AMANITIN ANTIBODY CONJUGATES
20190328899 · 2019-10-31
Inventors
- Torsten HECHLER (Lautertal, DE)
- Michael Kulke (Ludwigshafen am Rhein, DE)
- Christian LUTZ (Weinheim, DE)
- Andreas Pahl (Heidelberg, DE)
- Christoph Müller (Birkenau, DE)
- Werner Simon (Hüffelsheim, DE)
- Anikó Pálfi (Hirschberg a.d. Bergstra(3e, DE)
Cpc classification
A61K47/6889
HUMAN NECESSITIES
A61K47/6867
HUMAN NECESSITIES
C07K16/2878
CHEMISTRY; METALLURGY
A61K47/6831
HUMAN NECESSITIES
International classification
A61K47/68
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
Abstract
The invention relates to a conjugate comprising (a) an amatoxin comprising (i) an amino acid 4 with a 6-deoxy position; and (ii) an amino acid 8 with an S-deoxy position; (b) a BCMA-binding moiety comprising (i) the variable domains of humanized antibody J22.9-ISY, and (ii) a heavy chain constant region comprising a D265C mutation; and (c) a protease-cleavable linker linking said amatoxin and said target-binding moiety. The invention furthermore relates to a pharmaceutical composition comprising such conjugate, particularly for use in the treatment of multiple myeloma.
Claims
1. A conjugate according to Formula I comprising (a) an amatoxin; (b) a BCMA-binding moiety comprising (i) the variable domains of the heavy chain according to SEQ ID NO: 1 and the light chain according to SEQ ID NO: 2 of antibody J22.9-ISY, and (ii) a heavy chain constant region comprising a D265C mutation; and (c) a protease-cleavable linker, wherein said BCMA-binding moiety is attached to said linker via the thiol group of the cysteine residue at position 265 in the antibody heavy chain, wherein said amatoxin is characterized by comprising (i) an amino acid 4 with a 6-deoxy position; and (ii) an amino acid 8 with an S-deoxyposition. ##STR00019##
2. The conjugate of claim 1, wherein said BCMA-binding moiety comprises the heavy chain according to SEQ ID NO: 1 and the light chain according to SEQ ID NO: 2.
3. The conjugate of claim 1, wherein said BCMA-binding moiety is an IgG1.
4. A pharmaceutical composition comprising the conjugate of claim 1.
5. A method of treating cancer in a patient, the method comprising administering to the patient the conjugate of claim 1, wherein the cancer is selected from the group consisting of multiple myeloma, diffuse large B-cell lymphoma (DLBCL), and chronic lymphocytic leukemia (CLL).
6. The conjugate of claim 2, wherein said BCMA-binding moiety is an IgG1.
7. A pharmaceutical composition comprising the conjugate of claim 2.
8. A pharmaceutical composition comprising the conjugate of claim 3.
9. A pharmaceutical composition comprising the conjugate of claim 6.
10. A method of treating cancer in a patient, the method comprising administering to the patient the conjugate of claim 2, wherein the cancer is selected from the group consisting of multiple myeloma, diffuse large B-cell lymphoma (DLBCL), and chronic lymphocytic leukemia (CLL).
11. A method of treating cancer in a patient, the method comprising administering to the patient the conjugate of claim 3, wherein the cancer is selected from the group consisting of multiple myeloma, diffuse large B-cell lymphoma (DLBCL), and chronic lymphocytic leukemia (CLL).
12. A method of treating cancer in a patient, the method comprising administering to the patient the conjugate of claim 6, wherein the cancer is selected from the group consisting of multiple myeloma, diffuse large B-cell lymphoma (DLBCL), and chronic lymphocytic leukemia (CLL).
13. A method of treating cancer in a patient, the method comprising administering to the patient the pharmaceutical composition of claim 4, wherein the cancer is selected from the group consisting of multiple myeloma, diffuse large B-cell lymphoma (DLBCL), and chronic lymphocytic leukemia (CLL).
14. A method of treating cancer in a patient, the method comprising administering to the patient the pharmaceutical composition of claim 7, wherein the cancer is selected from the group consisting of multiple myeloma, diffuse large B-cell lymphoma (DLBCL), and chronic lymphocytic leukemia (CLL).
15. A method of treating cancer in a patient, the method comprising administering to the patient the pharmaceutical composition of claim 8, wherein the cancer is selected from the group consisting of multiple myeloma, diffuse large B-cell lymphoma (DLBCL), and chronic lymphocytic leukemia (CLL).
16. A method of treating cancer in a patient, the method comprising administering to the patient the pharmaceutical composition of claim 9, wherein the cancer is selected from the group consisting of multiple myeloma, diffuse large B-cell lymphoma (DLBCL), and chronic lymphocytic leukemia (CLL).
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
DETAILED DESCRIPTION OF THE INVENTION
[0060] Before the present invention is described in detail below, it is to be understood that this invention is not limited to the particular methodology, protocols and reagents described herein as these may vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present invention which will be limited only by the appended claims. Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of ordinary skill in the art.
[0061] Particularly, the terms used herein are defined as described in A multilingual glossary of biotechnological terms: (IUPAC Recommendations), Leuenberger, H. G. W, Nagel, B. and Kolbl, H. eds. (1995), Helvetica Chimica Acta, CH-4010 Basel, Switzerland).
[0062] Throughout this specification and the claims which follow, unless the context requires otherwise, the word comprise, and variations such as comprises and comprising, will be understood to imply the inclusion of a stated integer, composition or step or group of integers or steps, while any additional integer, composition or step or group of integers, compositions or steps may optionally be present as well, including embodiments, where no additional integer, composition or step or group of integers, compositions or steps are present. In such latter embodiments, the term comprising is used coterminous with consisting of.
[0063] Several documents are cited throughout the text of this specification. Each of the documents cited herein (including all patents, patent applications, scientific publications, manufacturer's specifications, instructions, GenBank Accession Number sequence submissions etc.), whether supra or infra, is hereby incorporated by reference in its entirety to the extent possible under the respective patent law.
[0064] The present invention will now be further described. In the following passages different aspects of the invention are defined in more detail. Each aspect so defined may be combined with any other aspect or aspects unless clearly indicated to the contrary. In particular, any feature indicated as being of particular relevance or advantageous may be combined with any other feature or features indicated as being of particular relevance or advantageous.
[0065] The present invention is based on a combination of different advantageous elements and features and in particular on the unexpected observation that a variant form of an amatoxin conjugated to an anti-BCMA antibody based on antibody J22.9, wherein the antibody and the amatoxin are linked by a cleavable linker shows an increased stability under stress conditions, particularly in human plasma, and an improved therapeutic index.
[0066] Thus, in one aspect the present invention relates to a conjugate comprising (a) an amatoxin comprising (i) an amino acid 4 with a 6-deoxy position; and (ii) an amino acid 8 with an S-deoxy position; (b) a BCMA-binding moiety comprising the variable domains of the heavy chain according to SEQ ID NO: 1 and the light chain according to SEQ ID NO: 2 of antibody J22.9-ISY, and (c) a protease-cleavable linker, wherein said BCMA-binding moiety is attached to said linker via the thiol group of the cysteine residue at position 265 in the antibody heavy chain.
[0067] In a particular embodiment, the BCMA-binding moiety comprises a heavy chain constant region comprising a D265C mutation.
[0068] In a particular embodiment, said protease-cleavable linker is a self-immolative linker.
[0069] In a particular embodiment, the conjugate is the conjugate according to Formula I.
##STR00002##
[0070] In the context of the present invention, the term amatoxin includes all cyclic peptides composed of 8 amino acids as isolated from the genus Amanita and described in Wieland, T. and Faulstich H. (1978), which comprise the specific positions according to (i) (i.e. where the indole moiety of the amino acid residue tryptophan has no oxygen-containing substituent at position 6, particularly where position 6 carries a hydrogen atom) and (ii) (i.e. in which the thioether sulfoxide moiety of naturally occurring amatoxins is replaced by a sulfide), and furthermore includes all chemical derivatives thereof; further all semisynthetic analogues thereof; further all synthetic analogues thereof built from building blocks according to the master structure of the natural compounds (cyclic, 8 amino acids), further all synthetic or semisynthetic analogues containing non-hydroxylated amino acids instead of the hydroxylated amino acids, further all synthetic or semisynthetic analogues, in each case wherein any such derivative or analogue carries at least the positions (i) and (ii) mentioned above and is functionally active by inhibiting mammalian RNA polymerase II.
[0071] Functionally, amatoxins are defined as peptides or depsipeptides that inhibit mammalian RNA polymerase II. Preferred amatoxins are those with a functional group (e.g. a carboxylic group or carboxylic acid derivative such as a carboxamide or hydroxamic acid, an amino group, a hydroxy group, a thiol or a thiol-capturing group) that can be reacted with linker molecules or target-binding moieties as defined above. Amatoxins which are particularly suitable for the conjugates of the present invention are di-deoxy variants of -amanitin, -amanitin, -amanitin, -amanitin, amanullin, or amanullinic acid, or mono-deoxy variants of amanin, amaninamide, y-amanin, or y-amaninamide as shown in
[0072] An amatoxin variant comprising (i) an amino acid 4 with a 6-deoxy position; and (ii) an amino acid 8 with an S-deoxy position was first mentioned in Zhou et al., ChemBioChem 16 (2015) 1420-1425, as one of four diastereomers being obtained in a total synthesis approach for amatoxins. However, the fact that such variants are more stable under stress conditions in plasma and result in a reduced degree of cross-linked products (as shown in
[0073] In a particular embodiment, the conjugate of the present invention has a purity greater than 90%, particularly greater than 95%.
[0074] Monoclonal murine antibody J22.9 has been obtained using standard hybridoma technology from C57BL/6 mice immunized with purified human BCMA extracellular domain (residue 1-54) N-terminally fused to glutathione S-transferase (GST). Due to instability of the hybridomas, variable regions of light and heavy chain were amplified and cloned upstream of the human kappa and IgG1 constant domain, respectively, resulting in chimeric J22.9-xi antibody (Oden et al., 2015).
[0075] Antibody J22.9-xi was humanized based on sequence alignments and data obtained from crystal structure in order to identify mutations that would potentially disrupt the binding to BCMA. Briefly, J22.9-xi Fab fragment was generated from full-length antibody by incubation with pepsin and combined with purified 54 amino acid residue BCMA extracellular domain. Isolated complexes were used for crystallization studies and J22.9-xi BCMA binding epitopes were analysed in detail (WO2014/068079, WO2015/166073, Oden et al., 2015, Marino et al. 2016).
[0076] Based on these analyses, various combinations of fully humanized gene cassettes were identified and expressed as full-length antibody. J22.9-H is the fully humanized version of J22.9-xi. J22.9-ISY and J22.9-FSY are fully humanized versions containing in addition mutations intended to remove potentially detrimental post-translational modification (PTM) motifs.
[0077] J22.9-xi binds to purified BCMA and also detects BCMA on human MM cell lines MM.1S, NCI-H929, OPM-2 and RPMI-8226. No binding was detected on BCMA-negative cells. In addition, flow cytometry analyses revealed that cells from bone marrow of MM patients were detectable using J22.9-xi.The affinity of J22.9-xi to BCMA is very high with a mean Kd of 54 M as determined using plasmon resonance (Oden et al., 2015).
[0078] BCMA activates nuclear factor KB (NFB) pathways and triggers signals important for survival of MM and plasma cells through interaction with APRIL and/or BAFF. Affinity of J22.9 to BCMA was shown to be very high and exceeds that of April by 300- and of BAFF by 30.000-fold (Bossen and Schneider 2006). J22.9-xi efficiently blocks binding of APRIL and BAFF to BCMA. In addition, J22.9-xi interferes with APRIL-induced NFB activation by blocking phosphorylation of IKB kinase (IKK) and subsequent IB degradation, leading to reduced DNA-binding activity of NFB. In summary, J22.9-xi interferes with APRIL-induced NFB activation in BCMA-positive NCI-H929 cells (Oden et al., 2015).
[0079] Cytotoxic activity of IgG1 antibodies is achieved through interaction of the IgG1 with Fc receptor (FcR) on effector cells (e.g. natural killer cells) or with the C1q protein of the complement cascade. This interaction is dependent on glycosylation of the antibody at position Asn297 in the heavy chain constant region. Glycans on IgG1 display some heterogeneity but core structure is usually a fucosylated bi-antennary structure with varying levels of sialic acid at the antennae. Numerous investigations have shown that glycosylation affects binding affinity and loss of glycosylation completely abrogates binding altogether. Absence of glycosylation disrupts the structural integrity of the Fc region which is required for optimal binding to the Fc receptor (for review see Hayes et al., 2014). However, absence of core fucose of IgG results in improved binding to Fc receptor and enhanced antibody-dependent cellular cytotoxicity (ADCC).
[0080] Binding of the antibody to effector cells or complement results in ADCC mediated by natural killer cells or complement-dependent cytotoxicity (CDC). J22.9-xi is able to induce strong ADCC and CDC on BCMA-positive MM.1S cells when mixed with isolated Fc-bearing effector, peripheral blood mononuclear cells (PBMCs) from healthy donors.
[0081] Humanized and chimeric antibody variants bind to BCMA-expressing cell lines. No differences in binding characteristics were observed for J22.9-ISY and J22.9-FSY, whereas binding affinity of humanized variant J22.9-H was much lower.
[0082] In the context of the present invention, the term purity refers to the total amount of conjugates being present. A purity of greater than 90%, for example, means that in 1 mg of a composition comprising a conjugate of the present invention, there are more than 90%, i.e. more than 900 pg, of such conjugate. The remaining part, i.e. the impurities may include unreacted starting material and other reactants, solvents, cleavage products and/or side products.
[0083] In a particular embodiment, a composition comprising a conjugate of the present invention comprises more than 100 mg of such conjugate. Thus, trace amount of a conjugate of the present invention that arguably may be present in complex preparations of conjugates of the prior art, e.g. from partial reduction of naturally occurring sulfoxides, are explicitly excluded.
[0084] As used herein, a first compound (e.g. an antibody) is considered to specifically bind to a second compound (e.g. an antigen, such as a target protein), if it has a dissociation constant K.sub.D to said second compound of 100 M or less, particularly 50 M or less, particularly 30 M or less, particularly 20 M or less, particularly 10 M or less, particularly 5 M or less, more particularly 1 M or less, more particularly 900 nM or less, more particularly 800 nM or less, more particularly 700 nM or less, more particularly 600 nM or less, more particularly 500 nM or less, more particularly 400 nM or less, more particularly 300 nM or less, more particularly 200 nM or less, even more particularly 100 nM or less, even more particularly 90 nM or less, even more particularly 80 nM or less, even more particularly 70 nM or less, even more particularly 60 nM or less, even more particularly 50 nM or less, even more particularly 40 nM or less, even more particularly 30 nM or less, even more particularly 20 nM or less, and even more particularly 10 nM or less.
[0085] The term antibody or antigen binding fragment thereof, as used herein, refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e. molecules that contain an antigen-binding site that immunospecifically binds the antigen BSMA. Thus, the term antigen-binding fragments thereof refers to a fragment of an antibody comprising at least a functional antigen-binding domain. In a particular embodiment, functional antigen-binding domain comprises the variable domains of the heavy chain according to SEQ ID NO: 1 and the light chain according to SEQ ID NO: 2 of antibody J22.9-ISY. Also comprised are immunoglobulin-like proteins that are selected through techniques including, for example, phage display to specifically bind to the antigen BSMA. The immunoglobulin molecules of the invention can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2) or subclass of immunoglobulin molecule. Antibodies and antigen-binding fragments thereof suitable for use in the present invention include, but are not limited to, polyclonal, monoclonal, monovalent, bispecific, heteroconjugate, multispecific, human, humanized (in particular CDR-grafted), deimmunized, or chimeric antibodies, single chain antibodies (e.g. scFv), Fab fragments, F(ab).sub.2 fragments, fragments produced by a Fab expression library, diabodies or tetrabodies (Holliger P. et al., Proc Natl Acad Sci USA. 90 (1993) 6444-8), nanobodies, anti-idiotypic (anti-Id) antibodies (including, e.g., anti-Id antibodies to antibodies of the invention), and epitope-binding fragments of any of the above.
[0086] In some embodiments the antigen-binding fragments are human antigen-binding antibody fragments of the present invention and include, but are not limited to, Fab, Fab and F(ab).sub.2, Fd, single-chain Fvs (scFv), single-chain antibodies, disulfide-linked Fvs (dsFv) and fragments comprising either a VL or VH domain. Antigen-binding antibody fragments, including single-chain antibodies, may comprise the variable domain(s) alone or in combination with the entirety or a portion of the following: hinge region, CL, CH1, CH2, and CH3 domains. Also included in the invention are antigen-binding fragments also comprising any combination of variable domain(s) with a hinge region, CL, CH1, CH2, and CH3 domains. In a particular embodiment, the antibody or antigen binding fragment thereof comprises a heavy chain constant region comprising a D265C mutation.
[0087] Antibodies usable in the invention may be from any animal origin including birds and mammals. Particularly, the antibodies are from human, rodent (e.g. mouse, rat, guinea pig, or rabbit), chicken, pig, sheep, goat, camel, cow, horse, donkey, cat, or dog origin. It is particularly preferred that the antibodies are of human or murine origin. As used herein, human antibodies include antibodies having the amino acid sequence of a human immunoglobulin and include antibodies isolated from human immunoglobulin libraries or from animals transgenic for one or more human immunoglobulin and that do not express endogenous immunoglobulins, as described for example in U.S. Pat. No. 5,939,598 by Kucherlapati & Jakobovits.
[0088] In a second aspect, the present invention relates to a pharmaceutical composition comprising the conjugate of the present invention.
[0089] In a third aspect, the present invention relates to the conjugate of the present invention, or the pharmaceutical composition of the present invention, for use in the treatment of cancer in a patient, particularly wherein the cancer is selected from the group consisting of multiple myeloma, diffuse large B-cell lymphoma (DLBCL), and chronic lymphocytic leukemia (CLL), particularly multiple myeloma.
[0090] As used herein, treat, treating or treatment of a disease or disorder means accomplishing one or more of the following: (a) reducing the severity of the disorder; (b) limiting or preventing development of symptoms characteristic of the disorder(s) being treated; (c) inhibiting worsening of symptoms characteristic of the disorder(s) being treated; (d) limiting or preventing recurrence of the disorder(s) in patients that have previously had the disorder(s); and (e) limiting or preventing recurrence of symptoms in patients that were previously symptomatic for the disorder(s).
[0091] As used herein, the treatment may comprise administering a conjugate or a pharmaceutical composition according to the present invention to a patient, wherein administering includes in vivo administration, as well as administration directly to tissue ex vivo, such as vein grafts.
[0092] In particular embodiments, a therapeutically effective amount of the conjugate of the present invention is used.
[0093] A therapeutically effective amount is an amount of a therapeutic agent sufficient to achieve the intended purpose. The effective amount of a given therapeutic agent will vary with factors such as the nature of the agent, the route of administration, the size and species of the animal to receive the therapeutic agent, and the purpose of the administration. The effective amount in each individual case may be determined empirically by a skilled artisan according to established methods in the art.
[0094] In another aspect the present invention relates to pharmaceutical composition comprising an amatoxin according to the present invention, or a conjugate of the present invention of an amatoxin with a target-binding moiety, and further comprising one or more pharmaceutically acceptable diluents, carriers, excipients, fillers, binders, lubricants, glidants, disintegrants, adsorbents; and/or preservatives.
[0095] Pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans.
[0096] In particular embodiments, the pharmaceutical composition is used in the form of a systemically administered medicament. This includes parenterals, which comprise among others injectables and infusions. Injectables are formulated either in the form of ampoules or as so called ready-for-use injectables, e.g. ready-to-use syringes or single-use syringes and aside from this in puncturable flasks for multiple withdrawal. The administration of injectables can be in the form of subcutaneous (s.c.), intramuscular (i.m.), intravenous (i.v.) or intracutaneous (i.c.) application. In particular, it is possible to produce the respectively suitable injection formulations as a suspension of crystals, solutions, nanoparticular or a colloid dispersed systems like, e.g. hydrosols.
[0097] Injectable formulations can further be produced as concentrates, which can be dissolved or dispersed with aqueous isotonic diluents. The infusion can also be prepared in form of isotonic solutions, fatty emulsions, liposomal formulations and micro-emulsions. Similar to injectables, infusion formulations can also be prepared in the form of concentrates for dilution. Injectable formulations can also be applied in the form of permanent infusions both in in-patient and ambulant therapy, e.g. by way of mini-pumps.
[0098] It is possible to add to parenteral drug formulations, for example, albumin, plasma, expander, surface-active substances, organic diluents, pH-influencing substances, complexing substances or polymeric substances, in particular as substances to influence the adsorption of the target-binding moiety toxin conjugates of the invention to proteins or polymers or they can also be added with the aim to reduce the adsorption of the target-binding moiety toxin conjugates of the invention to materials like injection instruments or packaging-materials, for example, plastic or glass.
[0099] The amatoxins of the present invention comprising a target-binding moiety can be bound to microcarriers or nanoparticles in parenterals like, for example, to finely dispersed particles based on poly(meth)acrylates, polylactates, polyglycolates, polyamino acids or polyether urethanes. Parenteral formulations can also be modified as depot preparations, e.g. based on the multiple unit principle, if the target-binding moiety toxin conjugates of the invention are introduced in finely dispersed, dispersed and suspended form, respectively, or as a suspension of crystals in the medicament or based on the single unit principle if the target-binding moiety toxin conjugate of the invention is enclosed in a formulation, e.g. in a tablet or a rod which is subsequently implanted. These implants or depot medicaments in single unit and multiple unit formulations often consist of so called biodegradable polymers like e.g. polyesters of lactic acid and glycolic acid, polyether urethanes, polyamino acids, poly(meth)acrylates or polysaccharides.
[0100] Adjuvants and carriers added during the production of the pharmaceutical compositions of the present invention formulated as parenterals are particularly aqua sterilisata (sterilized water), pH value influencing substances like, e.g. organic or inorganic acids or bases as well as salts thereof, buffering substances for adjusting pH values, substances for isotonization like e.g. sodium chloride, sodium hydrogen carbonate, glucose and fructose, tensides and surfactants, respectively, and emulsifiers like, e.g. partial esters of fatty acids of polyoxyethylene sorbitans (for example, Tween) or, e.g. fatty acid esters of polyoxyethylenes (for example, Cremophor), fatty oils like, e.g. peanut oil, soybean oil or castor oil, synthetic esters of fatty acids like, e.g. ethyl oleate, isopropyl myristate and neutral oil (for example, Miglyol) as well as polymeric adjuvants like, e.g. gelatine, dextran, polyvinylpyrrolidone, additives which increase the solubility of organic solvents like, e.g. propylene glycol, ethanol, N,N-dimethylacetamide, propylene glycol or complex forming substances like, e.g. citrate and urea, preservatives like, e.g. benzoic acid hydroxypropyl ester and methyl ester, benzyl alcohol, antioxidants like e.g. sodium sulfite and stabilizers like e.g. EDTA.
[0101] When formulating the pharmaceutical compositions of the present invention as suspensions in a preferred embodiment thickening agents to prevent the setting of the target-binding moiety toxin conjugates of the invention or, tensides and polyelectrolytes to assure the resuspendability of sediments and/or complex forming agents like, for example, EDTA are added. It is also possible to achieve complexes of the active ingredient with various polymers. Examples of such polymers are polyethylene glycol, polystyrene, carboxymethyl cellulose, Pluronics or polyethylene glycol sorbit fatty acid ester. The target-binding moiety toxin conjugates of the invention can also be incorporated in liquid formulations in the form of inclusion compounds e.g. with cyclodextrins. In particular embodiments dispersing agents can be added as further adjuvants. For the production of lyophilisates scaffolding agents like mannite, dextran, saccharose, human albumin, lactose, PVP or varieties of gelatine can be used.
EXAMPLES
[0102] In the following, the invention is explained in more detail by non-limiting examples:
Example 1
Synthesis of Amatoxin-Linker HDP 30.2115
[0103] Linkage of antibody to toxin can occur either to cysteine or lysine residues, a specific tag or non-natural amino acids of the antibody. In order to obtain homogenous ADC products with specific DAR of 2, site-specific conjugation to cysteine in combination with genetic engineered Thiomabs is preferred. Key attributes of the linker include the requirement to be stable in plasma in order to prevent the uncontrolled release of the toxic payload into the circulation, and on the other hand the toxin needs to be released within the cell after internalization of the ADC upon target binding. Release of the toxin inside the target cell can occur either via cleavable or non-cleavable linkers. Cleavable linkers can be cleaved from the payload via a variety of mechanism including acidic degradation as consequence of lower pH inside the cell compared to circulation and protease cleavage by the protease cathepsin B or thiol-disulfide exchange attributed to the more reductive intracellular environment. Non-cleavable linkers require complete lysosomal proteolytic degradation generating a payload with a charged lysine or cysteine residue from the antibody.
[0104] The main advantage of non-cleavable compared to cleavable linkers is their increased plasma stability. While it is apparent that activities of ADCs containing non-cleavable linkers are less predictable, cleavable linkers raise the concerns of non-specific cytotoxicity.
[0105] However, in previous experiments, particularly in vitro experiments, with numerous different linkers, ADCs containing non-cleavable linkers have been shown to be less toxic than ADCs with a cleavable linker, and the majority of amanitin-based ADCs based on cleavable linkers were more effective compared to non-cleavable linker constructs. Thus, a cathepsin B-cleavable linker has been chosen for the drug substance.
[0106] The -amanineamide-linker-toxin HDP 30.2115 is synthesized by a multistep approach using solid phase peptide synthesis whereas the bicyclic octapeptide is initially assembled in a linear fashion. Starting point is a hydroxyproline resin immobilisation, followed by C-terminal coupling of dihydroxyisoleucin (HDP 30.0477). The remaining six amino acids are coupled by Fmoc strategy. The first cyclisation (right hand ring) occurs upon acidic cleavage from resin following the Savige-Fontana mechanism. To make this happen, Tryptophan is incorporated in its oxidized form, HPI (HDP 30.0079), as final amino acid. The second ring is formed by macrolactamisation using moderate to high dilution. The linker compound (HDP 30.2109) is synthesized in six linear steps and is finally introduced under standard coupling conditions, after deprotection.
1. Synthesis of Synthetic Dideoxy Precursor Molecule K
[0107] The synthesis of the dideoxy precursor molecule K is described in WO 2014/009025 in Example 5.5.
##STR00003##
[0108] Compound K may be deprotected by treatment with 7 N methanolic NH.sub.3 solution (3.0 ml) and stirring overnight.
2. Synthesis of Synthetic Dideoxy Precursor HDP 30.2105
[0109] An alternative dideoxy precursor molecules comprising a COOH group instead of the carboxamide group at amino acid 1 can be synthesized (HDP 30.1895) and deprotected to result in HDP 30.2105.
##STR00004##
Step 1: 4-Hydroxy-pyrrolidine-1,2-dicarboxylic acid 2-allyl ester 1-(9H-fluoren-9-ylmethyl) ester (HDP 30.0013)
[0110] ##STR00005##
[0111] FmocHypOH (10.0 g, 28.3 mmol) was suspended in 100 ml 80% MeOH and Cs2CO3 (4.6 g, 14.1 mmol) was added. The suspension was stirred at 50 C. for 30 minutes until complete dissolution. The reaction mixture was concentrated to dryness and resolved in 100 ml DMF. Allylbromide (1.6 ml, 3.6 g, 29.7 mmol) was added dropwise and the reaction was stirred over night at RT. DMF was distilled off and the residue dissolved in tert-butylmethyl ether. Precipitates were filtered and the clear solution was absorbed on Celite prior column chromatography. The compound was purified on 220 g Silicagel with an n-hexane/ethyl acetate gradient.
[0112] Yield: 11.5 g, 100%
Step 2: Resin Loading (HDP 30.0400)
[0113] ##STR00006##
[0114] HDP 30.0013 (5.0 g, 14.1 mmol), pyridinium 4-toluenesulfonate (1.33 g, 5.3 mmol) were added to a suspension of 1,3-dihydro-2H-pyran-2-yl-methoxymethyl resin (5.0 g, 1.0 mmol/g THP-resin) in 40 ml dichloroethane. The reaction was stirred at 80 C. overnight. After cooling the resin was filtered and extensively washed with dichloroethane, dimethylformamide, acetonitrile, dichloromethane and tert-butylmethylether.
[0115] Loading was 0.62 mmol/g (determined by UV-spectroscopy of the fluorene methyl group after deprotection).
Step 3: Solid Phase Precursor Synthesis (HDP 30.1894)
[0116] ##STR00007##
Resin Pre-Treatment:
[0117] HDP 30.0400 (0.5 g, 0.31 mmol) was treated with N,N-dimethylbarbituric acid (483 mg, 3.1 mmol) and Pd(PPh3)4 (69 mg, 0.06 mmol). The resin was shaken over night at RT. Thereafter the resin was extensively washed with dichloromethane, N-methyl-2-pyrrolidone, acetonitrile, dichloromethane and tert-butylmethyl ether and dried under reduced pressure.
Coupling Procedure:
[0118] All reactants and reagents were dissolved in dichloromethane/N-methyl-2-pyrrolidone containing 1% Triton-X100 (Solvent A).
[0119] HDP 30.0477 (257 mg, 0.38 mmol) was dissolved in 3.0 ml Solvent A and treated with 3.0 ml of a 0.2 N solution PyBOP (333 mg, 0.63 mmol, 2.0 eq), 3.0 ml of a 0.2 N solution HOBt (130 mg, 0.63 mmol, 2.0 eq) and 439 pl DIEA (4.0 eq). The reaction was heated to 50 C. for 8 minutes by microwave irradiation (20 W, CEM microwave reactor) and was washed with N-methyl-2-pyrrolidone after coupling.
Deprotection:
[0120] Deprotection was performed by addition of 6.0 ml 20% piperidine in N-methyl-2-pyrrolidone at 50 C. for 8 minutes. The resin was washed with N-methyl-2-pyrrolidone (Note: No deprotection after coupling of the final amino acid).
[0121] All other amino acids were coupled following the above protocol, weightings are shown below: [0122] 0.63 mmol, 498 mg Fmoc Asp(OAll)OH [0123] 0.63 mmol, 738 mg Fmoc Cys(Tri)OH [0124] 0.63 mmol, 375 mg Fmoc GlyOH [0125] 0.63 mmol, 445 mg FmocIleOH [0126] 0.63 mmol, 375 mg Fmoc GlyOH [0127] 0.38 mmol, 242 mg N-Boc-HPIOH (HDP 30.0079)
[0128] 4,5-Diacetoxy-2-amino-3-methyl-pentanoic acid tert-butyl ester; hydrochloride (HDP 30.0477) was synthesized as described in WO 2014/009025.
[0129] N-Boc-HPIOH (HDP 30.0079) was prepared according to Zanotti, Giancarlo; Birr Christian; Wieland Theodor; International Journal of Peptide & Protein Research 18 (1981) 162-8.
Step 4: HDP 30.1895
[0130] ##STR00008##
Elimination from Resin and B-Ring Formation
[0131] The resin was shaken with 10 ml trifluoroacetic acid/dichloromethane 50:50 (v/v) plus 10% methanol for 30 min and finally eluted into a 50 ml flask. The resin was washed twice with methanol (10 ml each). The combined eluates were concentrated in vacuum and re-suspended in 2-4 ml methanol. The methanolic solution was dropped twice into 50 ml cold diethyl ether for peptide precipitation. After centrifugation the precipitate was washed with diethyl ether (2 times) and dried under reduced pressure. The white precipitate was solubilized in approx. 4-5 ml methanol (0.5 ml per 100 mg) and purified by preparative reverse phase column chromatography. Approximately 100 mg crude precipitate were purified per run. Fractions were analyzed by mass spectrometry, combined and methanol distilled off under reduced pressure. The aqueous phase was freeze dried.
[0132] Yield: 24.4 mg, 23.7 pmol
[0133] Mass spectrometry: [M+H].sup.+, 1030.5
A-Ring Formation
[0134] The above freeze dried intermediate was dissolved in 25 ml dimethylformamide and treated with diphenylphosphorylazide (63 l, 1185 mol, 5 eq) and diisopropylethyl amine (201 l, 1185 pmol, 5 eq). The reaction was stirred overnight (20 hours). Conversion was monitored by reverse phase chromatography and finally quenched with 100 l water. The mixture was concentrated by reduced pressure and re-dissolved in 1-2 ml methanol. Precipitation of the product was performed by dropwise addition to 20 ml diethyl ether. The precipitate was washed twice with diethyl ether and dried under reduced pressure. The next step was performed without further purification.
[0135] Mass spectrometry: [M+Na].sup.+, 1034.6
Ester Deprotection:
[0136] To the crude cyclisation product 2.5 ml dichloromethane, diethylbarbituric acid (22.3 mg, 118.5 mol) and Pd(PPh.sub.3).sub.4 (27 mg, 23.7 mol) were added. The reaction was stirred at RT overnight. The reaction can be monitored by RP-HPLC. After complete conversion, the mixture was added dropwise to 20 ml cooled diethyl ether and the precipitate washed twice with diethyl ether. After drying at reduced pressure the precipitate was dissolved in methanol (1.0 ml) and purified by preparative reversed phase chromatography.
[0137] Yield: 15.0 mg
[0138] Mass spectrometry: [M+H].sup.+, 972,3; [M+Na].sup.+, 994.5
Step 5: HDP 30.2105
[0139] ##STR00009##
[0140] HDP 30.1895 (15.0 mg, 15.3 pmol) was dissolved in 7 N methanolic NH.sub.3 solution (3.0 ml) and stirred overnight. Conversion was checked by mass spectrometry. After complete conversion the reaction was concentrated in vacuum, suspended in 80% tert-butanol and lyophilized. Product was purified by preparative HPLC.
[0141] Yield: 12.1 mg
[0142] Mass spectrometry: [M+H].sup.+, 888,0; [M+Na].sup.+, 910.2
3. Synthesis of Synthetic Dideoxy Precursor HDP 30.2115
[0143] ##STR00010##
[0144] A dideoxy precursor molecule comprising a thiol reactive group with cleavable linker can be synthesized from example 2 product in 7 steps as follows:
Step 1: Fmoc-Val-OSu (HDP 30.1343)
[0145] ##STR00011##
[0146] This compound is prepared according to R. A. Firestone et al, U.S. Pat. No. 6,214,345. Fmoc-Val-OH (20.24 g; 59.64 mmol) and N-hydroxysuccinimide (6.86 g=1.0 eq.) in tetrahydrofuran (200 ml) at 0 C. were treated with N,N-dicyclohexylcarbodiimide (12.30 g; 1.0 eq.). The mixture was stirred at RT under argon atmosphere for 6 h and then the solid dicyclohexyl urea (DCU) by-product was filtered off and washed with THF and the solvent was removed by rotavap. The residue was dissolved in 300 ml dichloromethane, cooled in an ice bath for 1 h and filtered again to remove additional DCU. The dichloromethane was evaporated and the solid foam (26.51 g) was used in the next step without further purification.
Step 2: Fmoc-Val-Ala-OH (HDP 30.1414)
[0147] ##STR00012##
[0148] Step 2 product is prepared in analogy to P. W. Howard et al. US 2011/0256157. A solution of L-alanine (5.58 g; 1.05 eq.) and sodium hydrogen carbonate (5.51 g; 1.1 eq.) in 150 ml water was prepared and added to a solution of HDP 30.1343 (26.51 g; max. 59.6 mmol) in 225 ml tetrahydrofuran. The mixture was stirred for 50 h at RT. After consumption of starting material the solution was partitioned between 240 ml of 0.2 M citric acid and 200 ml of ethyl acetate. The aqueous layer was separated and extracted with ethyl acetate (3200 ml). The combined organic layers were washed with water and brine (300 ml each) dried (MgSO.sub.4) and the solvent was evaporated to approx. 200 ml. Pure product precipitated at this time and was filtered off. The mother liquor was evaporated to dryness and the residue was stirred 1 h with 100 ml MTBE to result additional crystalline material. The two crops of product were combined to 18.01 g (74%) white powder. (m.p.: 203-207 C.)
TABLE-US-00001 MS [M + Na].sup.+ found: 410.94; calc.: 411.19 (C.sub.23H.sub.27N.sub.2O.sub.5) (ESI+) [M + Na].sup.+ found: 433.14; calc.: 433.17 (C.sub.23H.sub.27N.sub.2O.sub.5) [2M + H].sup.+ found: 842.70; calc.: 843.36 (C.sub.46H.sub.52N.sub.4NaO.sub.10)
Step 3: Fmoc-Val-Ala-PAB-NHBoc (HDP 30.1713)
[0149] ##STR00013##
[0150] Step 2 product HDP 30.1414 (1.76 g; 4.28 mmol) and 4-[(N-Boc)aminomethyl]aniline (1.00 g; 1.05 eq.) were dissolved in 26 ml abs. tetrahydrofuran. 2-Ethoxy-N-(ethoxycarbonyl)-1,2-dihydroquinoline (EEDQ 1.11 g; 1.05 eq.) was added and the mixture was stirred at RT, protected from light. With ongoing reaction a gelatinous matter is formed from the initially clear solution. After 40 h the reaction mixture was diluted with 25 ml of tert-butylmethyl ether (MTBE) and stirred for 1 h. Subsequently the precipitation is filtered off with suction, washed with MTBE and dried in vacuo to 2.30 g (85% yield) of a white solid.
[0151] .sup.1H NMR (500 MHz, DMSO-d6) 9.87 (s, 1H), 8.11 (d, J=7.1 Hz, 1H), 7.88 (d, J=7.5 Hz, 2H), 7.74 (q, J=8.4, 7.9 Hz, 2H), 7.51 (d, J=8.2 Hz, 2H), 7.45-7.23 (m, 7H), 7.17 (d, J=8.3 Hz, 2H), 4.44 (p, J=7.0 Hz, 1H), 4.36-4.17 (m, 3H), 3.96-3.89 (m, 1H), 2.01 (hept, J=6.9 Hz, 1H), 1.39 (s, 9H), 1.31 (d, J=7.1 Hz, 3H), 0.90 (d, J=6.8 Hz, 3H), 0.87 (d, J=6.8 Hz, 3H).
[0152] .sup.13C NMR (126 MHz, DMSO-d6) 170.84, 170.76, 156.04, 155.63, 143.77, 143.69, 140.60, 137.41, 134.99, 127.50, 127.26, 126.93, 125.22, 119.95, 118.97, 77.60, 65.62, 59.95, 48.86, 46.62, 42.93, 30.28, 28.16, 19.06, 18.10, 18.03.
Step 4: H-Val-Ala-PAB-NHBoc (HDP 30.1747)
[0153] ##STR00014##
[0154] Step 3 compound HDP 30.1713 (1.230 g, 2.00 mmol) was placed in a 100 ml flask and dissolved in 40 ml dimethylformamide (DMF). Diethyl amine (7.5 ml) was added and the mixture was stirred at RT. The reaction was monitored by TLC (chloroform/methanol/HOAc 90:8:2). After consumption of starting material (30 min) the volatiles were evaporated and the residue was co-evaporated with 40 ml fresh DMF to remove traces of diethyl amine. The crude product was used without further purification for the next step.
TABLE-US-00002 MS [MH].sup.+ found: 393.26; calc.: 393.25 (C.sub.20H.sub.33N.sub.4O.sub.4) (ESI+) [M + Na].sup.+ found: 415.35; calc.: 415.23 (C.sub.20H.sub.32N.sub.4NaO.sub.4) [2M + H].sup.+ found: 785.37; calc.: 785.49 (C.sub.40H.sub.65N.sub.8O.sub.8)
Step 5: BMP-Val-Ala-PAB-NHBoc (HDP 30.2108)
[0155] ##STR00015##
[0156] Crude step 4 product HDP 30.1747 (max 2.00 mmol) was dissolved in 40 ml DMF, 3-(maleimido)propionic acid N-hydroxysuccinimide ester (BMPS 532 mg; 1.0 eq.) and N-ethyldiisopropylamine (510 l, 1.5 eq.) were added and the mixture was stirred 3 h at RT After consumption of starting material HDP 30.1747 (TLC: chloroform/methanol/HOAc 90:8:2) the volatiles were evaporated and the residue is stirred with 50 ml MTBE until a fine suspension was formed (1 h). The precipitate was filtered off with suction, washed with MTBE and dried. The crude product (1.10 g) was dissolved in 20 ml dichloromethane/methanol 1:1, kieselgur (15 g) was added and the solvents were stripped off. The solid material was placed on top of an 80 g silica gel column and eluted with a linear gradient of 0-10% methanol in dichloromethane. Product fractions were combined and evaporated to 793 mg (73% over two steps) amorphous solid.
TABLE-US-00003 MS [M + Na].sup.+ found: 566.24; calc.: 566.26 (C.sub.27H.sub.37NaO.sub.7) (ESI.sup.+)
[0157] .sup.1H NMR (500 MHz, DMSO-d.sub.6) 9.75 (s, 1H), 8.09 (d, J=7.1 Hz, 1H), 7.98 (d, J=8.4 Hz, 1H), 7.52 (d, J=8.6 Hz, 2H), 7.29-7.23 (m, 1H), 7.16 (d, J=8.5 Hz, 2H), 6.98 (s, 2H), 4.39 (p, J=7.1 Hz, 1H), 4.13 (dd, J=8.4, 6.7 Hz, 1H), 4.06 (d, J=6.1 Hz, 2H), 3.67-3.56 (m, 2H), 2.49-2.41 (m, 2H), 1.96 (h, J=6.8 Hz, 1H), 1.39 (s, 9H), 1.30 (d, J=7.1 Hz, 3H), 0.86 (d, J=6.8 Hz, 3H), 0.82 (d, J=6.8 Hz, 3H). .sup.13C NMR (126 MHz, DMSO-d.sub.6) 170.80, 170.63, 170.60, 169.72, 155.65, 137.45, 134.94, 134.44, 127.26, 118.95, 77.62, 57.71, 48.92, 42.95, 33.96, 33.64, 30.17, 28.17, 19.02, 18.06, 17.82.
Step 6: BMP-Val-Ala-PAB-NH.SUB.2 .(HDP 30.2109)
[0158] ##STR00016##
[0159] Step 5 product HDP 30.2108 (400 mg, 736 pmol) was dissolved in 4,000 l trifluoroacetic acid and stirred for 2 min. Subsequently the volatiles were evaporated at RT and the remainders were co-evaporated twice with 4,000 l toluene. The residue was dissolved in 5,000 l 1,4-dioxane/water 4:1, solidified in liquid nitrogen and freeze-dried: 410 mg (quant.) colorless powder.
TABLE-US-00004 MS [M + Na].sup.+ found: 415.35; calc.: 466.21 (C.sub.22H.sub.29NaO.sub.5) (ESI+) [2M + H].sup.+ found: 887.13; calc.: 887.44 (C.sub.44H.sub.59N.sub.10O.sub.10)
[0160] .sup.1H NMR (500 MHz, DMSO-d.sub.6) 9.89 (s, 1H), 8.13 (d, J=6.9 Hz, 1H), 7.99 (d, J=8.2 Hz, 1H), 7.66-7.60 (m, 2H), 7.41-7.34 (m, 2H), 6.98 (s, 2H), 4.39 (p, J=7.1 Hz, 1H), 4.11 (dd, J=8.2, 6.6 Hz, 1H), 3.97 (q, J=5.6 Hz, 2H), 3.69-3.58 (m, 2H), 2.49-2.40 (m, 2H), 1.96 (h, J=6.8 Hz, 1H), 1.32 (d, J=7.1 Hz, 3H), 0.86 (d, J=6.8 Hz, 3H), 0.83 (d, J=6.7 Hz, 3H).
[0161] .sup.13C NMR (126 MHz, DMSO-d.sub.6) 171.24, 170.78, 170.72, 169.85, 158.12 (q, J=33.2 Hz, TFA), 158.25, 157.99, 157.73, 139.19, 134.53, 129.45, 128.52, 119.02, 116.57 (q, J=296.7 Hz, TFA), 57.78, 49.08, 41.90, 34.00, 33.68, 30.21, 19.07, 18.16, 17.76.
Step 6: HDP 30.2115
[0162] ##STR00017##
[0163] HDP 30.2105 (15.0 mg, 16.5 mol) were treated with 429 l of a 0.1 M solution of HDP 30.2109 (25.2 mol, 1.5 eq), 492 l of 0.1 M TBTU (25.2 mol, 1.5 eq) and 492 l of 0.2 M DIEA (49.1 mol, 3.0 eq) at RT. The reaction was monitored by RP-HPLC. After completion the reaction was quenched with 100 l H.sub.2O stirred for 15 minutes and injected onto a preparative RP-HPLC.
[0164] Yield: 12.2 mg, 56%
[0165] Mass spectrometry: 1313.2 [M+H].sup.+, 1335.5 [M+Na].sup.+
Example 2
Properties of Constructs Based on HDP 30.2105
[0166] Various experiments were performed to compare the properties of constructs based on di-deoxy amanitin derivative HDP 30.2105 with those of other amanitin variants. The results of these experiments are shown in
Example 3
Generation and Expression of Thiomab Antibody J22.9-ISY-D265C
[0167] Conjugation of the antibody with linker and toxin can occur to lysine or cysteine residues, resulting in highly variable drug-antibody ratio (DAR). Since potency and toxicity is strongly influenced by DAR, homogeneity and comparability of the ADC with predictable DAR is favourable. Antibodies with engineered reactive cysteine residues (thiomabs) allow for site-specific conjugation and therefore, amino acid aspartic acid at position 265 has been exchanged to cysteine (D265C). Thus, the resulting antibody variant contains two introduced cysteines at each chain of the Fc region, which serves as coupling site for the toxin-linker compound and allows production of ADCs with DAR=2.
[0168] Sequence modifications in the Fc-region of the antibody can have dramatic influence in linking antibody-mediated immune responses with cellular effector functions, since residues in the Fc-region are responsible for interaction with IgG Fc receptor (FcR). Interactions of IgG with the FcR play crucial role in cellular effector functions including release of inflammatory mediators, endocytosis of immune complexes, antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). Preserving these effector functions in an ADC might contribute to the anti-tumor activity of the ADC. However, this assumption might prove to be incorrect as these effector functions are generally weak and, importantly, might compete with ADC internalization, reduce or abolish their specific toxin-related activity and increase off-target toxicity due to ADC uptake in antigen-negative cells via Fc-receptor. Several ADCs currently in pre-clinical and clinical development are based on IgG2 and IgG4 which are very inefficient in these effector functions (Trail, 2013; Peters and Brown, 2015).
[0169] Detailed mapping of binding sites on human IgG1 to FcRI, FcRII, FcRIII and to neonatal Fc receptor (FcRn) revealed a crucial role of aspartic acid at position 265. Replacement of aspartic acid in IgG2 and IgG1 completely abolished interaction with FcR (Baudino et al., 2008; Shields et al., 2001).
[0170] The efficiency of antibody-induced effector functions in Trastuzumab (Trademark Herceptin) and corresponding thiomab antibodies with amino acid exchanges at position 265 (D265C) or 118 (T118C) for control were tested on a macrophage cell line THP-1. This monocytic cell line expresses multiple FcRs and allows for testing antibody-mediated phagocytosis (Ackerman et al. 2011). Cytotoxicity on THP-1 cells was reduced by at least two orders of magnitude with thiomab D265C compared to thiomab A118C, containing a cysteine mutation at position A118 not reducing the effector function, and non-engineered antibody. This effect of reduced cytotoxicity with thiomab engineered at amino acid 265 is not due to conjugation of the toxin to the engineered cysteine, since, in contrast to T-D265C-30.1699 containing a cleavable linker conjugated to the engineered cysteine, in the case of T-D265C-30.0643 a stable linker is conjugated to lysine residues of the antibody. Thus, antibody-dependent effector functions were surprisingly highly reduced due to D265C exchange in thiomabs (see Table 1).
TABLE-US-00005 TABLE 1 EC.sub.50 [M] Compound on THP-1 T-D265C-30.0643 (stable linker; lysine coupling) 1.9 10.sup.8 T-D265C-30.0880 (stable linker; cysteine coupling) 4.0 10.sup.8 T-D265C-30.1699 (cleavable linker; cysteine coupling) 2.0 10.sup.8 T-A118C-30.0643 (stable linker; lysine coupling) 2.8 10.sup.10 T-A118C-30.0880 (stable linker; cysteine coupling) 7.0 10.sup.10 T-A118C-30.1699 (cleavable linker; cysteine coupling) 4.4 10.sup.10 Her-30.0880 (wild-type) 4.6 10.sup.10 Her-30.0643 (wild-type) 1.2 10.sup.10
[0171] Results from characterization of the chimeric and sequence-optimized variants of J22.9 revealed improved binding properties of the sequence optimized variants J22.9-ISY and J22.9-FSY to BCMA compared to J22.9-H, with no obvious difference for ISY- or FSY-variant. Since use of plasmids expressing J22.9-ISY antibody variant resulted in improved titers when transiently expressed in cell culture, variant J22.9-ISY was chosen for conjugation and further evaluation.
[0172] The nucleic acid coding sequence for the heavy chain of monoclonal antibody J22.9-ISY-D265C was obtained from the heavy chain sequence of humanized antibody J22.9-ISY (see WO 2014/068079 and WO 2015/166073) as described in WO 2016/142049. In addition to the exchange D265C, J22.9-ISY-D265C additionally contains a mutation R214K (see SEQ ID NO: 1).
[0173] In order to produce amanitin-conjugate J22.9-ISY-D265C-30.2115, antibody J22.9-ISY-D265C was transiently expressed in Expi293F cells co-transfected with plasmids for the heavy and light chain. In an additional approach, antibody J22.9-ISY-D265C was produced in CHO cells stably transfected with plasmids expressing heavy and light chain. The antibody was purified from the cell culture supernatant using protein A chromatography followed by gel filtration. Antibody produced transiently from Expi293F.sup.TM or from stable CHO cells are comparable conjugation to payload, in binding to BCMA and cytotoxicity on BCMA-expressing cells.
[0174] In order to test if amino acid exchange in Thiomab J22.9-ISY-D265C did not interfere with binding to BCMA, binding of J22.9-ISY and J22.9-ISY-D265C to BCMA-expressing cells was compared. The binding property of the engineered thiomab J22.9-ISY-D265C to BCMA-positive NCI-H929 and MM.1S-Luc cells was identical to J22.9-ISY antibody (see
Example 4
Synthesis of Conjugate J22.9-ISY-D265C-30.2115
[0175] Conjugation of HDP 30.2115 to 10 mg J22.9-ISY-D265C
[0176] 10 mg Thiomab J22.9-ISY-D265C in PBS buffer will be used for conjugation to HDP 30.2115.
[0177] Adjust antibody solution to 1 mM EDTA:
[0178] 2 ml antibody solution (10.0 mg)+20 l 100 mM EDTA, pH 8.0
[0179] Amount antibody: 10 mg=6.810.sup.8 mol
[0180] Uncapping of cysteines by reaction of antibody with 40 eq. TCEP: [0181] 2 ml antibody solution (6.810.sup.8 mol)+54.5 l 50 mM TCEP solution (2.7210.sup.6 mol) [0182] Incubate for 3 h at 37 C. on a shaker. [0183] Two consecutive dialyses at 4 C. in 2.0 11PBS, 1 mM EDTA, pH 7.4 in a Slide-A-Lyzer Dialysis Cassette 20000 MWCO, first dialysis ca. 4 h, second dialysis overnight [0184] Concentrate to ca. 4.0 ml using Amicon Ultra Centrifugal Filters 50000 MWCO.
[0185] Oxidation by reaction of antibody with 20 eq. dehydroascorbic acid (dhAA): [0186] ca. 2 ml antibody solution (6.810.sup.8 mol)+27.2 l fresh 50 mM dhAA solution (1.3610.sup.6 mol) [0187] Incubate for 3 h at RT on a shaker.
[0188] Conjugation with amanitin using 4 eq. HDP 30.2115 and quenching with 25 eq. N-acetyl-L-cysteine:
[0189] Solubilize 0.7 mg HDP 30.2115 in 70 l DMSO=10 g/l [0190] ca. 2 ml antibody solution (=9.5 mg; 6.5410.sup.8 mol)+34.4 l HDP 30.2115 (=344 g; 2.6210.sup.7 mol). [0191] Incubate 1 h at RT. [0192] Quench by addition of 16.4 l 100 mM N-acetyl-L-cysteine (1.6410.sup.6 mol). [0193] Incubate 15 min at RT (or overnight at 4 C.). [0194] Purify reaction mix with 1 PD-10 columns equilibrated with 1 PBS, pH 7.4. Identify protein-containing fractions with Bradford reagent on parafilm and bring protein-containing fractions together. [0195] Dialysis of antibody solution at 4 C. overnight in 2.0 I PBS, pH 7.4 and Slide-A-Lyzer Dialysis Cassettes 20000 MWCO.
[0196] Determination of protein concentration by UV-spectra (absorption at 280 nm).
[0197] Determination of DAR by LC-ESI-MS-analysis.
[0198] Adjust protein concentration to 5.0 mg/ml (3.410-5 M) and bring to sterile conditions by filtration. Store at 4 C.
Example 5
Characterization of Drug Substance J22.9-ISY-D265C-30.2115
[0199] 1. Production and Release Testing
[0200] In order to characterize an ADC variant based on HDP 30.2115, it was compared to a variant based on HDP 30.1699 (see Table 1).
##STR00018##
[0201] HDP 30.1699 contains amanitin from natural source in contrast to fully synthetic amanitin derivative HDP 30.2115. Due to the chemical synthesis, there are the following differences between the two compounds: HDP 30.2115 contains a thioether bridge and a core tryptophan moiety, whereas HDP 30.1699 contains a sulfoxide bridge and a 6-hydroxytryptophan moiety. The absence of 6-hydroxytryptophan in HDP 30.2115 requires linkage of the antibody to the aspartic acid in contrast to HDP 30.1699 were 6-hydroxytryptophan is used for the linkage. In both compounds a cathepsin B cleavable linker was used.
[0202] Antibody J22.9-ISY-D265C was conjugated to compounds HDP 30.1699 and HDP 30.2115 using maleimido-chemistry as described above and tested for aggregates, DAR and product quality in analytical SEC-HPLC, Mass spectrometry, SDS-Page and Western Blot.
[0203] Test results from B16-0040 and B16-0049 are presented exemplarily in
[0204] Stability of J22.9-ISY-D265C-30.2115 and J22.9-ISY-D265C-30.1699 was tested following incubation at 37 C. for 0, 4, and 10 days in PBS, human, cynomolgus or mouse plasma. In contrast to J22.9-ISY-D265C-30.1699, Western Blot analyses surprisingly revealed a particularly high stability throughout the time course of the experiment for J22.9-ISY-D265C-30.2115 in PBS or plasma (see
[0205] Plasma stability of both ADC variants was confirmed in a cell-based cytotoxicity assay on BCMA-positive NCI-H929 cells (see Table 2) after incubation for 0, 4 and 10 days in PBS, human, cynomolgus or mouse plasma. Incubation in PBS or plasma over up to 10 days has almost no influence on the cytotoxic potential of J22.9-ISY-D265C-30.2115. In contrast, the cytotoxicity and thus the stability of J22.9-ISY-D265C-30.1699 was clearly reduced after incubation in human, cynomolgus or mouse plasma, as already observed in Western Blot analyses (see
TABLE-US-00006 TABLE 2 human cynomolgus mouse PBS EC.sub.50 plasma plasma plasma pH 7.4 J22.9-ISY- day 0 2.8 10.sup.10 2.5 10.sup.10 1.2 10.sup.10 2.4 10.sup.10 D265C- day 4 2.7 10.sup.10 2.5 10.sup.10 1.8 10.sup.10 2.4 10.sup.10 30.2115 day 10 1.0 10.sup.9 2.9 10.sup.10 6.0 10.sup.10 4.1 10.sup.10 J22.9-ISY- day 0 1.8 10.sup.10 2.0 10.sup.10 8.6 10.sup.11 1.6 10.sup.10 D265C- day 4 3.7 10.sup.7 2.1 10.sup.9 2.0 10.sup.9 3.6 10.sup.10 30.1699 day 10 6.0 10.sup.10
[0206] Cytotoxicity potentials of both ADCs were tested on five BCMA-positive MM cell lines (NCI-H929, MM.1S Luc, MM.1S, U266B1, and OPM-2) and one BCMA-negative control cell line (CCRF-CEM). Both ADCs show high cytotoxic activity in the picomolar range with slightly superior toxicity of J22.9-ISY-D265C-30.1699 on some cell lines. Cytotoxicity of J22.9-ADCs is strongly dependent on BCMA-expression levels on cell surface with no toxicity observed in non-BCMA expressing control cells. In addition, with both amanitin-ADCs low EC.sub.50 values on OPM-2 cells correlate with poor BCMA-expression (see Table 3/
TABLE-US-00007 TABLE 2 CD269 CD138 protein protein J22.9-ISY (Western (Western binding Cell line blot) blot) (FACS) MM.1S Multiple myeloma cell (B ++ +++ ++ lymphoblast) established from the bone marrow of a 55-year- old man with plasma cell leukemia at relapse after chemotherapy MM.1S MM.1S cells expressing ++ +++ ++ Luc luciferase NCI- Multiple myeloma cell (B +++ ++ +++ H929 lymphoblast) cell established from a 62-year-old white woman with myeloma at relapse U266B1 Multiple myeloma cell (B ++ +++ + lymphoblast) cell derived from peripheral blood of a 53-year- old patient with an IgE myeloma OPM-2 Multiple myeloma cell (B + +++ + lymphoblast) cell established from the peripheral blood of a 56-year-old woman with multiple myeloma (IgG lambda) in leukemic phase (relapse, terminal) KMS-11 Multiple myeloma cell (B + +/ + lymphoblast) cell established from patient with multiple myeloma RPMI- Multiple myeloma cell (B +/ + + 8226 lymphoblast) cell established from the peripheral blood of a 61-year-old man with multiple myeloma CCRF- T lymphoblastoid line CEM established from the peripheral blood of a 3-year-old Caucasian girl with acute lymphoblastic leukemia (ALL) at relapse (control cell line)
TABLE-US-00008 TABLE 4 EC.sub.50 [M]: NCI-H929 MM.1S Luc MM.1S U266B1 OPM-2 J22.9-ISY- 7.0 10.sup.11 6.5 10.sup.11 1.7 10.sup.10 7.3 10.sup.11 7.9 10.sup.9 D265C- 30.1699 J22.9-ISY- 9.7 10.sup.11 2.3 10.sup.10 2.9 10.sup.10 1.4 10.sup.10 1.4 10.sup.7 D265C- 30.2115
Example 6
In-Vivo Pharmacological Activity in Multiple Myeloma Xenograft Model
1. Subcutaneous Xenograft Model
Single Dosing
[0207] Antitumor activity of J22.9-ISY-D265C-30.2115 and J22.9-ISY-D265C-30.1699 was tested in a subcutaneous NCI-H929 (see Table 3 for details of cell line) mouse xenograft model.
[0208] Single treatment with 2 mg/kg doses resulted in initial response followed by regrowth of tumor in 7 of 8 mice for J22.9-ISY-D265C-30.1699 and 6 of 8 mice for J22.9-ISY-D265C-30.2115. At 4 mg/kg doses, complete tumor remission was reached in 8 of 8 mice for J22.9-ISY-D265C-30.1699 and 7 of 8 mice for J22.9-ISY-D265C-30.2115 and mice stayed tumor free for more than 100 days (the time course of the experiment). At doses of 2 mg/kg J22.9-ISY-D265C-30.2115 showed slightly superior anti-tumor efficacy compared to J22.9-ISY-D265C-30.1699. No statistically significant body weight reduction was observed, except for J22.9-ISY-D265C-30.1699 at 4 mg/kg doses (see
Repeated Dosing
[0209] The efficacy of drug substance J22.9-ISY-D265C-30.2115 was further evaluated in a repeated dose setting in the subcutaneous NCI-H929 xenograft model. Compared to the single dose application described above, doses were reduced to 1, 0.5 and 0.25 mg/kg and applied either once per week (1/week), every two weeks (1/2 weeks) or every three weeks (1/3 weeks). Repeatedly applied doses of 1 mg/kg already resulted in tumor regression, and with repeated 2 mg/kg dosing complete tumor remission could be observed (see
2. Intravenous Xenograft Model
Single Dosing
[0210] The antitumor activity of J22.9-ISY-D265C-30.1699 and J22.9-ISY-D265C-30.2115 was further tested in a disseminating intravenous MM.1S Luc xenograft model at doses of 2 and 4 mg/kg. Both compounds showed very effective and comparable antitumor activity with complete tumor remission for more than 100 days (see
[0211] In the disseminating MM.1S Luc xenograft model doses of drug substance J22.9-ISY-D265C-30.2115 were further reduced to single dose application of 1, 0.3 and 0.1 mg/kg. Already single dose application of 0.3 mg/kg resulted in complete tumor eradication (see
Example 7
Non-Human Primate (NHP) Tolerability Study
[0212] J22.9-ISY-D265C-30.2115 and J22.9-ISY-D265C-30.1699 were assessed for a dose-escalating tolerability study in cynomolgus monkeys. Groups of 3 animals were injected with J22.9-ISY-D265C-30.1699 at days 1 (0.3 mg/kg), 22 (1 mg/kg), and 44 (3 mg/kg), or with J22.9-ISY-D265C-30.2115 at days 1 (0.3 mg/kg), 21 (1 mg/kg), and 42, 64, 84,106 (3 mg/kg each time point). Animals were monitored over time for biochemical and haematological blood parameters (see
[0213] Up to 3 mg/kg doses of both compounds were well tolerated with no signs of kidney damage by serum parameters and unaffected body weight and food consumption. Doses of 3 mg/kg resulted in increased but transient levels of liver enzymes (ALT, AST) and the unspecific inflammatory marker LDH. Repeated dosing of 3 mg/kg J22.9-ISY-D265C-30.2115 did not result in further increase of liver enzymes or LDH.
Example 7
Cytotoxic Potential of J22.9-ISY-D265C-30.2115 in Comparison to Monomethyl Auristatin F Derivative
[0214] Cytotoxicity potentials of J22.9-ISY-D265C-30.2115 was compared to the interchain conjugate J22.9-ISY-MMAF on two BCMA-positive MM cell lines (MM.1S Luc, and KMS-11). Both ADCs show high cytotoxic activity in the picomolar range after 96 h with slightly superior toxicity of J22.9-ISY-MMAF (see
Example 8
Efficacy of J22.9-ISY-D265C-30.2115 in a Disseminating Xenograft Model
[0215] The antitumor activity of J22.9-ISY-D265C-30.2115 was compared to the interchain conjugate J22.9-ISY-MMAF in a disseminating intravenous MM.1S Luc xenograft model at doses of 1 and 4 mg/kg. The MMAF conjugate showed a very fast initial response after five days at both doses and a regrowth of the tumor after 20 and 50 days, respectively. J22.9-ISY-D265C-30.2115 in contrast showed a slower initial response after 10 days at both doses, but a longer period until regrowth of the tumor after 50 and 100 days, respectively (see
REFERENCES
[0216] Ackerman M E et al. A robust, high-throughput assay to determine the phagocytic activity of clinical antibody samples. J Immunol Methods. 2011 Mar. 7; 366(1-2): 8-19. [0217] Baudino L et al. Crucial role of aspartic acid at position 265 in the CH2 domain for murine IgG2a and IgG2b Fc-associated effector functions. J Immunol. 2008 Nov. 1; 181(9):6664-9. [0218] Belucci R et al. Graft-versus-tumor response in patients with multiple myeloma is associated with antibody response to BCMA, a plasma-cell membrane receptor. Blood. 2005 May 15; 105(10):3945-5 [0219] Bird J M et al. Guidelines for the diagnosis and management of multiple myeloma 2011. Br J Haematol. 2011 July; 154(1):32-75 [0220] Bossen C, Schneider P. BAFF, APRIL and their receptors: structure, function and signaling. Semin Immunol. 2006 October; 18(5):263-75 [0221] Chesi M, Bergsagel P L. Advances in the pathogenesis of multiple myeloma. Int J Lab Hematol. 2015 May; 37 Suppl 1:108-14 [0222] Davis M B, Preston J F. A Conjugate of a -amanitin and Monoclonal Immunoglobulin G to Thy 1.2 Antigen is Selectively Toxic to T Lymphoma Cells. Science 213 (1981) 1385-1388 [0223] Dimopoulos M A et al. Current treatment landscape for relapsed and/or refractory multiple myeloma. Nat Rev Clin Oncol. 2015 January; 12(1):42-54 [0224] Dimopoulos M A et al. Pathogenesis and treatment of renal failure in multiple myeloma. Leukemia. 2008 August; 22(8):1485-93 [0225] Hayes J M et al. Glycosylation and Fc receptors. Curr Top Microbiol Immunol. 2014; 382:165-99 [0226] Kuehl W M, Bergsagel P L. Molecular pathogenesis of multiple myeloma and its premalignant precursor. J Clin Invest. 2012 October; 122(10):3456-63 [0227] Leukemia. 2009 Jan;23(1):3-9 [0228] Kyle R A, Rajkumar S V. Multiple myeloma. N Engl J Med. 2004 Oct. 28; 351(18):1860-73. [0229] Marino S F, Olal D, Daumke O. A complex water network contributes to high-affinity binding in an antibody-antigen interface. Data Brief. 2015 Dec. 19; 6:394-7 [0230] Morris P W, Venton D L. Regiospecific amine substitution into a-amanitin with retention of inhibitory properties against eukaryotic class II RNA polymerase. Int. J. Peptide Protein Res. 21 (1983) 419-430 [0231] Oden et al. Potent anti-tumor response by targeting B cell maturation antigen (BCMA) in a mouse model of multiple myeloma. Mol Oncol. 2015 August; 9(7):1348-5 [0232] Peters C, Brown S. Antibody-drug conjugates as novel anti-cancer chemotherapeutics. Biosci Rep. 2015 Jun. 12; 35(4). [0233] Rajkumar S V et al. International Myeloma Working Group updated criteria for the diagnosis of multiple myeloma. Lancet Oncol. 2014 November; 15(12):e538-4 [0234] Rickert R C et al. Signaling by the tumor necrosis factor receptor superfamily in B-cell biology and disease. Immunol Rev. 2011 November; 244(1):115-33 [0235] Sanchez et al.Serum B-cell maturation antigen is elevated in multiple myeloma and correlates with disease status and survival. Br J Haematol. 2012 September; 158(6):727-38 [0236] Shaffer A L et al. IRF4 addiction in multiple myeloma. Nature. 2008 Jul. 10; 454(7201):226-31 [0237] Shields R L et al. High resolution mapping of the binding site on human IgG1 for Fc gamma RI, Fc gamma RII, Fc gamma RIII, and FcRn and design of IgG1 variants with improved binding to the Fc gamma R. J Biol Chem. 2001 Mar. 2; 276(9):6591-604 [0238] Trail P A. Antibody drug conjugates as cancer therapeutics. Antibodies 2013, 2(1), 113-129. [0239] Wieland T, Faulstich H. Amatoxins, phallotoxins, phallolysin, and antamanide: the biologically active components of poisonous Amanita mushrooms. CRC Crit Rev Biochem. 1978 December; 5(3):185-260 [0240] Zhao L, May J P, Blanc A, Dr. Dietrich D J, Loonchanta A, Matinkhoo K, Pryyma A, and Perrin D M. Synthesis of a Cytotoxic Amanitin for Biorthogonal Conjugation. ChemBioChem 16 (2015) 1420-1425
SEQUENCES
[0241]
TABLE-US-00009 HumanizedJ22.9heavychainJ22.9-ISY-D265C (SEQIDNO:1): EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWISWVRQA PGKGLVWVGEINPSSSTINYAPSLKDKFTISRDNAKNTLY LQMNSLRAEDTAVYYCASLYYDYGDAYDYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT YICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVCVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK HumanizedJ22.9lightchain(SEQIDNO:2): EIVMTQSPATLSVSPGERATLSCKASQSVESNVAWYQQKP GQAPRALIYSASLRFSGIPARFSGSGSGTEFTLTISSLQS EDFAVYYCQQYNNYPLTFGAGTKLELKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG LSSPVTKSFNRGEC