MICROORGANISM FOR DELIVERING DRUG FOR TREATMENT OF GASTROINTESTINAL DISEASE, WHICH EXPRESSES AND SECRETES P8 PROTEIN, AND PHARMACEUTICAL COMPOSITION FOR PREVENTING OR TREATING GASTROINTESTINAL DISEASE, WHICH INCLUDES THE SAME
20190328801 ยท 2019-10-31
Inventors
Cpc classification
C12N15/74
CHEMISTRY; METALLURGY
C12N15/625
CHEMISTRY; METALLURGY
A61K35/744
HUMAN NECESSITIES
C12N15/746
CHEMISTRY; METALLURGY
International classification
C12N15/74
CHEMISTRY; METALLURGY
Abstract
The present invention relates to a microorganism for drug delivery, which has been transformed with a gene construct comprising a therapeutically active peptide, which can be delivered safely into the intestines through oral administration, and which can express and secrete the therapeutic peptide in the gastrointestinal tract, and also relates to a pharmaceutical composition for prevention or treatment of gastrointestinal disease, which includes the same. The present invention is directed to a lactic acid bacteria drug delivery system capable of overexpressing and secreting a lactic acid bacteria-derived anticancer protein, which is developed by introducing the anticancer protein into a lactic acid bacteria expression and secretion system. It is expected that the lactic acid bacteria drug delivery system will be widely used as a natural protein therapeutic agent against gastrointestinal disease in the medical field.
Claims
1. A microorganism for delivering a drug for treatment of gastrointestinal disease, wherein the microorganism has been transformed with a gene construct, comprising a P8 protein-encoding polynucleotide operably linked to an exogenous promoter and having a nucleotide sequence represented by SEQ ID NO: 1 and a gene encoding a secretion signal peptide, and expresses and secretes the P8 protein in a gastrointestinal tract.
2. The microorganism of claim 1, wherein the exogenous promoter is at least one promoter selected from the group consisting of SEQ ID NO: 3 to SEQ ID NO: 8.
3. The microorganism of claim 1, wherein the microorganism is a strain belonging to the genus Lactobacillus, Latococcus, Leuconostoc, Pediococcus, or Bifidobacterium.
4. The microorganism of claim 3, wherein the microorganism is a Lactobacillus rhamnosus, Lactobacillus acidophilus, Lactobacillus paracasei, Lactobacillus plantarum, Pediococcus pentosaceus, or Lactobacillus brevis strain.
5. The microorganism of claim 1, wherein the secretion signal peptide is a USP45 secretion signal peptide, Usp45 N4, or a Lactobacillus brevis S-layer protein signal peptide.
6. The microorganism of claim 5, wherein the microorganism is the Pediococcus pentosaceus strain, and the secretion signal peptide is the USP45 secretion signal peptide.
7. The microorganism of claim 1, wherein the gene construct further comprises, downstream of the promoter, a second promoter, a second secretion signal peptide, and a heterologous nucleic acid sequence encoding a second therapeutic peptide, and the second promoter is identical to or different from the first promoter.
8. The microorganism of claim 1, wherein the gastrointestinal disease is colorectal cancer, colon polyp, colitis, ischemic gastrointestinal diseases, dysentery, intestinal vascular dysplasia, diverticulosis, irritable bowel syndrome, or Crohn's disease.
9. A pharmaceutical composition for prevention or treatment of gastrointestinal disease, comprising the microorganism of claim 1, which produces and secretes a P8 protein having an amino acid sequence represented by SEQ ID NO: 2.
10. A pharmaceutical composition for prevention or treatment of gastrointestinal disease, comprising a Pediococcus pentosaceus strain, wherein the Pediococcus pentosaceus strain comprises a heterologous nucleic acid encoding a therapeutic peptide having a therapeutic effect against at least one gastrointestinal disease, and the heterologous nucleic acid comprises: at least one promoter operably linked to the heterologous nucleic acid and selected from the group consisting of SEQ ID NOs: 3 to 8 and combinations thereof; and a gene encoding a secretion signal peptide.
11. The pharmaceutical composition of claim 10, wherein the secretion signal peptide is a USP45 secretion signal peptide, Usp45 N4, or a Lactobacillus brevis S-layer protein signal peptide.
12. The pharmaceutical composition of claim 10, wherein the gene construct further comprises, downstream of the promoter, a second promoter, a second secretion signal peptide, and a heterologous nucleic acid sequence encoding a second therapeutic peptide, and the second promoter is identical to or different from the first promoter.
13. The pharmaceutical composition of claim 10, further comprising a pharmaceutically acceptable carrier or pharmaceutically acceptable salt.
14. The pharmaceutical composition of claim 10, further comprising a chemotherapeutic compound.
Description
DESCRIPTION OF DRAWINGS
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
MODE FOR INVENTION
[0031] The present invention will be described in more detail below with reference to the accompanying drawings.
[0032] Unless otherwise defined, all the scientific and technical terms used in the specification have the same meanings as commonly understood by those skilled in the technical field to which the present invention.
[0033] The term nucleic acid refers to a deoxyribonucleotide or ribonucleotide polymer in either single- or double-stranded form, and unless otherwise limited, encompasses known analogs of natural nucleotides that that hybridize to nucleic acids in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence includes its complementary sequence.
[0034] As used herein, the term promoter refers to a DNA sequence capable of controlling the expression of a coding sequence or functional RNA. Any person skilled in the art will easily recognize a promoter region. The promoter consists of proximal and distal upstream elements. Proximal elements include a TATA box capable of directing RNA polymerase II to initiate RNA synthesis at an appropriate transcription initiation site.
[0035] The term biologically active molecule refers to substances which are involved in gene therapy or capable of regulating immune responses, and include substances capable of regulating intracellular signal transduction mechanisms or the expression of other particular genes. These substances may include growth factors, substances for cancer treatment, tumor suppressors, cytokines, interferons, and the like.
[0036] As used herein, a heterologous sequence or a heterologous nucleic acid means one that originates from a foreign source (or species) or, if originates from the same source, is modified from its original form. Thus, a heterologous nucleic acid operably linked to a promoter is derived from a source different from that from which the promoter was derived, or, if derived from the same source, is modified from its original form.
[0037] The term operably linked refers to functional linkage between a nucleic acid expression control sequence (such as a promoter, signal sequence, or array of transcription factor binding sites) and a heterologous nucleic acid sequence, wherein the expression control sequence affects transcription and/or translation of the nucleic acid corresponding to the heterologous nucleic acid sequence.
[0038] As used herein, the terms protein and polypeptide are used interchangeably. A polypeptide refers to a polymer of amino acids, and does not refer to a specific length of the molecule. This term also includes post-translational modifications of the polypeptide, such as glycosylation, phosphorylation and acetylation.
[0039] As used herein, the term prevention means a medical or public health procedure whose purpose is to prevent disease rather than to treat or cure disease.
[0040] As used herein, the term treatment means a medical or public health procedure whose purpose is to treat or cure disease.
[0041] As used herein, the term therapeutically effective amount refers to the amount of therapeutic substance or composition effective to treat a disease or disorder in a subject, e.g., human or animal, i.e., to obtain a desired local or systemic effect and performance.
[0042] As used herein, the term pharmaceutically acceptable means compatible with the other ingredients of a pharmaceutical composition and not deleterious to the recipient thereof.
[0043] One aspect of the present invention is directed to a microorganism for delivering a drug for treatment of gastrointestinal disease, wherein the microorganism has been transformed with a gene construct, including a P8 protein-encoding polynucleotide operably linked to an exogenous promoter and having a nucleotide sequence represented by SEQ ID NO: 1 and a gene encoding a secretion signal peptide, and expresses and secretes the P8 protein in the gastrointestinal tract.
[0044] In one embodiment of the present invention, the P8 protein is an 8-kDa protein frayment extracted from the lactic acid bacterium Lactobacillus rhamnosus, which is an anticancer protein derived from a Lactobacillus rhamnosus cell lysate.
[0045] The microorganism for delivering a drug for treatment of gastrointestinal disease according to the present invention, which expresses and secretes the P8 protein in the gastrointestinal tract, may exhibit synergistic effects by the anticancer effect of the lactic acid bacteria themselves in addition to the anticancer effect of the P8 protein. Lactic acid bacteria strains may exhibit the effect of inhibiting the production of carcinogenic substances by improvement of intestinal microbiota and the effect of inhibiting cancer cell proliferation by the activation of intestinal immune functions.
TABLE-US-00001 TABLE1 SEQIDNO Definition Sequence SEQIDNO:1 Nucleotide gcaacagtagatcctgaaaagacattgtttctcgatgaaccaatga sequenceofP8 acaaggtatttgactggagcaacagcgaagcacctgtacgtgatgc protein gctgtgggattattacatggaaaagaacagccgtgataccatcaag actgaagaagaaatgaaaccagtcctagacatgtccgacgatgagg tcaaagccctagcagaaaaggttctcaagaagtaa SEQIDNO:2 Aminoacid ATVDPEKTLFLDEPMNKVFDWSNSEAPVRDALWDYYMEKNSRDTIK sequenceofP8 TEEEMKPVLDMSDDEVKALAEKVLKK protein
[0046] In the present invention, five strong promoters for expression of a target protein in lactic acid bacteria were selected. The exogenous promoter may be selected from SEQ ID NO: 3 (ermE, erythromycin resistance gene), SEQ ID NO: 4 (PK promoter, pyruvate kinase), SEQ ID NO: 5 (GK promoter, glucokinase), SEQ ID NO: 6 (GPFK promoter, 6-phosphofructokinase), SEQ ID NO: 7 (G6Pi promoter, glucose 6-phosphate isomerase), SEQ ID NO: 8 (L-LDH promoter, L-lactate dehydrogenase), and combinations thereof, derived from Pediococcus pentosaceus.
TABLE-US-00002 TABLE2 Primer Sequence(5 .fwdarw. 3) ermE GGATCCTTTTTAGTATTTTTAATTAATTGTAATCAGCACAGTTCATTATCAACCAAACAAAA AATAAGTGGTTATAATGAATCGTTAATAAGCAAAATTCATATAACCAAATTAAAGAGGGTTA TAATGAAAAAAAAGATTATCTCAGCTATTTTAATGTCTACAGTGATACTTTCTGCTGCAG PK GGATCCCTAAAGATCGCGTTTTAGCAAGTAAGATGGGTGCTTACGCTGTTGAGCTACTCCTT GAAGGTAAGGGTGGTTTAGCAGTTGGAATCTTAGAAAATAAGGTTCAAGCTCATAACATGCT TGACTTGTTTGATGCAAAACATCAAGCAGATGATTCACTTTACCAATTAAGTGAAGATTTAT CATTCTAGAGTTCTATTAATATTTGGATAAAATGACTTAAGAAGTCTTTTATAATTTAAAAT CAAGGGAGAGATTCTGTAATGAAAAAAAAGATTATCTCAGCTATTTTAATGTCTACAGTGAT ACTTTCTGCTGCAG GK GGATCCATAATCTGGTAAATTAGTTGAGATGGTATTATGAAAACACTTTATGATGTGCAACA ACTTTTAAAGCAATTCGGAATATTTGTTTACGTTGGAAAACGTAAATGGGATATTGAATTGA TGAGTATTGAATTGAAAAATTTGTACAAAGCAGGAGTCGTCGATAAACCGACTTATGTTAAA GCTCAGTTGGTTTTACGACATGAGCATCATATTGAAGAGGTTAGAGATAACCAACAAAAATA ATGGAGGGTTTCGAAGTAATGAAAAAAAAGATTATCTCAGCTATTTTAATGTCTACAGTGAT ACTTTCTGCTGCAG GPFK GGATCCCCAGTTATTTTAGTTTATGAGGATACTAATGAACATAATGAGTTGTCTGAAAAATT TTATTTAAATGACAGTTCTGAAGTAAAAGAACAATTAGCAGAATTGCTAGGAAGTCAACATA TTTCGTTAATTAAAAAATAAATTTTGAATAAAGCACTTACATTCGATTAATTAAGAAAATGG TACAGACAACTGTTTTCAAAAGTGATAAAATCAACAATGAAGTTTTGAAAAAACTCAATATT TCTGTTTGAGGTGAAAAGATGAAAAAAAAGATTATCTCAGCTATTTTAATGTCTACAGTGAT ACTTTCTGCTGCAG G6Pi GGATCCATGCCGGCTAAAGTGGTGGATAAATTGAATCATCCCCAAGAACTGGAATAAGATAA AATTGTAGTGCTTTCAGGCTTTACCAGCCATCTTTTGAAAAAATTAATTTCTTTCAAAAGTG CGTGTGACAGGTGATCAACTAGATTAAATGGGGAGGGTATCCCAGTAAATATTAGGTTAAAT CGGATAGGCTTAACCAAATTAAGTAATTTTATTGTATAATGGTACAGATAAAGAATTTTAAA CAAAAGGGGTAGTTATTAATGAAAAAAAAGATTATCTCAGCTATTTTAATGTCTACAGTGAT ACTTTCTGCTGCAG L-LDH GGATCCTCATTTTCATGTTATTTTTCCACCCTCAACACGCAAAAACGGCTGAAAGAGCAAAA ACCCCTCAGCTGTCCACGTTTATTTTCATGTAATATTACCATATTATTGACCCCAAGCGGGT CTTTTAACCTCTAACTTATCAATCACTTTACTAACTATACCCGAACTTCATAAAATTTTTAC TCAACTTTCTTTTATGAAAATGCTATACTTAGTATTGTTTGATAAATTCAAATATTATATGA AAAAAGGGGATTGATCTTATGAAAAAAAAGATTATCTCAGCTATTTTAATGTCTACAGTGAT ACTTTCTGCTGCAG
[0047] The promoters, when introduced into microbial cells, promote the expression of a heterologous nucleic acid encoding a biologically active foreign protein. Of the promoters of SEQ ID NO: 3 to SEQ ID NOs: 8, five (ermE promoter, PK promoter, GK promoter, GPFK promoter, and G6Pi promoter) were selected from the glycolysis metabolic pathway of Pediococcus pentosaceus, and one (L-LDH promoter) was selected from the secondary metabolite lactate production pathway. These promoters are strong promoters that induce high-level expression of a heterologous nucleic acid in lactic acid bacteria (e.g., Pediococcus pentosaceus). These promoters enable the microorganism of the present invention to function as a drug delivery system and to produce and secrete a sufficient amount of the P8 protein at a specific site in the gastrointestinal tract.
[0048] The gene construct may increase not only the expression level of a heterologous nucleic acid but also secretion of the heterologous nucleic acid. As used herein, the expression protein is secreted means that the protein is transported extracellularly from microbial cells, and this expression includes the case in which the entire protein molecule is substantially present in medium in a completely released form, and also includes the case in which the entire protein molecule is present in the cell surface layer, and the case in which a portion of the protein molecule is present in medium while the remaining portion of the molecule is present in the cell surface layer.
[0049] The gene construct may also include a replication origin replicable in microbial cells. The reason for this is that manipulation of the vector is more efficient in lactic acid bacteria strain, and preferred examples of the replication origin include ColE1, Ori, oriT, and the like.
[0050] The gene construct may include a secretion signal peptide sequence suitable for allowing the therapeutic peptide to be secreted or released from a microbial drug delivery system (e.g., a Pediococcus pentosaceus system). To allow secretion of the therapeutic peptide, a fragment encoding a secretion signal peptide suitable for use in Pediococcus pentosaceus may be added to the 5 end or 3 end of the heterologous nucleic acid sequence.
[0051] The secretion signal peptide may include a secretion signal peptide that directs strong protein secretion, such as a USP45 secretion signal, Usp45 N4 in which lysine at position 4 of a wild-type Usp45 secretion signal is substituted with asparagine, or a Lactobacillus brevis S-layer protein signal peptide. This secretion signal peptide is capable of providing the secretion of the exogenous protein of interest. In addition, this secretion signal peptide sequence can additionally control the production and secretion of the therapeutic polypeptide of interest.
[0052] In another embodiment of the present invention, the gene construct may further include, downstream of the promoter, a second promoter other than the above-described promoter of any one of SEQ ID NOs: 3 to 8, a second secretion signal peptide, and a second nucleic acid sequence encoding a therapeutic polypeptide.
[0053] In another embodiment of the present invention, the gene construct may necessarily have a first promoter upstream of the heterologous nucleic acid to be expressed, and may also include a second promoter downstream of the heterologous nucleic acid to be expressed. The first promoter and the second promoter may be the same as or different from each other. It is possible to use not only a non-specific promoter capable of promoting the expression of a foreign gene in most cells or tissues, but also a specific or selective promoter, such as a tissue- or organ-specific promoter, a tumor-specific promoter, a development- or differentiation-specific promoter or the like. For example, a specific promoter may be used as the first promoter, and a non-specific promoter may be used as the second promoter. A microorganism transformed with a gene construct including these two promoters is capable of expressing a desired heterologous polypeptide or protein in a very high yield.
[0054] The microbial strain may be a strain belonging to the genus Lactobacillus, Latococcus, Leuconostoc, Pediococcus, or Bifidobacterium. Specific examples of the strain include, but are not necessarily limited to, Lactobacillus rhamnosus, Lactobacillus acidophilus, Lactobacillus paracasei, Lactobacillus plantarum, Pediococcus pentosaceus, or Lactobacillus brevis strains.
[0055] Preferably, the strain may be a Pediococcus pentosaceus strain (e.g., KCCM12181P). Pediococcus pentosaceus can survive during passage through the gastrointestinal tract due to its excellent acid resistance and bile juice resistance, and reach and adhere well to the intestinal mucosal layer in a living form, indicating that it can continuously function as a drug delivery system.
[0056] The strain that is used as a drug delivery system preferably Pediococcus PP P8 deposited under accession number KCCM12181P, but any strains for delivering a drug for treatment of gastrointestinal disease, which expresses and secretes the P8 protein of the present invention, are all included in the scope of the present invention.
[0057] The microorganism of the present invention is obtained by transfecting a microbial strain with an expression vector including the gene construct, and thus a heterologous nucleic acid encoding a desired therapeutic peptide can be expressed by the microbial strain at a predetermined location in the gastrointestinal tract, thereby producing the therapeutic peptide.
[0058] Another aspect of the present invention is directed to a pharmaceutical composition for prevention or treatment of gastrointestinal disease, which includes the above-described microbial strain that produces and secretes the P8 protein having the amino acid sequence represented by SEQ ID NO: 2.
[0059] Still another aspect of the present invention is directed to a pharmaceutical composition for prevention or treatment of gastrointestinal disease, including a Pediococcus pentosaceus strain, wherein the Pediococcus pentosaceus strain includes a heterologous nucleic acid encoding a therapeutic peptide having a therapeutic effect against at least one gastrointestinal disease, wherein the heterologous nucleic acid includes: at least one promoter operably linked to the heterologous nucleic acid and selected from SEQ ID NOs: 3 to 8 and combinations thereof, derived from Pediococcus pentosaceus; and a gene encoding a secretion signal peptide.
[0060] The heterologous nucleic acid may preferably encode a therapeutic peptide or a disease-related polypeptide. In addition, the heterologous nucleic acid may encode an antigenic polypeptide for use as a vaccine. In the present invention, the heterologous nucleic acid may be a gene encoding a hormone, a cytokine, an enzyme, a coagulation factor, a transporter protein, a receptor, a regulatory protein, a structural protein, a transcription factor, an antigen, an antibody or the like. Specific examples thereof include, but are not limited to, genes encoding thrombopoietin, growth hormones, growth hormone-releasing hormones, growth hormone-releasing peptides, interferons, interferon receptors, colony-stimulating factors, glucagon-like peptides, G-protein coupled receptors, interleukins, interleukin receptors, enzymes, interleukin binding proteins, cytokine binding proteins, macrophage activators, macrophage peptides, B-cell factors, T-cell factors, protein A, allergy inhibitors, necrosis glycoproteins, immunotoxins, lymphotoxins, tumor necrosis factors, tumor suppressors, transforming growth factors, -1 anti-trypsin, albumin, -lactalbumin, apolipoprotein-E, erythropoietin, highly glycosylated erythropoietin, angiopoietin, hemoglobin, thrombin, thrombin receptor activating peptides, thrombomodulin, blood factors VII, VIIa, VIII, IX and XIII, plasminogen activators, fibrin-binding peptides, urokinases, streptokinases, hirudin, protein C, C-reactive proteins, superoxide dismutase, leptin, platelet-derived growth factors, epithelial growth factors, epidermal growth factors, angiostatin, angiotensin, bone growth factors, bone stimulating proteins, calcitonin, insulin, atriopeptin, cartilage inducing factors, elcatonin, connective tissue activating factors, follicle stimulating hormones, luteinizing hormones, luteinizing hormone releasing hormones, nerve growth factors, parathyroid hormones, relaxin, secretin, somatomedin, insulin-like growth factors, adrenocortical hormones, glucagon, cholecystokinin, pancreatic polypeptides, gastrin releasing peptides, corticotropin releasing factors, thyroid stimulating hormones, autotaxin, lactoferrin, myostatin, receptors, receptor antagonists, cell surface antigens, virus derived vaccine antigens, monoclonal antibodies, polyclonal antibodies, antibody fragments, and the like.
[0061] Gastrointestinal diseases suitable for treatment with the pharmaceutical composition of the present invention includes diseases and disorders that affect organs, such as the mouth, esophagus, stomach, small intestine, large intestine, rectum, pancreas, liver and gallbladder. For examples, the diseases include dry mouth, oral ulcer, gingival diseases, gastroesophageal reflux diseases, gastric ulcer, inflammatory bowel diseases, inflammatory colitis, Crohn's disease, mycositis, gastric cancer, and colorectal cancer. In particular, the pharmaceutical composition may advantageously be used for treatment of colorectal cancer, colitis, irritable bowel syndrome, and Crohn's disease.
[0062] The Pediococcus pentosaceus strain can survive during passage through the gastrointestinal tract due to its excellent acid resistance and bile juice resistance, and reach and adhere well to the intestinal mucosal layer in a living form, indicating that it can continuously function as a drug delivery system.
[0063] Still another aspect of the present invention is directed to a pharmaceutical composition for prevention or treatment of gastrointestinal disease, which includes the strain of the present invention, that is, a microorganism which has been transformed with a gene construct, including a P8 protein-encoding polynucleotide operably linked to an exogenous promoter and a gene encoding a secretion signal peptide, and which expresses and secretes the P8 protein in the gastrointestinal tract.
[0064] The secretion signal peptide may be a secretion signal peptide, such as a USP45 secretion signal peptide, Usp45 N4 or a Lactobacillus brevis S-layer protein signal peptide.
[0065] The strain may further include, downstream of the promoter, a second promoter, a second signal peptide, and a heterologous nucleic acid sequence encoding a second therapeutic peptide, and the second promoter may be the same as or different from the first promoter. The heterologous nucleic acid sequence encoding the first therapeutic peptide and the heterologous nucleic acid sequence encoding the second therapeutic peptide may be the same as or different from each other. In another example, the nucleotide sequence of the heterologous nucleic acid sequence encoding the first therapeutic peptide and the nucleotide sequence of heterologous nucleic acid sequence encoding the second therapeutic peptide may differ from each other while they encode the same therapeutic peptides having the same amino acid sequence.
[0066] The pharmaceutical composition of the present invention may further include a pharmaceutically acceptable carrier or pharmaceutically acceptable salt. Meanwhile, the pharmaceutical composition may further include chemotherapeutic agents, such as 5-fluorouracil (5-FU), UFT (tegafur-uracil), capecitabine, irinotecan, oxaliplatin, bevacizumab (trade name: Avastin), and cetuximab (trade name: Erbitux).
[0067] The composition of the present invention is preferably administered by a route that is most effective for treatment. The composition may be administered orally or by parenteral routes, such as intraoral, tracheobronchial, intrarectal, subcutaneous, intramuscular and intravenous routes. Dosage forms include sprays, capsules, tablets, granules, syrups, emulsions, suppositories, injections, ointments, tapes, and the like.
[0068] For oral administration, gastroresistant oral dosage forms may be formulated, which may also include compounds providing controlled release of the host cells and thus provide controlled release of the desired therapeutic peptide encoded therein. For example, the oral dosage form (including tablets, pellets, granulates, and powders) may be coated with a thin layer of excipient (usually polymers, cellulosic derivatives and/or lipophilic materials) that resists dissolution or disruption in the stomach, but not in the intestine, thereby allowing transit through the stomach in favor of disintegration, dissolution and absorption in the intestine.
[0069] The oral dosage form may be designed to allow slow release of the host cells and of the recombinant protein thereof, for instance as controlled release, sustained release, prolonged release, sustained action tablets or capsules. These dosage forms usually contain conventional and well known excipients, such as lipophilic, polymeric, cellulosic, insoluble, swellable excipients. Controlled release formulations may also be used for any other delivery sites including intestinal, colon, bioadhesion or sublingual delivery (i.e., dental mucosal delivery) and bronchial delivery.
[0070] Preparations suitable for oral administration include emulsions, syrups, capsules, tablets, powders, granules and the like. Liquid preparations such as emulsions or syrups may be prepared using, as additives, water, sugars such as sucrose, sorbitol and fructose, glycols such as polyethylene glycol and propylene glycol, oils such as sesame oil, olive oil and soybean oil, antiseptics such as p-hydroxybenzoates, flavors such as strawberry flavor and peppermint, and the like. Capsules, tablets, powders, granules, and the like may be prepared using, as additives, excipients such as lactose, glucose, sucrose and mannitol, disintegrating agents such as starch and sodium alginate, lubricants such as magnesium stearate and talc, binders such as polyvinyl alcohol, hydroxypropyl cellulose and gelatin, surfactants such as fatty acid esters, plasticizers such as glycerin, and the like.
[0071] Preparations suitable for parenteral administration include injections, suppositories, sprays and the like. Injections are prepared using carriers including a salt solution, a glucose solution, or a mixture thereof. Alternatively, powdery injections may also be prepared by freeze-drying the strain according to a conventional method and adding sodium chloride thereto. Suppositories are prepared using carriers such as cacao butter, hydrogenated fat or carboxylic acid. In addition, sprays are prepared using the compound itself and carriers which do not stimulate the oral and airway mucous membranes of a recipient and which disperse the compound into fine particles which are easily absorbed.
[0072] The dose of the therapeutic peptide-producing strain which is the active ingredient of the pharmaceutical composition according to the present invention may vary depending on the patient's age, sex, body weight and disease. However, the strain may be administered once or several times at a dose of 0.001 to 100 mg/kg, preferably 0.01 to 10 mg/kg.
[0073] In addition, the dose of the strain according to the present invention may be increased or decreased depending on the route of administration, the severity of the disease, the patient's sex, body weight, age and the like. Accordingly, the dose is not intended to limit the scope of the present invention in any way.
[0074] The present invention will be described in more detail below with reference to examples. However, these examples are for illustrative purposes only, and the scope of the present invention is not limited by these examples.
EXAMPLES
Example 1
Construction of System for Overexpression and Secretion of Lactic Acid Bacteria-Derived Protein
Example 1-1
Selection of Promoters for Induction of Overexpression
[0075] Six strong promoters (ermE, erythromycin resistance gene promoter; PK, pyruvate kinase; GK, glucokinase; GPFK, 6-phosphofructokinase; G6Pi, glucose 6-phosphoate isomerase; and L-LDH, L-lactate dehydrogenase) for expression of a target protein (P8 protein A) in lactic acid bacteria were selected from the glycolysis metabolic pathway of Pediococcus pentosaceus. Experiments demonstrated that the glucose consumption rate of the host was very high, and HPLC analysis indicated that nearly 100% of the consumed glucose was converted to the secondary metabolite L-lactate. For this reason, of the promoters, five were selected from the glycolysis metabolic pathway, and one was selected from the secondary metabolite lactate production pathway.
Example 1-2
Construction of System for Overexpression and Secretion of Target Protein
[0076] The plasmid pCBT24-2 (SEQ ID NO: 9) (KCCM12182P) was used for cloning of the P8 protein. The promoters selected in Example 1-1 were ligated with a usp45 signal peptide, thereby synthesizing DNA frayments. BamHI/PstI restriction enzyme sites were inserted into each promoter ligated with the signal peptide. After completion of the synthesis, a portion of each promoter ligated with the signal peptide was digested with BamHI/PstI restriction enzymes, and the DNA frayments were isolated/purified by DNA gel extraction, and each of the DNA frayments was inserted into a pCBT24-2-P8/BamHI/PstI vector digested with the same restriction enzymes. Each of the constructed pCBT24-2-PK-P8, pCBT24-2-GK-P8, pCBT24-2-6PFK-P8, pCBT24-2-FK-P8, pCBT24-2-G6Pi-P8, pCBT24-2-L-LDH-P8 and pCBT24-2-D-LDH-P8 was transformed into a Pediococcus pentosaceus SL4 strain.
[0077] The promoters that showed high activity in the previous step were combined with each other, thereby constructing pCBT24-2-GK-P8-L-LDH-oriP8, pCBT24-2-PK-P8-PK-oriP8, and pCBT24-2-GK-P8-GK-oriP8. Each of the constructed DNAs was transformed into the Pediococcus pentosaceus SL4 strain.
[0078] Among the strains of the present invention, the strain transformed with pCBT24-2-PK-P8-PK-oriP8 was named PP P8 and the Korean Culture Center of Microorganisms (KCCM), located at Yurim B/D Hongjenae-2ga-gil, Seodaemun-gu, Seoul, Korea, on Nov. 30, 2017 under accession number KCCM12181P.
[0079] The transformant was mixed with LB liquid medium, and then cultured at 37 C. for 1 hour. The transformant cultured for 1 hour was plated onto LB agar medium containing erythromycin (final concentration: 10 g/ml), and a strain showing resistance to the antibiotic was selected as a strain (PP DDS) to be used as a drug delivery system in the present invention.
Example 1-3
Culture of Pediococcus pentosaceus SL4 Transformant
[0080] The transformant grown on MRS solid medium (agar plate) was inoculated into 10 ml of MRS liquid medium (containing 10 mg/ml of erythromycin) and statically cultured at 37 C. for 15 hours (overnight incubation). 1 ml of the culture was inoculated into 10 ml of M9 minimal medium (containing 10 mg/ml of erythromycin) and then statically cultured at 37 C. for 48 hours. 5 ml of the culture was centrifuged, and the supernatant was collected. 5 ml of the supernatant was concentrated by TCA precipitation to isolate total protein. Using the total protein, the expression and secretion levels of the P8 protein were comparatively analyzed by Western blotting. The microbial cells were diluted with buffer and lysed using a sonicator, and then the cell extract was analyzed by Western blotting, thereby determining the amount of P8 protein that was not secreted after expression.
Example 1-4
Isolation and Detection of P8 Protein
[0081] The lactic acid bacteria transformant was cultured, and then 100% TCA (Trichloro Acetic Acid) was added to 5 ml of the culture supernatant to a final concentration of 20%. After mixing, the solution was incubated on ice for 30 minutes, and centrifuged at 15,000 rpm and 4 C. for 30 minutes to induce the precipitation of all proteins. After centrifugation, the supernatant was removed, and 200 l of acetone was added to the precipitate which was then centrifuged at 15,000 rpm and 4 C., and the precipitated protein was washed. After the remaining acetone was completely removed by drying at room temperature, the secretion level of the target protein present in the culture supernatant was measured. The secretion level was measured by Western blotting, and the results of the measurement are shown in
[0082] Referring to
Example 2
Evaluation of Anticancer Effect of P8 Protein by Use of In Vivo Lactic Acid Bacteria Expression/Secretion System
Example 2-1
Tumor Cell Transplantation and Tumor Transplantation
[0083] The colorectal cancer cell line DLD-1 obtained from the Korean Cell Line Bank (Seoul, Korea) was subcultured at 37 C. in a 5% CO.sub.2 incubator with RPMI 1640 medium (Sigma, MO, USA) containing 10% fetal bovine serum (FBS; Invitrogen, NY, USA), penicillin (0.02 UI/ml; Sigma, MO, USA), streptomycin (0.02 g/ml; Sigma, MO, USA), glutamine (2 mM: Sigma, MO, USA) and non-essential amino acid (1%; Sigma, MO, USA). The cultured DLD-1 cells were suspended, and the tumor cell suspension were transplanted subcutaneously into the back of male nude mice (BALB/cAnN.Cg-Foxnlnu/CrlNarl; 5 weeks old) in an amount of 0.2 ml (210.sup.6 cells/mouse), thereby forming solid tumors. To dissect tumor tissue formed from the subcultured group, the animals were sacrificed and the tumor lumps were dissected. The blood vessels and fat layer distributed on the surface were removed, and then only fresh tumor tissue was selected and transplanted subcutaneously into untreated animals by a troca needle.
Example 2-2
Division into Experimental Groups and Substance Administration
[0084] When the volumes of individual tumors reached 100-150 mm.sup.3 after transplantation of the tumor lumps, the body weights and the tumor sizes were measured, and the animals were randomly grouped. The experimental animals were divided into a total of seven groups as shown in Table 3 below, and each group consisted of 10 animals: a negative control group (tumor-transplanted control group: G1); a positive control group (a group administered with an anticancer agent, 40 mg/Kg 5-Fu; 5-fluorouracil, Siyma, MO, USA: G2), and experimental groups {a group administered with 110.sup.10 CFU/head (a group administered with drug delivery system (DDS) P. pentosaceus (empty vector)): G3; a group administered with 110.sup.9 CFU/head PP-DDS (PK-P8-ChoS-oriP8): 2-promoter system: G4; a group administered with 110.sup.10 CFU/head PP-DDS (PK-P8-ChoS-oriP8): 2-promoter system: G5; a group administered with 110.sup.9 CFU/head PP-DDS (PK-P8-PK-oriP8): 2-promoter system: G6; and a group administered with 110.sup.10 CFU/head PP-DDS (PK-P8-PK-oriP8: 2-promoter system: G7). Each of the groups was administered orally with the indicated substance once a day for 7 weeks. Here, the transformant was cultured in MRS medium and suspended to a concentration of 10.sup.10/200 l, and the suspension was administered orally once a day for a total of 6 weeks.
TABLE-US-00003 TABLE 3 Number of Group Treatment animals G1 (NC1) Treated with PBS 100 ml/head 10 G2 (PC1) 5-fluorouracil (5-Fu) 400 mg/head 10 G3 (T1) Empty vector 1 10.sup.10 CFU/head 10 G4 (T2) PP-DDS 1 10.sup.9 CFU/head 10 (PK-P8-ChoS-oriP8) G5 (T3) PP-DDS 1 10.sup.10 CFU/head 10 (PK-P8-ChoS-oriP8) G6 (T4) PP-DDS 1 10.sup.9 CFU/head 10 (PK-P8-PK-oriP8) G7 (T5) PP-DDS 1 10.sup.10 CFU/head 10 (PK-P8-PK-oriP8) Total number of animals 70
Example 2-3
Measurement of Change in Volume of Solid Cancer
[0085] The growth of tumors in the seven groups of nude mice BALB/cAnN.Cg-Foxn1nu/CrlNarl; 5 weeks old) (10 animals per group) transplanted with the colorectal cancer cell line DLD-1 was confirmed, and the tumor lumps transplanted subcutaneously into the right sides manifested as subcutaneous nodules 5 days after transplantation.
[0086] After tumor tissue transplantation, the animals were grouped as shown in Table 3 above and were treated according to the dosage schedule. During the period from the 0.sup.th day before administration to the 49.sup.th day after administration, the sizes of the tumor tissues were measured once a week with Vernier calipers. On the 49.sup.th day of the experiment, the xenograft models (solid cancer models) were sacrificed, and tissue samples were obtained, after which tumor metastasis was observed. The tumor volume was calculated using the following equation: width.sup.2length/2 (mm.sup.3). The measured tumor sizes are shown in
[0087] Referring to
[0088] The tumor size in the groups (G4 and G5) administered with the drug delivery system Pediococcus pentosaceus strain (KCCM12181P) of the present invention, which expresses and secretes the P8 protein, significantly decreased compared to those in the negative control group (G1) and the positive control group (G3), and decreased to a size similar to that in the group (G2) administered with 5-fluorouracil (5-Fu). Meanwhile, particularly, in the groups (G6 and G7) administered with high concentrations of the strain having the two promoters, the tumor size greatly decreased compared to that in the group (G2) administered with 5-fluorouracil (5-Fu), indicating that the strain exhibited very excellent anticancer activity.
Example 2-4
Examination of Survival of PP DDS in Mouse Intestines and Stability of Plasmid DNA
[0089] In order to examine whether the drug delivery system Pediococcus pentosaceus strain (KCCM12181P) that expressed/excreted the P8 protein could reach mouse intestines alive after administration to mice, the Pediococcus pentosaceus strain was administered to mice. After 6 weeks, mouse intestinal contents were collected and cultured on MRS (10 g/ml of erythromycin) plates, and the amount of the Pediococcus pentosaceus strain present in the mouse intestinal contents was analyzed. The expression and secretion levels of the P8 protein from the survived Pediococcus pentosaceus strain were measured.
[0090] After the completion of the 6-week experiment, the contents in the mouse small intestines were collected and washed twice with PBD buffer, followed by centrifugation. The remaining supernatant was concentrated by 20% TCA and analyzed by Western blotting to detect the P8 protein. The results of the analysis are shown in
[0091] Referring to
[0092] The use of lactic acid bacteria as therapeutic agents against colorectal diseases, including colorectal cancer, colitis, irritable bowel syndrome, Crohn's disease and the like, is known technology. However, there has been little development regarding a system for overexpression and secretion of a target protein from lactic acid bacteria and the use of the system as a drug delivery system. In the present invention, the protein derived from lactic acid bacteria was introduced into the lactic acid bacteria expression/secretion system, thereby developing the lactic acid bacteria drug delivery system that overexpresses and secretes the protein, and the effect of the drug delivery system was demonstrated by applying it to animal models. Accordingly, it is expected that the present invention will be widely used as a natural therapeutic agent for treatment of colorectal disease in the medical field.
[0093] Although the preferred embodiments of the present invention have been described in detail, the present invention is not limited to the above-described embodiments. Those skilled in the art to which the present invention pertains will appreciate that various modifications and alterations may be easily made based on the above-described embodiments. Therefore, the true scope of protection of the present invention should be defined based on the appended claims and their equivalents.