, Cmelak A, Sheehan F, Pulliam J, Devitt-Risse P, Fuchs H, Chambers M, O'Sullivan B, Ang K K. 2004. A multinational, randomized phase III trial of iseganan HCl oral solution for reducing the severity of oral mucositis in patients receiving radiotherapy for head-and-neck malignancy. Int J Radiat Oncol Biol Phys. 58:674-81. [0133] Van Strydonck D A, Slot D E, Van der Velden U, Van der Weijden F. 2012. Effect of a chlorhexidine mouthrinse on plaque, gingival inflammation and staining in gingivitis patients: a systematic review. J Clin Periodontol. 39:1042-55. [0134] Verma D, Kanagaraj A, Jin S, Kolattukudy P E, Daniell H. 2010. Chloroplast-derived enzyme cocktails hydrolyse lignocellulosic biomass and release fermentable sugars. Plant Biotechnol J. 8:332-50. [0135] Walsh G. 2014. Biopharmaceutical benchmarks 2014. Nat Biotechnol. 32:992-1000. [0136] Wang W, Cole A M, Hong T, Waring A J, Lehrer R I. 2003. Retrocyclin, an antiretroviral theta-defensin, is a lectin. J Immunol. 170(9):4708-16. [0137] Xiao, Yuhong, Kwang-Chul Kwon, Brad E. Hoffman, Aditya Kamesh, Noah T. Jones, Roland W. Herzog, and Henry Daniell. Low Cost Delivery of Proteins Bioencapsulated in Plant Cells to Human Non-Immune or Immune Modulatory Cells. Biomaterials 80 (February 2016): 68-79. doi: 10.1016/j.biomaterials.2015.11.051. [0138] Xiao, J. et al. 2012. The exopolysaccharide matrix modulates the interaction between 3D architecture and virulence of a mixed-species oral biofilm. PLoS Pathog 8, e1002623. [0139] Yakhnin, A. V., L. M. Vinokurov, A. K. Surin, and Y. B. Alakhov. Green Fluorescent Protein Purification by Organic Extraction. Protein Expression and Purification 14, no. 3 (December 1998): 382-86. doi:10.1006/prep.1998.0981.
Example II
Creation of Chloroplast Vectors Expressing AMP, Biofilm Degrading Enymes and Fusion Proteins Thereof
[0140] Effective treatment of biofilm-associated infections is problemantic as antimicrobials often fail to reach clusters of microbes present within the surrounding extracellular matrix that enmeshes and protects them. Furthermore, development of novel therapies against biofilm-related oral diseases and maintenance of oral health needs to be cost-effective and readily accessible.
[0141] To ensure a continued supply of reagents, dextranase/mutanase and protegrin/retrocyclin are expressed independently and as fusion proteins in tobacco and other plant chloroplasts, such as lettuce. Proteins will be produced and used in low cost purification strategies. Tobacco plants produce a million seeds, and thus, it is feasible to scale up production easily. Each acre of tobacco will produce up to 40 metric tons of biomass, facilitating low cost large scale production of AMP, enzymes and fusion constructs encoding the same. In another approach, the proteins are produced in an edible plant such as lettuce.
[0142] Several dextranases (Dex) and mutanases (Mut) have been isolated from fungi and bacteria and characterized for their enzymatic activity. Optimal dextranase and mutanase enzymes should have enzymatic properties suitable for human oral environment. Based on short duration of oral treatments, strong binding/retention property to plaque-biofilms and catalytic activity to both types of EPS (dextrans and mutans) are highly desirable. The enzymes added in commercial dextranase-containing mouthwashes (e.g. Biotene) are largely derived from fungi (Penicillium sp. and Chaetomium erraticum). However, fungal dextranases show higher temperature optima (50-60 C.) than bacterial dextranases (35-40 C.). Furthermore, bacterial dextranases are more stable and effective at oral temperature (37 C.) and are suitable for dental caries-prevention. Recently, a dextranase from Arthrobacter sp strain Arth410 showed superior dextran degradation properties at optimal temperatures (35-45 C.) and pH values (pH 5-7) found in mouth and in cariogenic biofilms when compared to fungal dextranases. In addition, topical applications of bacterial dextranase are more effective in reducing dental caries in vivo than fungal dextranse. Likewise, a bacterial mutanase from Paenibacillus sp. strain RM1 shows that biofilm was effectively degraded by 6 hr incubation even after removal of the mutanase, preceded by first incubation with the biofilms for 3 min. Also, when compared to other microbial species, RM1 mutanase shows enhanced biofilm-degrading property. Notably, fungal enzymes require glycosylation, which precludes their expression in chloroplasts. In addition, immunogenicity of glycoproteins in human system may raise additional regulatory concerns. Therefore, the present invention involves use of bacterial dextranase and mutanase for expression in chloroplasts.
[0143] In order to increase the production of Arth410 dextranase and RM1 mutanase protein in chloroplasts, both sequences have been codon optimized for chloroplast expression. See
Retrocyclin and Protegrin.
[0144] In order to maximize synthesis and reduce toxicity of AMPs, ten tandem repeats of PG1 or RC101, separated by protease cleavage sites as shown in
[0145] As mentioned above, the sequences encoding the AMP/biofilm degrading enzymes are optionally codon-optimized prior to insertion into chloroplast transformation vectors, such as pLD. Chloroplast transformation relies upon a double homologous recombination event. Therefore, chloroplast vectors comprise homologous regions to the chloroplast genome which flank the expression cassette encoding the heterologous proteins of interest, which facilitate insertion of the transgene cassettes into the intergenic spacer region of the chloroplast genome, without disrupting any functional genes. Although any intergenic spacer region could be used to insert transgenes, the most commonly used site of transgene integration is the transcriptionally active intergenic region between the trnI-trnA genes (in the rrn operon), located within the IR regions of the chloroplast genome (
Purification Strategies
[0146] A hydrophobic interaction column (HIC; TOSOH Butyl Toyopearl 650m) can be used to purify PG1 fused with Green Florescent Protein (GFP). The GFP selectively binds to the HIC and facilitates RclOl/PG1 to >90% purity. Despite using the expensive HIC chromatography method, recovery is very poor (<20%). To address this problem and enhance yield, 10 tandem repeats of PG1 with an elastin like biopolymer (GVGVP (SEQ ID NO: 11);
[0147] In an alternative approach, a signal peptide is fused with dextranase or mutanase for expression in E. coli, where the signal peptide will result in secretion of the enzymes into the extracellular media. In addition, secretory proteins should pass through two membrane systems of E. coli, during which they pass through the periplasmic environment where disulfide isomerases, foldases and chaperones are present. Therefore, correct folding and disulfide bond formation of secretory proteins are facilitated by the enzymes, resulting in enhancement of biological activity of proteins (ideal for AMPs). Another merit of this production strategy is the low level of proteolytic activity in the culture medium which serves to enhance the stability of the recombinant protein. The signal sequence of the secreted protein is cleaved during the export process, creating an authentic N-terminus to the native protein. There are several molecules useful for translocating proteins to extracellular media, such as TAT, SRP, or SecB-dependent pathways. However, rather than working independently, the different pathways closely interact with each other. Both SRP and SecB-dependent pathways can work together in targeting of a single protein. Also, under Sec-deficient conditions, translocation of Sec pathway substrates can be rescued by TAT systems.
[0148] Among numerous signal sequences, outer membrane protein A (OmpA) and Seq X (derived from lac Z) signal peptide demonstrate superior export functions and are capable of exporting fused protein into extracellular medium at up to 4 g/L and 1 g/L, respectively. Therefore, these signal sequences are used for efficient exporting of Arth 410 Dex and RM1 Mut to extracellular milieu. Accumulation of the dextranase and mutanase exported into media will be determined by protein quantitation and enzyme assays.
[0149] Successful expression of these proteins in E. coli has been achieved. See Western blot results shown in
[0150] The AMP-enzyme combination effectively disrupts cariogenic biofilm formation and the onset of cavitation in vivo. Furthermore, AMP-enzyme fusion protein appears to be superior to current chemical modalities for antimicrobial therapy and caries prevention.
[0151] As mentioned previously, effective AMP-enzyme (independently or in combination) can be expressed in lettuce chloroplasts under the control of endogenous lettuce regulatory elements, for large scale GLP production and stability assessment. A key advantage is the lower production cost by elimination of prohibitively expensive purification processes. Freeze-dried leaf material expressing AMP/enzymes can be stored at ambient temperatures for several months or years while maintaining their integrity and functionality. See
[0152] The steps for producing the AMP/enzymes or fusions thereof are shown in
[0153] AMP-enzyme(s) expressed in the edible plants are preferably orally delivered (topically) when used for treatment of oral diseases and the prevention and inhibition of dental carie formation. For enhanced lysis of plant cells within the oral cavity, AMP/enzyme expressing plant cells are optionally mixed with plant cells expressing cell wall degrading enzymes, described in U.S. patent application Ser. No. 12/396,382, also incorporated herein by reference. Chewing gum tablet preparation is shown in
[0154] It is clear from these data that gum tablets comprising the AMP-enzyme fusion proteins of the invention will deliver the active material for a suitable time period to achieve bacterial kill and plaque or biofilm degradation. However, oral rinses such as Listerine can also be employed to deliver the AMP-enzyme fusion proteins or combinations of the invention.
[0155] AMPS have the ability to stimulate innate immunity and wound healing, in addition to antimicrobial activity. Harnessing this novel mast cell host defense feature of AMPs in addition to their antimicrobial properties expands their clinical applications. Biofilm-associated caries is the most challenging model for development of topical therapeutics. When developed, such topical drug delivery can be easily adapted to other biofilms, as matrix formation hinders drug efficacy in many other biofilm-associated diseases. Matrix is inherent in all biofilms thus the application goes beyond the biofilm in the mouth. The biofilm inhibiting compositions described herein can also be employed in coating stents, artificial joints, implants, valves and other medical devices inserted into the human body for the treatment of disease.
[0156] As discussed above, the AMP/enzymes, or leaves expressing the same can be incorporated into a chewing gum for effective topical application of the same for the treatment of oral disease. The compositions may also be incorporated into an oral rinse, such as Listerine. As mentioned previously, other anti dental carrie agents such as fluoride or CHX may included in such gums or oral rinses.
[0157] The references below in Table 2 describe a number of different mutanases from a variety of biological sources. Each of these references incorporated herein by reference.
TABLE-US-00002 Reference Year Mutanase resource 1 Otsuka R, Imai S, Murata T, et al. (2014) Application of chimeric glucanase comprising 2014 Paenibacillus humicus NA1123 mutanase and dextranase for prevention of dental biofilm formation. Microbiology and Immunology n/a-n/a 2 Wiater A, Pleszczynska M, Rogalski J, Szajnecka L & Szczodrak J (2013) Purification 2013 Trichoderma harzianum CCM F-340 and properties of an alpha-(1 --> 3)-glucanase (EC 3.2.1.84) from Trichoderma harzianum and its use for reduction of artificial dental plaque accumulation. Acta Biochim Pol 60: 123-128. 3 Wiater A, Janczarek M, Choma A, Prochniak K, Komaniecka I & Szczodrak J (2013) 2013 Trichoderma harzianum strain CCM F-340 Water-soluble (1 .fwdarw. 3), (1 .fwdarw. 4)--d-glucan from mango as a novel inducer of cariogenic biofilm-degrading enzyme. International Journal of Biological Macromolecules 58: 199-205. 4 Tsumori H, Shimamura A, Sakurai Y & Yamakami K (2012) Combination of Mutanase 2012 Paenibacillus humicus and Dextranase Effectively Suppressed Formation of Insoluble Glucan Biofilm by Cariogenic Streptococci. Interface Oral Health Science 2011, (Sasaki K, Suzuki O & Takahashi N, ed.{circumflex over ()}eds.), p.{circumflex over ()}pp. 215-217. Springer Japan. 5 Xiao J, Klein MI, Falsetta ML, et al. (2012) The Exopolysaccharide Matrix Modulates the 2012 Trichoderma harzianum Interaction between 3D Architecture and Virulence of a Mixed-Species Oral Biofilm. PLoS Pathog 8: e1002623. 6 Tsumori H, Shimamura A, Sakurai Y & Yamakami K (2011) Mutanase of 2011 Paenibacillus humicus <i>Paenibacillus humicus</i> from Fermented Food Has a Potential for Hydrolysis of Biofilms Synthesized by <i>Streptococcus mutans</i>. Journal of Health Science 57: 420-424. 7 Wiater A, Szczodrak J & Pleszczynska M (2008) Mutanase induction in Trichoderma 2008 Trichoderma harzianum harzianum by cell wall of Laetiporus sulphureus and its application for mutan removal from oral biofilms. J Microbiol Biotechnol 18: 1335-1341. 8 Shimotsuura I, Kigawa H, Ohdera M, Kuramitsu H K & Nakashima S (2008) 2008 Paenibacillus sp. strain RM1 Biochemical and Molecular Characterization of a Novel Type of Mutanase from Paenibacillus sp. Strain RM1: Identification of Its Mutan-Binding Domain, Essential for Degradation of Streptococcus mutans Biofilms. Applied and Environmental Microbiology 74: 2759-2765 9 Shimotsuura I, Kigawa H, Ohdera M, Kuramitsu H K & Nakashima S (2008) 2008 Paenibacillus sp. strain RM1 Biochemical and Molecular Characterization of a Novel Type of Mutanase from Paenibacillus sp. Strain RM1: Identification of Its Mutan-Binding Domain, Essential for Degradation of Streptococcus mutans Biofilms. Applied and Environmental Microbiology 74: 2759-2765. 10 Wiater A, Szczodrak J; Pleszczyska M; Prochniak K(2005) Production and use of 2005 Trichoderma harzianum CCM F-340 mutanase from Trichoderma harzianum for effective degradation of streptococcal mutans. Braz. J. Microbiol. vol. 36 no. 2 11 Hayacibara M F, Koo H, Vacca Smith A M, Kopec L K, Scott-Anne K, Cury J A & Bowen 2004 Trichoderma harzianum W H (2004) The influence of mutanase and dextranase on the production and structure of glucans synthesized by streptococcal glucosyltransferases. Carbohydrate Research 339: 2127-2137 12 Kopec LK, Vacca Smith A M, Wunder D, Ng-Evans L & Bowen W H (2001) Properties of 2001 Trichoderma harzianum Streptococcus sanguinis glucans formed under various conditions. Caries Res 35: 67-74. 13 Kopec LK, Vacca-Smith A M & Bowen W H (1997) Structural aspects of glucans formed 1997 Trichoderma harzianum CCM F-341 in solution and on the surface of hydroxyapatite. Glycobiology 7: 929-934. 14 Vacca-Smith A M, Venkitaraman A R, Quivey R G, Jr. & Bowen W H (1996) Interactions of 1996 Trichoderma harzianum streptococcal glucosyltransferases with alpha-amylase and starch on the surface of saliva-coated hydroxyapatite. Arch Oral Biol 41: 291-298. 15 Quivey R G, Jr. & Kriger P S (1993) Raffinose-induced mutanase production from 1993 Trichoderma harzianum Trichoderma harzianum. FEMS Microbiol Lett 112: 307-312. 16 Inoue M, Yakushiji T, Mizuno J, Yamamoto Y & Tanii S (1990) Inhibition of dental 1990 Pseudomonas sp. strain plaque formation by mouthwash containing an endo-alpha-1, 3 glucanase. Clin Prev Dent 12: 10-14. 17 Inoue M, Yakushiji T, Katsuki M, Kudo N & Koga T (1988) Reduction of the adherence 1988 Pseudomonas sp. of Streptococcus sobrinus insoluble -d-glucan by endo-(1.fwdarw.3)--d-glucanase. Carbohydrate Research 182: 277-286. 18 Kelstrup J, Holm-Pedersen P & Poulsen S (1978) Reduction of the formation of dental 1978 Trichoderma harzianum plaque and gingivitis in humans by crude mutanase. European Journal of Oral Sciences 86: 93-102. 19 Kelstrup J, Holm-Pedersen P & Poulsen S (1978) Reduction of the formation of dental 1978 Trichoderma harzianum plaque and gingivitis in humans by crude mutanase. Scand J Dent Res 86: 93-102. 20 Guggenheim B, Regolati B & Mhlemann H R (1972) Caries and Plaque Inhibition by 1972 Trichoderma harzianum OMZ 779 Mutanase in Rats. Caries Research 6: 289-297.
Additional biofilm degrading enzyme encoding sequences useful in the practice of the invention, include without limitation,
I) Paenibacillus humicus NA1123
See also http://www.ncbi.nlm.nih.gov/nuccore/AB489092
Genbank AB489092
Length:1,146
Mass (Da):119,007
[0158] Reference: Otsuka R, et al. Microbiol Immunol. 2015 January; 59(1):28-36.
2. The Protein Sequence of Mutanase from Paenibacillus Humicus NA1123
TABLE-US-00003 >gi|257153265|dbj|BAI23187.1|putative mutanase [Paenibacillus humicus] (SEQ ID NO: 12) MRIRTKYMNWMLVLVLIAAGFFQAAGPIAPATAAGGANLTLGKTVTASGQ SQTYSPDNVKDSNQGTYWESTNNAFPQWIQVDLGASTSIDQIVLKLPSGW ETRTQTLSIQGSANGSTFTNIVGSAGYTFNPSVAGNSVTINFSAASARYV RLNFTANTGWPAGQLSELEIYGATAPTPTPTPTPTPTPTPTPTPTPTVTP APSATPTPTPPAGSNIAVGKSITASSSTQTYVAANANDNNTSTYWEGGSN PSTLTLDFGSNQSITSVVLKLNPASEWGTRTQTIQVLGADQNAGSFSNLV SAQSYTFNPATGNTVTIPVSATVKRLQLNITANSGAPAGQIAEFQVFGTP APNPDLTITGMSWTPSSPVESGDITLNAVVKNIGTAAAGATTVNFYLNNE LAGTAPVGALAAGASANVSINAGAKAAATYAVSAKVDESNAVIEQNEGNN SYSNPTNLVVAPVSSSDLVAVTSWSPGTPSQGAAVAFTVALKNQGTLASA GGAHPVTVVLKNAAGATLQTFTGTYTGSLAAGASANISVGSWTAASGTYT VSTTVAADGNEIPAKQSNNTSSASLTVYSARGASMPYSRYDTEDAVLGGG AVLRTAPTFDQSLIASEASGQKYAALPSNGSSLQWTVRQGQGGAGVTMRF TMPDTSDGMGQNGSLDVYVNGTKAKTVSLTSYYSWQYFSGDMPADAPGGG RPLFRFDEVHFKLDTALKPGDTIRVQKGGDSLEYGVDFIEIEPIPAAVAR PANSVSVTEYGAVANDGKDDLAAFKAAVTAAVAAGKSLYIPEGTFHLSSM WEIGSATSMIDNFTVTGAGIWYTNIQFTNPNASGGGISLRIKGKLDFSNI YMNSNLRSRYGQNAVYKGFMDNFGTNSIIHDVWVEHFECGMWVGDYAHTP AIYASGLVVENSRIRNNLADGINFSQGTSNSTVRNSSIRNNGDDGLAVWT SNTNGAPAGVNNTFSYNTIENNWRAAAIAFFGGSGHKADHNYIIDCVGGS GIRMNTVFPGYHFQNNTGITFSDTTIINSGTSQDLYNGERGAIDLEASND AIKNVTFTNIDIINAQRDGVQIGYGGGFENIVFNNITIDGTGRDGISTSR FSGPHLGAAIYTYTGNGSATFNNLVTRNIAYAGGNYIQSGFNLTIK
3. Sequence of mRNA from Paenibacillus Humicus NA1123
TABLE-US-00004 >gi|257153264|dbj|AB489092.1|Paenibacillus humicus mut gene for putative mutanase, complete cds (SEQ ID NO: 13) 1 aaaggaggat cgccaaccaa tcatcccagc aaagaaggtg atggcagccc aagaattgaa 61 agcgctttga atttggaata tacggatttg gccgacctgc tgattcagtc gtattcaagc 121 gattatgccg cgaaccaatc gaacccgagg aggactataa tgcgtatccg cactaaatat 181 atgaactgga tgttggtgct cgtcctgatc gccgccggct tcttccaggc tgccggcccc 241 atcgctcccg ccaccgctgc aggaggcgcg aatctgacgc tcggcaaaac cgtcaccgcc 301 agcggccagt cgcagacgta cagccccgac aatgtcaagg acagcaatca gggaacttac 361 tgggaaagca cgaacaacgc cttcccgcag tggatccaag tcgaccttgg cgccagcacg 421 agcatcgacc agatcgtgct caagcttccg tccggatggg agactcgtac gcaaacgctc 481 tcgatacagg gcagcgcgaa cggctcgacg ttcacgaaca tcgtcggatc ggccgggtat 541 acattcaatc catccgtcgc cggcaacagc gtcacgatca acttcagcgc tgccagcgcc 601 cgctacgtcc gcctgaattt cacggccaat acgggctggc cagcaggcca gctgtcggag 661 cttgagatct acggagcgac ggcgccaacg cctactccca cgcctactcc aacaccaacg 721 ccaacgccaa caccaacgcc aacccctaca gtaacccctg cgccttcggc cacgccgact 781 ccgactcctc cggcaggcag caacatcgcc gtagggaaat cgattacagc ctcttccagc 841 acgcagacct acgtagctgc aaatgcaaat gacaacaata catccaccta ttgggaggga 901 ggaagcaacc cgagcacgct gactctcgat ttcggttcca accagagcat cacttccgtc 961 gtcctcaagc tgaatccggc ttcggaatgg gggactcgca cgcaaacgat ccaagttctt 1021 ggagcggatc agaacgccgg ctccttcagc aatctcgtct ctgcccagtc ctatacgttc 1081 aatcccgcaa ccggcaatac ggtgacgatt ccggtctccg cgacggtcaa gcgcctccag 1141 ctgaacatta cggcgaactc cggcgcccct gccggccaga ttgccgagtt ccaagtgttc 1201 ggcacgccag cgcctaatcc ggacttgacc attaccggca tgtcctggac tccgtcttct 1261 ccggtcgaga gcggcgacat tacgctgaac gccgtcgtca agaacatcgg aactgcagct 1321 gcaggcgcca cgacggtcaa tttctacctg aacaacgaac tcgccggcac cgctccggta 1381 ggcgcgcttg cggcaggagc ttctgcaaat gtatcgatca atgcaggcgc caaagcagcc 1441 gcaacgtatg cggtaagcgc caaagtcgac gagagcaacg ccgtcatcga gcagaatgaa 1501 ggcaacaaca gctactcgaa cccgactaac ctcgtcgtag cgccggtgtc cagctccgac 1561 ctcgtcgccg tgacgtcatg gtcgccgggc acgccgtcgc agggagcggc ggtcgcattt 1621 accgtcgcgc ttaaaaatca gggtacgctg gcttccgccg gcggagccca tcccgtaacc 1681 gtcgttctga aaaacgctgc cggagcgacg ctgcaaacct tcacgggcac ctacacaggt 1741 tccctggcag caggcgcatc cgcgaatatc agcgtgggca gctggacggc agcgagcggc 1801 acctataccg tctcgacgac ggtagccgct gacggcaatg aaattccggc caagcaaagc 1861 aacaatacga gcagcgcgag cctcacggtc tactcggcgc gcggcgccag catgccgtac 1921 agccgttacg acacggagga tgcggtgctc ggcggcggag ctgtcctgag aacggcgccg 1981 acgttcgatc agtcgctcat cgcttccgaa gcatcgggac agaaatacgc cgcacttccg 2041 tccaacggct ccagcctgca gtggaccgtc cgtcaaggcc agggcggtgc aggcgtcacg 2101 atgcgcttca cgatgcccga cacgagcgac ggcatgggcc agaacggctc gctcgacgtc 2161 tatgtcaacg gaaccaaagc caaaacggtg tcgctgacct cttattacag ctggcagtat 2221 ttctccggcg acatgccggc tgacgctccg ggcggcggca ggccgctctt ccgcttcgac 2281 gaagtccact tcaagctgga tacggcgttg aagccgggag acacgatccg cgtccagaag 2341 ggcggtgaca gcctggagta cggcgtcgac ttcatcgaga tcgagccgat tccggcagcg 2401 gttgcccgtc cggccaactc ggtgtccgtc accgaatacg gcgctgtcgc caatgacggc 2461 aaggatgatc tcgccgcctt caaggctgcc gtgaccgcag cggtagcggc cggaaaatcc 2521 ctctacatcc cggaaggcac cttccacctg agcagcatgt gggagatcgg ctcggccacc 2581 agcatgatcg acaacttcac ggtcacgggt gccggcatct ggtatacgaa catccagttc 2641 acgaatccca atgcatcggg cggcggcatc tccctgagaa tcaaaggaaa gcttgatttc 2701 agcaacatct acatgaactc caacctgcgt tcccgttacg ggcagaacgc cgtctacaaa 2761 ggctttatgg acaatttcgg cactaattcg atcatccatg acgtctgggt cgagcatttc 2821 gaatgcggca tgtgggtcgg cgactacgcc catactcctg cgatctatgc gagcgggctc 2881 gtcgtggaaa acagccgcat ccgcaacaat cttgccgacg gcatcaactt ctcgcaggga 2941 acgagcaact cgaccgtccg caacagcagc atccgcaaca acggcgatga cggcctcgcc 3001 gtctggacga gcaacacgaa cggcgctccg gccggcgtga acaacacctt ctcctacaac 3061 acgatcgaga acaactggcg cgcggcggcc atcgccttct tcggcggcag cggccacaag 3121 gctgaccaca actacatcat cgactgtgtc ggcggctccg gcatccggat gaatacggtg 3181 ttcccaggct accacttcca gaacaacacc ggcatcacct tctcggatac gacgatcatc 3241 aacagcggca ccagccagga tctgtacaac ggcgagcgcg gagcgattga tctggaagct 3301 tccaacgacg cgatcaaaaa cgtcaccttc accaacatcg acatcatcaa tgcccagcgc 3361 gacggcgttc agatcggcta tggcggcggc ttcgagaaca tcgtgttcaa caacatcacg 3421 atcgacggca ccggccgcga cgggatatcg acatcccgct tctcgggacc tcatcttggc 3481 gcagccatct atacgtacac gggcaacggc tcggcgacgt tcaacaacct ggtgacccgg 3541 aacatcgcct atgcaggcgg caactacatc cagagcgggt tcaacctgac gatcaaatag 3601 gctgcaaaaa aaaggaagct cctcggagct tccttttttt
II) Paenibacillus curdlanolyticus MP-1
1. General Information of of Mutanase from Paenibacillus curdlanolyticus MP-1
http://www.ncbi.nlm.nih.gov/nuccore/HQ640944
Genbank HQ640944; Length:1,261; Mass (Da): 131,631
[0159] Reference: Pleszczyilska M, et al. Protein Expr Purif. 2012 November; 86(1):68-74.
2. The Protein Sequence of Mutanase from Paenibacillus curdlanolyticus MP-1
TABLE-US-00005 >gi|315201261|gb|ADT91063.1|alpha-1,3-glucanase [Paenibacillus curdlanolyticus] (SEQ ID NO: 14) MRNKYVTWTLALTMLFSSFFLAVGPNKVVHAAGGTNLALGKNVTASGQSQ TYSPNNVKDSNQSTYWESTNNAFPQWIQVDLGATTSIDQIVLKLPAGWGT RTQTLAVQGSTDGSSFTNIVGSAGYVFNPAVANNAVTINFSAASTRYVRL NVTANTAWPAAQLSEFEIYGAGGTTTPPTTPAGTYEAESAALSGGAKVNT DHTGYTGTGFVDGYWTQGATTTFTANVSAAGNYDVTLKYANASGSAKTLS VYVNGTKIRQTTLASLANWDTWGTKVETLSLNAGNNTIAYKYEASDSGNV NIDSIAVAPSTSTPVDPEPPITPPTGSNIAIGKAISASSNTQAFVAANAN DNDTNTYWEGGAASSTLTLDLGANQNVTSIVLKLNPSSAWSTRTQTIQVL GHNQSTTTFSNLVSSQSYTFNPATGNSVTIPVTATVKRLQLSITANSGSG AGQIAEFQVYGTPAPNPDLTITGMSWTPASPIETDAVTLNATVKNSGNAD APATTVNFYLNNELVGSSPVGALAAGASSTVSLNVGTKTAATYAVSAKVD ESNSIIEQNDANNSYTNASSLVVAPVASSDLVGATTWTPSTPVAGNAIGF MVNLKNQGTIASASGAHGITVVVKNAAGAALQSFSGTYSGAIAAGASVNV TLPGTWTAVNGSYTVTTTVAVDANELTNKQGNNVSTSNLVVYAQRGASMP YSRYDTEDATRGGGATLQTAPTFNQAQIASEASGQSYIALPSNGSSAQWT VRQGQGGAGVTMRFTMPDSTDGMGLNGSLDVYVNGVKVKTVSLTSYYSWQ YFSGDMPGDAPSAGRPLFRFDEVHWKLDTPLQPGDTIKIQKGNGDSLEYG IDFLEIEPVPTAIAKPANSLSVTEYGAVANDGQDDLAAFKATVTAAVAAG KSVYIPAGTFNLSSMWEIGSANNMINNITITGAGYWHTNIQFTNPNAAGG GISLRISGQLDFSNVYMNSNLRSRYGQNAIYKGFMDNFGTNSKIHDVWVE HFECGMWVGDYAHTPAIYATGLVVENSRIRNNLADGINYSQGTSNSIVRN SSIRNNGDDGLAVWTSNTNGAPAGVNNTFSYNTIENNWRAGGIAFFGGGG HKADHNLIVDTVGGSGIRMNTVFPGYHFQNNTGITFSDNTLINTGTSQDL YNGERGAIDLEASNDAIKNVTFTNIDIINTQRDAIQFGYGGGFENIVFNN ININGTGLDGVTTSRFAGPHKGAAIYTYTGNGSATFNNLTTSNVAYPGLN FIQQGFNLVIQ
3. Sequence of mRNA from Paenibacillus curdlanolyticus MP-1
TABLE-US-00006 (SEQ ID NO: 15) 1 atgcgcaaca agtatgtcac atggacgctc gccctgacga tgctattttc gagcttcttc 61 cttgcagtag gtcccaacaa ggtcgttcac gcagcaggcg gaacgaattt agcgctcggc 121 aaaaacgtta cggcaagcgg ccaatcgcaa acgtatagtc ccaacaatgt aaaagacagc 181 aatcaatcga cgtactggga aagcacgaac aatgcattcc cgcaatggat tcaagtagac 241 ttaggcgcaa cgacgagcat tgaccaaatc gtactgaagc tgcccgctgg atggggtacg 301 cgtacgcaaa cgttagctgt tcaaggaagc acggacggtt cctcgttcac gaatatcgtg 361 ggctccgcag gctatgtatt taatcctgct gttgccaata acgccgttac gattaacttc 421 tctgctgcaa gcacgcgtta tgttcgtctg aacgtaacag cgaacacggc ttggccagca 481 gcgcagctgt ccgaattcga gatttatggc gctggcggca cgacgacgcc tccaacaacg 541 ccagcaggca catatgaagc tgaatccgca gcattgtccg gcggtgcgaa agtgaacacg 601 gatcataccg gctacacggg tacgggcttt gttgacggct actggacaca aggcgcgaca 661 acgacgttca cggctaacgt gtccgcagct ggcaactatg acgttacatt gaaatatgcc 721 aacgcaagcg gcagtgccaa gacgctaagc gtttacgtca acggcacgaa gattcgccag 781 acgacgctgg caagcctggc aaactgggac acttggggca cgaaggttga gacgctgagc 841 ttgaatgccg gcaataatac gattgcatac aagtatgagg ctagcgactc gggcaacgtg 901 aatatcgact ccattgccgt ggcgccatcg acttcgacac cggtagatcc agaaccgccg 961 atcacgccgc caacgggcag caatatcgca atcggcaaag cgatcagcgc atcttcgaat 1021 acgcaagcat tcgtagctgc caacgcgaac gataacgata cgaacacgta ctgggaaggc 1081 ggagctgcat cgagcacgct gacgctggat cttggcgcga accaaaatgt aacctcgatc 1141 gtgctgaagc tgaatccttc ttcggcatgg agcacgcgta cgcaaacgat ccaagtgctt 1201 ggccacaacc aaagcacgac gacgttcagc aatctggtat cttcgcaatc gtatacgttc 1261 aatcctgcaa cgggcaactc cgtgacgatt ccggttacgg caacagttaa gcgcttgcag 1321 ctgagcatta cggcgaactc gggttccggc gctggtcaaa ttgcggaatt ccaagtgtat 1381 ggaacgccgg caccaaaccc agacctgacg atcacaggca tgtcctggac gcctgcttcg 1441 ccaattgaaa cggatgcagt tacgctgaat gcaacggtta aaaacagcgg aaatgcagac 1501 gctcctgcaa cgacggtaaa cttctacctg aacaatgagc tcgtaggctc ctcgccagtt 1561 ggcgcacttg ctgcaggcgc ttcctcgacg gtttcgctga atgttggtac gaaaacggct 1621 gcaacttatg cagttagcgc gaaagtcgat gagagcaatt cgattatcga gcaaaatgat 1681 gcgaacaaca gttatacgaa cgcatcctcg ctcgtcgtcg ctcctgtcgc aagctctgac 1741 ttggttggcg cgacgacgtg gacgcctagc acgccggttg ccggcaatgc aattggcttc 1801 atggtaaatc ttaaaaacca aggaacgatt gcatctgcaa gcggcgcgca tggcattaca 1861 gttgtcgtga aaaatgccgc aggcgctgcg ctccaatcgt tcagcggcac ctacagcgga 1921 gcaatcgcag ctggcgcatc cgttaacgta accctgccag gtacgtggac ggctgtgaat 1981 ggcagctaca cggtaacgac aacggttgct gtcgatgcta acgagctgac gaacaaacaa 2041 gggaacaacg taagcacttc gaacctcgtt gtttatgcac aacgtggcgc aagcatgcct 2101 tacagccgtt atgacacgga agacgctaca cgtggcggcg gtgcaacgct gcaaaccgca 2161 ccaaccttca accaagcgca aatcgcttcg gaagcatccg gacaaagcta tatcgcgctg 2221 ccttcgaacg gctcctccgc acaatggacg gtccgtcaag gacaaggcgg agctggcgtt 2281 acgatgcgct tcacgatgcc ggattcgact gacggtatgg gtttgaacgg ttcgctcgac 2341 gtttatgtca acggcgttaa agtaaaaacg gtatcgctca cgtcctacta cagctggcag 2401 tatttctcgg gcgatatgcc tggcgatgcg ccgtccgctg gccgtccgtt gttccgcttt 2461 gacgaagtac actggaagct tgacacgcct cttcaaccag gcgacacgat caaaatccaa 2521 aaaggcaacg gagatagcct ggaatacggc attgacttcc tcgaaatcga gccggttcca 2581 acagcaatcg ctaaacctgc caactcgctt tccgttacgg agtatggcgc tgtagcaaac 2641 gatggccaag acgaccttgc cgcattcaaa gcaacggtta cggctgcagt tgctgctggc 2701 aaatccgttt acattcctgc tggcacgttc aatctgagca gcatgtggga aatcggatcg 2761 gctaacaaca tgatcaacaa cattacgatt acaggcgcag gctactggca tacgaacatt 2821 caattcacga atccgaatgc agcaggcggc ggcatttcgc tccggatttc cggacagctt 2881 gatttcagca atgtttacat gaactccaac ctgcgttcgc gttatggtca aaatgcgatt 2941 tacaaaggct tcatggacaa cttcggcaca aactccaaaa tccatgacgt atgggttgag 3001 cacttcgagt gcggcatgtg ggtaggcgat tacgcgcata cgccagcgat ctatgcaacg 3061 ggtcttgtcg ttgaaaacag ccggattcgc aacaaccttg cagacggcat caactactcg 3121 caaggcacga gcaattcgat cgtacgcaac agcagtatcc gcaataacgg tgatgacggt 3181 ctggcggttt ggacgagtaa cacgaatggc gcgccagcag gcgtgaacaa cacgttctcg 3241 tacaacacga tcgaaaacaa ctggcgtgca ggcggtatcg cattcttcgg cggcggcggc 3301 cacaaggctg accacaacct gatcgttgat acggttggcg gctccggcat ccggatgaac 3361 acggtattcc caggctacca cttccaaaac aacacgggta ttacgttctc cgacaacacg 3421 ctgatcaaca caggcacaag ccaagatttg tacaacggcg agcgcggtgc gatcgatctc 3481 gaagcatcga acgatgcaat caagaacgtc acgttcacga acatcgacat catcaacacc 3541 cagcgcgatg cgatacaatt cggctacggc ggcggattcg agaacatcgt atttaacaac 3601 attaacatta acggtacggg gcttgacggc gttacaacct cacggtttgc tggaccgcat 3661 aaaggtgctg caatctacac gtacacgggc aatggctctg caacgttcaa taacctgacg 3721 acgagcaacg tggcatatcc aggcttgaat ttcattcagc aaggctttaa tctggtgatc 3781 cagtag
III) Paenibacillus sp. strain RM1.
1. General Information of of Mutanase
Genbank E16590; Length: 1,291; Mass (Da): 135kD
[0160] Reference: Shimotsuura I, et al. Appl Environ Microbiol. 2008 May; 74(9):2759-65.2. The protein sequence of mutanase from Paenibacillus sp. strain RM1
TABLE-US-00007
[0161] Deduced amino acid sequence of mutanase RM1. The signal peptide region is underlined, and the linker region is boxed. The arrow indicates the cleavage site for the N-terminal domain of the protein. The DNA sequence was registered as GenBank accession number E16590. (SEQ ID NO: 16)
3. Sequence of mRNA from Paenibacillus sp. Strain RM1
TABLE-US-00008 (SEQ ID NO: 17) 1 cccgggtacc agacctatcg ggaaaaacgc gagcggccct tcgcgcctta tgcgctacgg 61 acggtgctgg cgggcggttt gtttttcatc atcattcccc tgatgatcta cacggcatcg 121 tatatcccgt ttttgctcgt gccgggtccc ggacacgggt tgaaagacgt cgtctccgcc 181 cagaagttca tgttcaatta tcatagccgg cttaacgcca cccacccatt ctcgtcgctg 241 tggtgggagt ggcctctcat ccgcaagccg atctggtatt acggagccgc ggaattggcg 301 ccgggaaaaa tggcgagcat cgtgggcatg ggcaatccgg cggtgtggtg gacgggaacg 361 attgcggtaa tcgcggccct tcgctcggcc tggaagaagc gggaccggag catgaccgtc 421 gtcttcgttg gaatcgcctc gtcttatctt ccgtgggttt tcgtatccag actcaccttt 481 atttatcact ttttcgcttg cgttccgttt ctcgttcttt gcatcgttta ttggattcga 541 aaaatggaat agcgtaagcc gggatatcgg attgcgacgc tcctttacgc aggcgcggtt 601 ctggtgctgt tcattttgtt ttacccgatt ttgtcgggga ccgaaataga cgtttcttac 661 gcggaccgcg ttctgaagtg gttcggcggg tggatttttc acgggtaagc gagcgttgga 721 agcaaggaag ggaaggaaga cgagcgtctc cttcccgaaa tccatccaat atcttgaaat 781 tgcatacatt tttcgtaaga ttgcttctta tctgtctccc tcccctgttc ttataatggg 841 ggtatcccaa cgaaaggagg gtttgtaagc gctgtcagcs tgtttgccga aagttctcgc 901 atttgctgac ctacactttg aggaggagga atttaatgcg ctgcaaattt gtcgcatggt 961 cgcttgttac agccatgctg atggccagtt tgctgacggc tgtaggaccg ttcggccccg 1021 cttccgccgc gggaggaccg aatctgacgc cgggcaaacc cattacggcg agcggccaat 1081 cccaaaccta cagccctcag aacgtaaaag acggcaatca aaatacgtat tgggaaagca 1141 cgaacaacgc gttcccgcaa tggattcaag tggatttggg cgcaagcacg ggcatcgacc 1201 aaattgtgct gaagctgccc gcaagctggg aagcgcgcac gcaaacgctg gccgttcaag 1261 gcagcttgaa cggttcgacg ttcacggaca ttgtcggctc cgccaattat gtattcagtc 1321 cgtctgtcgg gaacaacacg gttacgatca actttaccgc gaccagcacg cgctacgtgc 1381 gcttgtatgt aacggccaac acgggctggc cggcggcgca gctgtccgaa ttcgaaattt 1441 acggctccgg cgaccagacg ccggcgcctg atacgtatca agccgaatcc gcggctctgt 1501 ccggcggcgc gaaagtcaac acggaccatg ccggatatat cggcacgggc tttgttgacg 1561 gttactggac gcaaggcgcg acgacgacct tttcggtcaa cgcgccgacg gcgggcaact 1621 acgatgtaac gctgaggtac ggcaacgcaa ccggcagcaa caaaacggta agcctctacg 1681 tcaatggagc gaagattcgc cagaccacgc tgcccagcct gcctaactgg gattcatgga 1741 gcagcaagac ggagacgctt aacctgaatg caggcagcaa caccattgcg tacaaatacg 1801 acccgggcga ttccggcaac gtcaatcttg accaaatcac ggtcgaagcg tcgacttcaa 1861 cgcctactcc tactccatcc cctactccta cacctacgcc aacgccgacg cctacgccta 1921 cgcctacacc cacacctact ccgaccccga cgcctacgcc tacacctaca cctacaccta 1981 cgccgacgcc tcctccgggc ggcaacatcg ccatcggcaa atcgatttcc gcatcctccc 2041 acacgcagac gtacgttgcg gagaacgcga acgataacga tgtcaacacg tactgggaag 2101 gcggcggcaa tccgagcacg ctgacgctcg atctcggagc gaactacaat attacgtcca 2161 tcgtgctgaa gctgaacccg tcctcgatat gggctgcgcg tacgcaaacg attcaagtgc 2221 tcggacacga tcagaacacg acgaccttca gcaatctggt ctcggcgaaa tcgtactcgt 2281 tcgatccggc ctccggcaat actgtgacca ttccggttac ggcgacggtg aaacgtttgc 2341 agttgaacat tacgtcgaac tccggcgccc cggccggaca agtcgccgag ttccaggtgt 2401 tcggcacgcc tgcgccgaat ccggacctga cgattaccgg catgtcctgg tcgccttctt 2461 ctccggttga gaccgacgcc attacgctaa acgcaacggt gaagaacaac gggaatgcca 2521 gcgccgcggc gaccaccgtc aatttctacc tgaacaacga gctggcgggt tccgcgccgg 2581 tagccgcgct ggcggcaggc gcttcggcaa cggtgccgct gaatgtcggc gcgaaaaccg 2641 ccgcgacata cgcggtcggc gccaaagtag acgagagcaa cgcggtcatc gagctgaacg 2701 agtcgaacaa cagctacacg aatccggctt cactcgttgt ggcccccgtt tccagctcgg 2761 atctggtggg cacggtttcg tggacgccga gcactccgat tgccaacaat gccgtttctt 2821 ttaacgtaaa tcttaaaaat caaggaacga ttgcttccgc cggcgggtct cacggcgtga 2881 cggtcgtgct taaaaatgct tccggttcga ccgttcaaac gttcagcggt tcctataccg 2941 gcagcctggc tccgggagcg tccgtcaaca tcacccttcc ggggacctgg acggcggcag 3001 ccggcagcta cacggtaacg gccaccgttg cggcagacgc caacgaactt ccgatcaagc 3061 aagccaacaa cgcgaacacc gcaagcctga ccgtatattc cgcccgcggc gcgagcatgc 3121 cgtacagccg gtatgacacc gaggacgcca ccctcggcgg cggcgccacg ctgaagtccg 3181 cgccgacatt cgatcaggcg cttacggcat cggaagccac cggccaactc tatgcggcgc 3241 tgccctcgaa cggctcctat cttcaatgga ccgtcagaca gggtcagggc ggcgcaggcg 3301 tgacgatgag atttacgatg cccgactcgg cggacggcat gggattaaac ggttcgctag 3361 acgtttacgt caacggcacc aaagtcaaaa ccgtatcgct gacctcctac tacagctggc 3421 agtatttctc gggcgatatg cccggagacg ctcccagcgc gggccgtccg ctcttccgct 3481 ttgacgaagt gcactggaag ctggatactc cgctcaaacc cggagacacg attcgcatcc 3541 agaagaacaa cggcgacagc ctggaatacg gtgtcgactt tattgaaatc gaaccggttc 3601 cggctgcgat ctcccgtccg gccaactcgg tttccgtaac ggattacggc gctgtgccga 3661 acgacggaca ggacgatctc accgccttta aagccgccgt aaacgcggcg gtcgcatccg 3721 acaagatctt gtacattccg gaaggaacgt tccacctcgg caacatgtgg gagatcggtt 3781 ccgtcagcaa catgatcgat cacattacga ttacgggagc cggtatctgg tatacgaaca 3841 tccagtttac caacgccaat ccggcgtccg gcggcatctc gctccggatt acgggcaagc 3901 ttgatttcag caacgtgtac ctcaactcca atttgcggtc gcggtatggt caaaatgcgg 3961 tttacaaagg ctttatggac aacttcggga ccaattccgt catccgcgac gtctgggtcg 4021 agcacttcga atgcggcttc tgggtcgggg actacgggca tacgccggcg atccgcgcga 4081 gcgggctgct gattgaaaac agccgaatcc gcaacaacct ggccgatggc gtcaacttcg 4141 cccaagggac cagcaattcg accgtacgca acagcagcct gcgcaacaac ggcgacgacg 4201 cccttgccgt atggacgagt aatacgaacg gcgcgcccga aggcgtaaac aataccttct 4261 cgtacaacac catcgaaaac aactggcgcg cgggaggcat cgccttcttc ggaggaagcg 4321 gacacaaggc cgaccacaac tacatcgtcg actgcgtcgg cggttccggc atccggatga 4381 acaccgtgtt ccccggatac cacttccaga acaataccgg cattgtgttc tcggacacga 4441 ccatcgtcaa ctgcggcacg agcaaagacc tatacaacgg cgaacgcggc gccatcgatc 4501 tggaagcttc gaacgacgcc atccggaacg tgacgtttac caacatcgat attatcaact 4561 ctcagcgcga tgcgatccag ttcggttacg gcggcggctt caccaacatc gtgttcaaca 4621 acatcaacat taacggaacc ggtcttgacg gcgtaaccac ctcgcggttc tcgggaccgc 4681 atctgggcgc ggcgatcttc acctataccg gcaacggctc cgccacgttc aacaatctga 4741 ggaccagcaa tatcgcttac cccaatctgt attacatcca gagcgggttc aatctgatca 4801 tcaataatta gatatctggg cccgtctgcg ggggaggaac tcttcggagc tcgaattcgt 4861 aatcatggtc atagctgttt cctgtgtgaa attgttatcc gctcacaatt ccacacaaca 4921 tacgagccgg aagcataaag tgtaaagcct ggggtgccta atgagtgagc taactcacat 4981 taattgcgtt gcgctcactg cccgctttcc agtcgggaaa ctgtcgtgcc agctgcatta 5041 atgaatcggc caacgcgcgg ggagaggcsg tttkcgtatt gggcgccctt
IV) Trichoderma harzianum (CCM F-470)
1. General Information of of Mutanase from Trichoderma harzianum
Also see http://www.uniprot.org/uniprot/Q8WZM7Length:635
Mass (Da):67,726
[0162] Last modified:Mar. 1, 2002-v1
Checksum:iBBOD864E2F432C58
2. The Protein Sequence of Mutanase from Trichoderma harzianum
http://www.uniprot.org/uniprot/Q8WZM7.fasta)
TABLE-US-00009 >tr|Q8WZM7|Q8WZM7_TRIHA Alpha-1,3-glucanase OS =Trichoderma harzianum GN =p3 PE =2 SV =1 (SEQ ID NO: 18) MLGVFRRLRLGALAAAALSSLGSAAPANVAIRSLEERASSADRLVFCHFM IGIVGDRGSSADYDDDMQRAKAAGIDAFALNIGVDGYTDQQLGYAYDSAD RNGMKVFISFDFNWWSPGNAVGVGQKIAQYANRPAQLYVDNRPFASSFAG DGLDVNALRSAAGSNVYFVPNFHPGQSSPSNIDGALNWMAWDNDGNNKAP KPGQTVTVADGDNAYKNWLGGKPYLAPVSTWVFNHFGPEVSYSKNWVFPS GPLIYNRWQQVLQQGFPRVEIVTWNDYGESHYVGPLKSKQFHDGNSKWVN DMPHDGFLDLSKPFIAAYKNRDTDISKYVQNEQLVYWYRRNLKALDCDAT DTTSNRPANNGSGNYFEGRPDGWQTMDDTVYVAALLKTAGSVTVTSGGTT QTFQANAGANLFQIPASIGQQKFALTRNGQTVFSGTSLMDITNVCSCGIY NFNPYVGTIPAGFDDPLQADGLFSLTIGLHVTTCQAKPSLGTNPPVTSGP VSSLPASSTTRASSPPPVSSTRVSSPPVSSPPVSRTSSAPPPPGNSTPPS GQVCVAGTVADGESGNYIGLCQFSCNYGYCPPGPCKCTAFGAPISPPASN GRNGCPLPGEGDGYLGLCSFSCNHNYCPPTACQYC
3. Sequence of mRNA (Trichoderma harzianum
http://www.ebi.ac.uk/ena/data/view/AJ243799&display=fasta)
TABLE-US-00010 >ENA|AJ243799|AJ243799.1 Trichoderma harzianum mRNA for alpha-1,3-glucanase (p3 gene) (SEQ ID NO: 19) ATGTTGGGCGTTTTCCGCCGCCTCAGGCTCGGCGCCCTTGCCGCCGCAGC TCTGTCTTCTCTCGGCAGTGCCGCTCCCGCCAATGTTGCTATTCGGTCTC TCGAGGAACGTGCTTCTTCTGCTGACCGTCTCGTATTCTGTCATTTCATG ATTGGGATCGTGGGTGACCGTGGCAGCTCGGCAGATTATGATGACGATAT GCAACGTGCCAAAGCCGCTGGCATTGACGCCTTCGCCCTGAACATCGGCG TTGACGGCTATACCGACCAGCAGCTCGGCTATGCCTATGACTCTGCCGAT CGTAATGGCATGAAAGTCTTCATTTCATTTGATTTCAACTGGTGGAGCCC CGGCAATGCAGTTGGTGTTGGCCAGAAGATTGCGCAGTATGCCAACCGCC CTGCCCAGCTGTATGTCGACAACCGGCCATTCGCCTCTTCCTTCGCCGGT GACGGTCTGGATGTAAATGCGTTGCGCTCTGCTGCAGGCTCCAACGTTTA CTTTGTGCCCAACTTCCACCCTGGTCAATCTTCCCCCTCCAACATTGATG GCGCCCTTAACTGGATGGCCTGGGATAATGATGGAAACAACAAGGCACCC AAGCCGGGCCAGACTGTCACAGTGGCAGACGGTGACAACGCTTATAAGAA TTGGTTGGGTGGCAAGCCTTACCTGGCGCCTGTCTCAACTTGGGTTTTCA ACCATTTCGGGCCCGAAGTTTCATATTCCAAGAACTGGGTTTTCCCAAGT GGGCCTCTGATCTATAACCGGTGGCAACAAGTCTTGCAGCAAGGGTTCCC AAGGGTTGAGATCGTTACCTGGAATGACTACGGGGAATCTCACTACGTCG GTCCCCTGAAGTCTAAGCAATTTCATGATGGGAACTCCAAATGGGTCAAT GATATGCCCCACGATGGATTCCTGGATCTTTCGAAGCCGTTCATAGCCGC ATATAAAAACAGGGATACCGACATCTCCAAGTATGTTCAAAATGAGCAGC TTGTTTACTGGTACCGCCGCAACTTAAAGGCACTGGACTGTGACGCCACC GACACAACCTCTAACCGCCCGGCTAACAATGGAAGCGGCAATTACTTTGA GGGACGCCCCGATGGTTGGCAAACTATGGATGATACGGTTTACGTGGCGG CACTTCTCAAGACTGCCGGTAGCGTCACGGTCACGTCTGGTGGCACCACT CAAACGTTCCAGGCCAACGCCGGAGCCAATCTCTTCCAAATCCCGGCCAG CATCGGCCAGCAAAAGTTTGCTCTGACTCGTAACGGTCAGACCGTCTTTA GCGGAACCTCATTGATGGATATCACCAACGTTTGCTCTTGCGGTATCTAC AACTTCAACCCATATGTTGGCACCATTCCTGCCGGCTTTGACGACCCTCT TCAGGCTGACGGTCTTTTCTCTTTGACCATCGGATTGCACGTCACAACTT GTCAGGCCAAGCCATCTCTTGGAACTAACCCTCCTGTCACTTCCGGCCCT GTGTCCTCGCTTCCAGCTTCCTCCACCACCCGCGCATCCTCGCCGCCTCC TGTTTCTTCAACTCGTGTCTCTTCTCCCCCTGTCTCTTCCCCTCCAGTTT CTCGCACCTCTTCTGCCCCTCCCCCTCCGGGCAACAGCACGCCGCCATCG GGTCAGGTTTGCGTTGCCGGCACCGTTGCCGACGGCGAGTCTGGCAACTA CATCGGCCTGTGCCAATTCAGCTGCAACTACGGTTACTGCCCACCAGGAC CGTGTAAGTGCACCGCCTTTGGTGCTCCCATCTCGCCACCGGCATCCAAC GGCCGCAACGGCTGCCCTCTGCCGGGAGAAGGCGATGGTTATCTGGGCCT GTGCAGTTTCAGTTGTAACCATAATTACTGCCCGCCAACGGCATGTCAAT ACTGCTAGGAGGGATCAATCTCAGTATGAGTATATGGAGGCTGCTGAAGG ACCAATTAGCTGTTCTTATCGGCAGACGAAACCCATAGAGTAAGAAGTTA AATAAAATGCAATTAATGTGTTTTCAAAAAAAAAAAAAAAA
(There is a polyA tail since Trichoderma harzianum is fungi)
V) Trichoderma harzianum
1. General Information of of Mutanase from Trichoderma harzianum
Also see http://www.uniprot.org/uniprot/Q8WZM7;
2. The Protein Sequence of Mutanase from Trichoderma harzianum
See: http://www.uniprot.org/uniprot/Q8WZM7.fasta)
TABLE-US-00011 >tr|Q8WZM7|Q8WZM7_TRIHA Alpha-1,3-glucanase OS =Trichoderma harzianum GN =p3 PE =2 SV =1 (SEQ ID NO: 20) MLGVFRRLRLGALAAAALSSLGSAAPANVAIRSLEERASSADRLVFCHFM IGIVGDRGSSADYDDDMQRAKAAGIDAFALNIGVDGYTDQQLGYAYDSAD RNGMKVFISFDFNWWSPGNAVGVGQKIAQYANRPAQLYVDNRPFASSFAG DGLDVNALRSAAGSNVYFVPNFHPGQSSPSNIDGALNWMAWDNDGNNKAP KPGQTVTVADGDNAYKNWLGGKPYLAPVSTWVFNHFGPEVSYSKNWVFPS GPLIYNRWQQVLQQGFPRVEIVTWNDYGESHYVGPLKSKQFHDGNSKWVN DMPHDGFLDLSKPFIAAYKNRDTDISKYVQNEQLVYWYRRNLKALDCDAT DTTSNRPANNGSGNYFEGRPDGWQTMDDTVYVAALLKTAGSVTVTSGGTT QTFQANAGANLFQIPASIGQQKFALTRNGQTVFSGTSLMDITNVCSCGIY NFNPYVGTIPAGFDDPLQADGLFSLTIGLHVTTCQAKPSLGTNPPVTSGP VSSLPASSTTRASSPPPVSSTRVSSPPVSSPPVSRTSSAPPPPGNSTPPS GQVCVAGTVADGESGNYIGLCQFSCNYGYCPPGPCKCTAFGAPISPPASN GRNGCPLPGEGDGYLGLCSFSCNHNYCPPTACQYC
3. Sequence of mRNA (Trichoderma harzianum Further information can be found at http://www.ebi.ac.uk/ena/data/view/AJ243799&display=fasta)
TABLE-US-00012 >ENA|AJ243799|AJ243799.1 Trichoderma harzianum mRNA for alpha-1,3-glucanase (p3 gene) (SEQ ID NO: 21) ATGTTGGGCGTTTTCCGCCGCCTCAGGCTCGGCGCCCTTGCCGCCGCAGC TCTGTCTTCTCTCGGCAGTGCCGCTCCCGCCAATGTTGCTATTCGGTCTC TCGAGGAACGTGCTTCTTCTGCTGACCGTCTCGTATTCTGTCATTTCATG ATTGGGATCGTGGGTGACCGTGGCAGCTCGGCAGATTATGATGACGATAT GCAACGTGCCAAAGCCGCTGGCATTGACGCCTTCGCCCTGAACATCGGCG TTGACGGCTATACCGACCAGCAGCTCGGCTATGCCTATGACTCTGCCGAT CGTAATGGCATGAAAGTCTTCATTTCATTTGATTTCAACTGGTGGAGCCC CGGCAATGCAGTTGGTGTTGGCCAGAAGATTGCGCAGTATGCCAACCGCC CTGCCCAGCTGTATGTCGACAACCGGCCATTCGCCTCTTCCTTCGCCGGT GACGGTCTGGATGTAAATGCGTTGCGCTCTGCTGCAGGCTCCAACGTTTA CTTTGTGCCCAACTTCCACCCTGGTCAATCTTCCCCCTCCAACATTGATG GCGCCCTTAACTGGATGGCCTGGGATAATGATGGAAACAACAAGGCACCC AAGCCGGGCCAGACTGTCACAGTGGCAGACGGTGACAACGCTTATAAGAA TTGGTTGGGTGGCAAGCCTTACCTGGCGCCTGTCTCAACTTGGGTTTTCA ACCATTTCGGGCCCGAAGTTTCATATTCCAAGAACTGGGTTTTCCCAAGT GGGCCTCTGATCTATAACCGGTGGCAACAAGTCTTGCAGCAAGGGTTCCC AAGGGTTGAGATCGTTACCTGGAATGACTACGGGGAATCTCACTACGTCG GTCCCCTGAAGTCTAAGCAATTTCATGATGGGAACTCCAAATGGGTCAAT GATATGCCCCACGATGGATTCCTGGATCTTTCGAAGCCGTTCATAGCCGC ATATAAAAACAGGGATACCGACATCTCCAAGTATGTTCAAAATGAGCAGC TTGTTTACTGGTACCGCCGCAACTTAAAGGCACTGGACTGTGACGCCACC GACACAACCTCTAACCGCCCGGCTAACAATGGAAGCGGCAATTACTTTGA GGGACGCCCCGATGGTTGGCAAACTATGGATGATACGGTTTACGTGGCGG CACTTCTCAAGACTGCCGGTAGCGTCACGGTCACGTCTGGTGGCACCACT CAAACGTTCCAGGCCAACGCCGGAGCCAATCTCTTCCAAATCCCGGCCAG CATCGGCCAGCAAAAGTTTGCTCTGACTCGTAACGGTCAGACCGTCTTTA GCGGAACCTCATTGATGGATATCACCAACGTTTGCTCTTGCGGTATCTAC AACTTCAACCCATATGTTGGCACCATTCCTGCCGGCTTTGACGACCCTCT TCAGGCTGACGGTCTTTTCTCTTTGACCATCGGATTGCACGTCACAACTT GTCAGGCCAAGCCATCTCTTGGAACTAACCCTCCTGTCACTTCCGGCCCT GTGTCCTCGCTTCCAGCTTCCTCCACCACCCGCGCATCCTCGCCGCCTCC TGTTTCTTCAACTCGTGTCTCTTCTCCCCCTGTCTCTTCCCCTCCAGTTT CTCGCACCTCTTCTGCCCCTCCCCCTCCGGGCAACAGCACGCCGCCATCG GGTCAGGTTTGCGTTGCCGGCACCGTTGCCGACGGCGAGTCTGGCAACTA CATCGGCCTGTGCCAATTCAGCTGCAACTACGGTTACTGCCCACCAGGAC CGTGTAAGTGCACCGCCTTTGGTGCTCCCATCTCGCCACCGGCATCCAAC GGCCGCAACGGCTGCCCTCTGCCGGGAGAAGGCGATGGTTATCTGGGCCT GTGCAGTTTCAGTTGTAACCATAATTACTGCCCGCCAACGGCATGTCAAT ACTGCTAGGAGGGATCAATCTCAGTATGAGTATATGGAGGCTGCTGAAGG ACCAATTAGCTGTTCTTATCGGCAGACGAAACCCATAGAGTAAGAAGTTA AATAAAATGCAATTAATGTGTTTTCAAAAAAAAAAAAAAAA
(There is a polyA tail since Trichoderma harzianum is fungi)
[0163] Dextranase (Dex) gene from Penicillium minioluteum
GenBank: L41562.1
[0164] (http://www.ncbi.nim.nih.gov/nuccore/L4152.1)
The mature protein has 574 amino acids with MW at 67KD. The optimum reaction condition is pH 5.5 and 40 C. The pH range is 3-6.
Amino Acid Sequence
[0165]
TABLE-US-00013 (SEQ ID NO: 22) MATMLKLLALTLAISESAIGAVMHPPGNSHPGTHMGTTNNTHCGADFCTW WHDSGEINTQTPVQPGNVRQSHKYSVQVSLAGTNNFHDSFVYESIPRNGN GRIYAPTDPPNSNTLDSSVDDGISIEPSIGLNMAWSQFEYSHDVDVKILA TDGSSLGSPSDVVIRPVSISYAISQSDDGGIVIRVPADANGRKFSVEFKT DLYTFLSDGNEYVTSGGSVVGVEPTNALVIFASPFLPSGMIPHMTPDNTQ TMTPGPINNGDWGAKSILYFPPGVYWMNQDQSGNSGKLGSNHIRLNSNTY WVYLAPGAYVKGAIEYFTKQNFYATGHGILSGENYVYQANAGDNYIAVKS DSTSLRMWWHNNLGGGQTWYCVGPTINAPPFNTMDFNGNSGISSQISDYK QVGAFFFQTDGPEIYPNSVVHDVFWHVNDDAIKIYYSGASVSRATIWKCH NDPIIQMGWTSRDISGVTIDTLNVIHTRYIKSETVVPSAIIGASPFYASG MSPDSRKSISMTVSNVVCEGLCPSLFRITPLQNYKNFVVKNVAFPDGLQT NSIGTGESIIPAASGLTMGLNISNWTVGGQKVTMENFQANSLGQFNIDGS YWGEWQIS
DNA Sequence
[0166]
TABLE-US-00014 (SEQ ID NO: 23) 1 ggcatagtaa tcccgacagc cgagtatgat ggagcttctt cggataatga tagcgccacc 61 agaccttgct tgagctggag agctaaaaca ttaaacgcca cacgaccaac actctcatta 121 gttgcgatag atgatgctcg gagctgttga aactcagaaa ttccttctat gcggggtctc 181 caagatcgat cctgggggat gtgaatacta cggtggacct aattgacgcc ttgacaggtg 241 atgttaagcg aaccaaggaa gaataatctg gggctagatg aagatgttga gctgtaaggt 301 acggtacgtt cctattggct ttatcggagc ttctccgggt tactcagtct ttccgggagc 361 atgatcattt ttgtattgtc caatagtaag cagaaactga gagccaccac aaactcaaaa 421 cctcggtagc gaagtttccc ggaaccagtc aggattctca gaaactgtgc tcgtgttgcg 481 gggaatccgc attctacgtc gtctggagca aggaaatgtt cgtgctggat tgaggaggat 541 aggtaggttg gagaatctct tcagctaacc aatctataag catgctccgg taacctttag 601 agtttcacat tcaacgtaat ttccaagata gccagagcgt ccttgaatta ctatgtagaa 661 atcctaaaat ttcccctgta aaatgcaagt caacgagatg cgtgccctca atgtctctcg 721 gcgctacccc ggaaatgatg cataaggcca agaatgtcac ccggtaactt tttcttcaga 781 atatcctaag atttccatca aacacagtcg aataggtcaa tgctcgcgag agactttctg 841 ccttcactct acgtcctact catagaagtt caacggctca attccggggt aatctagagt 901 ttggacctca agggagatgt tgcaacaaat tgtactagaa cgatgcgctt gctttccaat 961 acagtagttg acttcatata gcttccaaca aaagggatgg ggatgaaggc tctatagcga 1021 gaagtctata agaaagtgtc ctcatacctg tatctctcag tcgttcgaga acaatcccgg 1081 aaactatctt atcttgcgag aaagaagaca atatctcaaa cttatggcca caatgctaaa 1141 gctacttgcg ttgacccttg caattagcga gtccgccatt ggagcagtca tgcacccacc 1201 tggcaattct catcccggta cccatatggg cactacgaat aatacccatt gcggcgccga 1261 tttctgtacc tggtggcatg attcagggga gatcaatacg cagacacctg tccaaccagg 1321 gaacgtgcgc caatctcaca agtattccgt gcaagtgagc ctagctggta caaacaattt 1381 tcatgactcc tttgtatatg aatcgatccc ccggaacgga aatggtcgca tctatgctcc 1441 caccgatcca cccaacagca acacactaga ttcaagtgtg gatgatggaa tctcgattga 1501 gcctagtatc ggccttaata tggcatggtc ccaattcgag tacagccacg atgtagatgt 1561 aaagatcctg gccactgatg gctcatcgtt gggctcgcca agtgatgttg ttattcgccc 1621 cgtctcaatc tcctatgcga tttctcagtc tgacgatggt gggattgtca tccgggtccc 1681 agccgatgcg aacggccgca aattttcagt tgagttcaaa actgacctgt acacattcct 1741 ctctgatggc aacgagtacg tcacatcggg aggcagcgtc gtcggcgttg agcctaccaa 1801 cgcacttgtg atcttcgcaa gtccgtttct tccttctggc atgattcctc atatgacacc 1861 cgacaacacg cagaccatga cgccaggtcc tatcaataac ggcgactggg gcgccaagtc 1921 aattctttac ttcccaccag gtgtatactg gatgaaccaa gatcaatcgg gcaactcggg 1981 gaagttagga tctaatcata tacgtctaaa ctcgaacact tactgggtct accttgcccc 2041 cggtgcgtac gtgaagggtg ctatagagta ttttaccaag cagaacttct atgcaactgg 2101 tcatggtatc ctatcgggtg aaaactatgt ttaccaagcc aatgccggcg acaactacat 2161 tgcagtcaag agcgattcaa ccagcctccg gatgtggtgg cacaataacc ttgggggtgg 2221 tcaaacatgg tactgcgttg gcccgacgat caatgcgcca ccattcaata ctatggattt 2281 caatggaaat tctggcatct caagtcaaat tagcgactat aagcaggtgg gagccttctt 2341 cttccagacg gatggaccag aaatatatcc caatagtgtc gtgcacgacg tcttctggca 2401 cgtcaatgat gatgcaatca aaatctacta ttcgggagca tctgtatcgc gggcaacgat 2461 ctggaaatgt cacaatgacc caatcatcca gatgggatgg acgtctcggg atatcagtgg 2521 agtgacaatc gacacattaa atgttattca cacccgctac atcaaatcgg agacggtggt 2581 gccttcggct atcattgggg cctctccatt ctatgcaagt gggatgagtc ctgattcaag 2641 aaagtccata tccatgacgg tttcaaacgt tgtttgcgag ggtctttgcc cgtccctatt 2701 ccgcatcaca ccccttcaga actacaaaaa ttttgttgtc aaaaatgtgg ctttcccaga 2761 cgggctacag acgaatagta ttggcacagg agaaagcatt attccagccg catctggtct 2821 aacgatggga ctgaatatct ccaactggac tgttggtgga caaaaagtga ctatggagaa 2881 ctttcaagcc aatagcctgg ggcagttcaa tattgacggc agctattggg gggagtggca 2941 gattagctga attccagctc tcggagcgcg tgagtgcttc tacccgctcc tttacccttg 3001 tcgagagata aaggcataag ttagctcatg tgaaggcgat ttcagttcat tctctctttt 3061 tggagcttat ttcctgttcg accaattgtg acaccaactt gcctttcaaa agacgtggac 3121 gatatgtgta cggtaatcag tcaaatgaac gtcaacattc atttaataag gacatttcca 3181 ggtttcctta ctctgtcgat tatgcctaac tcgggttgat gtcttgtcag gatggaaaat 3241 ctcgttgtgt acttccagtg aaatgggcag ggctaagccc taaaccctaa cgcatacaat 3301 ttgtaggcac ctacccatgt aagttcacac ccagtcgact tataagtcta gatatttatg 3361 ctatgcaggc tctggaatga tttacattcc atgctataca tagttatttg caagaatttg 3421 cagacgagat aaaaatcaat ggacgaataa tcacgcatta ctccacaggc tcatgccacg 3481 gagcaagggt tcccccgaat ctaggccaga ccgggatgat attcaaccga ttctttttgc 3541 agtaactatc tccgtacgag ctgcacgagc taaacggatt atataaaggt gctaactgag 3601 cattggatcc gtcagttata tgaaatgca
2. Dextranase (Dex) Gene from Penicillium Aculeatum (Talaromyces aculeatus Strain z01)
GenBank: KF999646.1 (http://www.ncbi.nlm.nih.gov/nuccore/KF999646.1)
The optimum pH is around 5. The pH range is 3-6.
Amino Acid Sequence
[0167]
TABLE-US-00015 (SEQ ID NO: 24) MATMLKLLTLALAISESAIGAVLHPPGSSHPSTRTDTTNNTHCGADFCTW WHDSGEINTQTPVQPGNVRQSHKYSVQVSLAGANNFQDSFVYESIPRNGN GRIYAPTDPPNSNTLDSSVDDGISIEHSIGLNMAWSQFEYSQDVDIKILA ADGSSLGSPSDVVIRPVSISYAISQSDDGGIVIRVPADANGRKFSVEFKN DPYTFLSDGNEYVTSGGSVVGVEPTNALVIFASPFLPSGMIPHMTPDNTQ TMTPGPINNGDWGSKSILYFPPGVYWMNQDQSGNSGKLGSNHIRLNSNTY WVYFAPGAYVKGAIEYFTKQNFYATGHGVLSGENYVYQANAGENYVAVKS DSTSLRMWWHNNLGGGQTWYCVGPTINAPPFNTMDFNGNSGISSQISDYK QVGAFFFQTDGPEIYPNSVVHDVFWHVNDDAIKIYYSGASVSRATIWKCH NDPIIQMGWTSRDISGVTIDTLNVIHTRYIKSETVVPSAIIGASPFYASG MSPDSSKSISMTVSNVVCEGLCPSLFRITPLQNYKNFVVKNVAFPDGLQT NSIGTGESIIPAASGLTMGLDISNWSVGGQKVTMQNFQANSLGQFDIDGS YWGEWQIN
DNA Sequence
[0168]
TABLE-US-00016 (SEQ ID NO: 25) 1 atggccacaa tgctaaagct acttacgttg gcccttgcaa ttagcgagtc tgccattgga 61 gcagtcctgc acccacctgg cagttctcat cccagtaccc gtacggacac tacgaataat 121 acccattgcg gtgccgactt ctgtacctgg tggcatgatt caggcgagat caacacacag 181 acacctgtcc aaccggggaa cgtgcgccaa tctcacaagt attccgtaca agtgagccta 241 gctggtgcga acaactttca ggactccttt gtatatgaat cgatccctcg gaacggaaat 301 ggtcgcatct atgctcccac cgatccaccc aacagcaaca cactagattc aagtgttgat 361 gatggaatct cgattgaaca tagtattggc ctcaatatgg catggtccca attcgagtac 421 agccaggatg tcgatataaa gatcctggcc gctgatggct catcgttggg ctcaccaagt 481 gatgttgtta ttcgccccgt ctcaatctcc tatgcaattt ctcaatccga cgatggcgga 541 attgtcattc gggtcccagc cgatgcgaac ggccgcaaat tttcagtcga gttcaaaaat 601 gacccgtaca cgttcctctc tgacggcaac gagtacgtca catcgggagg cagcgttgtc 661 ggcgttgagc ctaccaacgc acttgtgatc ttcgcaagcc cgtttcttcc gtcaggcatg 721 attcctcata tgacacccga caacacgcag accatgacac caggacctat caataacggc 781 gactggggct ccaagtcaat tctttatttc ccaccgggcg tatactggat gaaccaagat 841 caatcaggca actcggggaa attaggatct aatcatatac gcctgaactc gaacacctac 901 tgggtctact ttgccccagg tgcgtacgtg aagggtgcta tagagtattt caccaagcag 961 aacttctatg caactggtca tggtgtccta tcgggtgaaa actatgttta ccaagccaat 1021 gctggcgaaa actacgttgc ggtcaagagc gattcgacta gcctccggat gtggtggcac 1081 aataacctgg gaggtggaca aacatggtac tgcgttgggc ctacgatcaa tgcgccgcca 1141 tttaacacaa tggatttcaa tggaaattcc ggtatctcaa gtcaaattag cgactataag 1201 caggtgggag ctttcttctt tcagacggat ggaccagaaa tttatcccaa tagtgtcgtg 1261 cacgacgtct tctggcatgt caatgatgat gcaatcaaaa tctactattc cggagcatct 1321 gtctcgcggg caacgatctg gaaatgtcac aacgatccaa tcatccagat gggatggacg 1381 tctcgggata tcagtggagt gacaatcgac acattgaatg tcatccacac ccgctacatc 1441 aagtcggaga cggtggtgcc ttcggctatc attggggctt ctccattcta tgcaagtggg 1501 atgagtcctg attcaagcaa gtctatatcc atgacggttt caaacgttgt ctgcgaggga 1561 ctttgcccgt ctctgttccg aatcacacct ttacagaact acaagaattt tgttgtcaaa 1621 aatgtggctt tcccagatgg gctacagacg aatagtattg gcacgggaga aagcattatt 1681 ccagccgcat ctggtctaac gatgggactg gatatctcca actggtctgt tggtggtcag 1741 aaggtgacta tgcagaactt tcaagccaat agtctggggc aattcgacat tgacggcagc 1801 tattgggggg agtggcagat taactagctg aataatattg cagctttcag ggcgcatgag 1861 tgcttgtacc cgctccttta cccttgtc
3. Penicillium funiculosum dexA Gene for Dextranase
GenBank: AJ272066.1 (http://www.ncbi.nlm.nih.gov/nuccore/7801166)
The optimum pH is around 5.5. The optimum temperature is 60 C. The pH range is5-7.5
(http://www.sciencedirect.com/science/article/pii/S0032959298001277)
Amino Acid Sequence
[0169]
TABLE-US-00017 (SEQ ID NO: 26) MATMLKLLALTLAISESAIGAVMHPPGVSHPGTHTGTTNNTHCGADFCTW WHDSGEINTQTPVQPGNVRQSHKYSVQVSLAGTNNFHDSFVYESIPRNGN GRIYAPTDPSNSNTLDSSVDDGISIEPSIGLNMAWSQFEYSQDVDIKILA TDGSSLGSPSDVVIRPVSISYAISQSNDGGIVIRVPADANGRKFSVEFKN DLYTFLSDGNEYVTSGGSVVGVEPTNALVIFASPFLPSGMIPHMKPHNTQ TMTPGPINNGDWGAKSILYFPPGVYWMNQDQSGNSGKLGSNHIRLNSNTY WVYLAPGAYVKGAIEYFTKQNFYATGHGVLSGENYVYQANAGDNYVAVKS DSTSLRMWWHNNLGGGQTWYCVGPTINAPPFNTMDFNGNSGISQISDYKQ VGAFFFQTDGPEIYPNSVVHDVFWHVNDDAIKIYYSGASVSRATIWKCHN DPIIQMGWTSRDISGVTIDTLNVIHTRYIKSETVVPSAIIGASPFYASGM SPDSSKSISMTVSNVVCEGLCPSLFRITPLQNYKNFVVKNVAFPDGLQTN SIGTGESIIPAASGLTMGLNISSWTVGGQKVTMENFQANSLGQFNIDGSY WGEWQISRISSSQSA
DNA Sequence
[0170]
TABLE-US-00018 (SEQ ID NO: 27) 1 atggccacaa tgctaaagct acttgcgttg acccttgcaa ttagcgagtc cgccattgga 61 gcagtcatgc acccacctgg cgtttctcat cccggtaccc atacgggcac tacgaataat 121 acccattgcg gcgccgactt ctgtacctgg tggcatgatt caggggagat caacacgcag 181 acacctgtcc aaccagggaa cgtgcgccaa tctcacaagt attccgtgca agtgagtcta 241 gctggtacaa acaactttca tgactccttt gtatatgaat cgatcccccg gaacggaaat 301 ggtcgcatct atgctcccac cgatccatcc aacagcaaca cattagattc aagcgtggat 361 gatggaatct cgattgagcc tagtatcggc ctcaatatgg catggtccca attcgagtac 421 agccaggatg tcgatataaa gatcctggca actgatggct catcgttggg ctcaccaagt 481 gatgttgtta ttcgccccgt ctcaatctcc tatgcgattt ctcagtccaa cgatggcggg 541 attgtcatcc gggtcccagc cgatgcgaac ggccgcaaat tttcagtcga attcaaaaat 601 gacctgtaca ctttcctctc tgatggcaac gagtacgtca catcgggagg tagcgtcgtc 661 ggcgttgagc ctaccaacgc acttgtgatc ttcgcaagtc cgtttcttcc ttctggcatg 721 attcctcata tgaaacccca caacacgcag accatgacgc caggtcctat caataacggc 781 gactggggcg ccaagtcaat tctttacttc ccaccaggtg tatactggat gaaccaagat 841 caatcgggca actcgggtaa attaggatct aatcatatac gtctaaactc gaacacttac 901 tgggtctacc ttgcccccgg tgcgtacgtg aagggtgcta tagagtattt caccaagcaa 961 aacttctatg caactggtca tggtgtccta tcaggtgaaa actatgttta ccaagccaat 1021 gctggcgaca actatgttgc agtcaagagc gattcgacca gcctccggat gtggtggcac 1081 aataaccttg ggggtggtca aacatggtac tgcgttggcc cgacgatcaa tgcgccacca 1141 ttcaacacta tggatttcaa tggaaattct ggcatctcaa gtcaaattag cgactataag 1201 caggtgggag ccttcttctt ccagacggat ggaccagaaa tctatcccaa tagtgtcgtg 1261 cacgacgtct tctggcacgt caatgatgat gcaatcaaaa tctactattc gggagcatct 1321 gtatcgcggg caacgatctg gaaatgtcac aatgacccaa tcatccagat gggatggaca 1381 tctcgggata tcagtggagt gacaatcgac acattaaatg ttattcacac ccgctacatc 1441 aaatcggaga cggtggtgcc ttcggctatc attggggcct ctccattcta tgcaagtggg 1501 atgagtcccg attcaagcaa gtccatatcc atgacggttt caaacgttgt ttgcgagggt 1561 ctttgcccgt ccctgttccg catcacaccc ctacagaact acaaaaattt tgttgtcaaa 1621 aatgtggctt tcccagatgg gctacagaca aatagtattg gcacaggaga aagcattatt 1681 ccagccgcat ctggtctaac gatgggacta aatatctcca gctggactgt tggtggacaa 1741 aaagtgacaa tggagaactt tcaagccaat agcctggggc agttcaatat tgacggcagc 1801 tattgggggg agtggcagat tagtcgaatt tccagctctc agagcgcgtg agtgcttcta 1861 cccgctcctt tacccttgtc gaaggatcaa ggcataagtt agctcatgtg aaggcgattt 1921 cagttcattc tctctttttt ggagctcatt tccttttcga ccaattgtga caccaaattg 1981 ccatgtgtac tgtaattggt caaatgaacg ttaaccttcg atttaatatg gacatttcca 2041 ggtttcctta ctctgtcgat tatgcctaac tcgggttgat gtcttgtcag gatgaaaatc 2101 tcgttgtcat gtacttcgag tgaaatgggc agggctaacc cctaagccct aacgcccaat 2161 cgacttataa gtctagatgt ttatgctatg caggctctgg aatgatttac attccatgct 2221 ataca
[0171] While certain of the preferred embodiments of the present invention have been described and specifically exemplified above, it is not intended that the invention be limited to such embodiments. Various modifications may be made thereto without departing from the scope and spirit of the present invention, as set forth in the following claims.