SYSTEM FOR F-BOX HORMONE RECEPTOR REGULATED PROTEIN EXPRESSION IN MAMMALIAN CELLS
20190316150 ยท 2019-10-17
Inventors
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
C12N15/79
CHEMISTRY; METALLURGY
A61K48/0066
HUMAN NECESSITIES
A61K48/0083
HUMAN NECESSITIES
C12N15/63
CHEMISTRY; METALLURGY
International classification
C12N15/86
CHEMISTRY; METALLURGY
A61K48/00
HUMAN NECESSITIES
Abstract
The present invention relates to a system for F-box hormone receptor regulated protein expression in mammalian cells. The system includes a silencing nucleic acid molecule comprising a first promoter and an shRNA operably linked to the first promoter, where the shRNA silences expression of a target protein. The system also includes an expression nucleic acid molecule comprising a second promoter, an F-box hormone receptor operably linked to the second promoter, and a nucleic acid molecule encoding a fusion protein comprising a degron fused to the target protein, where the nucleic acid molecule encoding the fusion protein is operably linked to the second promoter. Also disclosed are vectors comprising the system of the present application and methods of use thereof.
Claims
1. A system for F-box hormone receptor regulated protein expression, said system comprising: a silencing nucleic acid molecule comprising a first promoter and an shRNA operably linked to the first promoter, wherein the shRNA silences expression of a target protein; and an expression nucleic acid molecule comprising a second promoter, an F-box hormone receptor operably linked to the second promoter, and a nucleic acid molecule encoding a fusion protein comprising a degron fused to the target protein, wherein the nucleic acid molecule encoding the fusion protein is operably linked to the second promoter.
2. The system of claim 1, wherein the first promoter is an RNA polymerase III promoter.
3. The system of claim 1, wherein the first promoter is a U6 promoter.
4. The system of claim 1, wherein the shRNA targets the 3-UTR of the target protein.
5. The system of claim 1, wherein the shRNA targets a coding region of the target protein.
6. The system of claim 1, wherein the fusion protein is resistant to silencing by the shRNA.
7. The system of claim 1, wherein the second promoter is an RNA polymerase II promoter.
8.-10. (canceled)
11. The system of claim 1, wherein the F-box hormone receptor is codon-optimized for expression in mammalian cells.
12. The system of claim 1, wherein the F-box hormone receptor is selected from the group consisting of an auxin receptor or ajasmonate-isoleucine receptor.
13. The system of claim 1, wherein the F-box hormone receptor is Transport Inhibitor Response 1 (TIR1).
14.-16. (canceled)
17. The system of claim 1, wherein the F-box hormone receptor is Coronatine Insensitive 1 (COI1).
18.-22. (canceled)
23. The system of claim 1, wherein the F-box hormone receptor is a chimeric F-box hormone receptor.
24. (canceled)
25. The system of claim 1, wherein the fusion protein comprises a target protein fused to the amino-terminus of the degron.
26. The system of claim 1, wherein the fusion protein comprises a target protein fused to the carboxyl-terminus of the degron.
27. The system of claim 1, wherein the expression nucleic acid molecule further encodes: a selectable marker operably linked to the second promoter.
28. (canceled)
29. The system of claim 27, wherein the expression nucleic acid molecule further encodes: a first self-cleaving peptide between the F-box hormone receptor and the fusion protein and a second self-cleaving peptide between the fusion protein and the selectable marker.
30. (canceled)
31. A vector comprising the system of claim 1, wherein the silencing nucleic acid molecule is coupled directly or indirectly to the expression nucleic acid molecule.
32. (canceled)
33. A mammalian cell infected with the vector of claim 31.
34. (canceled)
35. A method for F-box hormone receptor regulated protein degradation in a mammalian host cell comprising: providing a mammalian host cell; introducing the system of claim 1 into the mammalian host cell to produce a transgenic mammalian host cell; culturing said transgenic mammalian host cell under conditions that result in (i) silencing expression of the target protein and (ii) expression of the fusion protein; and contacting said transgenic mammalian host cell with a molecule that binds the F-box hormone receptor so that said fusion protein undergoes degradation.
36.-45. (canceled)
46. A method for F-box hormone receptor regulated target protein degradation in a mammalian host cell comprising: providing a mammalian host cell; infecting, into the mammalian host cell, a first lentiviral vector comprising (i) a first silencing nucleic acid molecule comprising a primary first promoter and a first shRNA operably linked to the primary first promoter, wherein the first shRNA silences expression of a first target protein and (ii) a first expression nucleic acid molecule comprising a primary second promoter, a Transport Inhibitor Response 1 (TIR1) receptor operably linked to the primary second promoter, and nucleic acid molecule encoding a first fusion protein comprising an auxin-induced degradation (AID) degron fused to a first target protein, wherein the nucleic acid molecule encoding the first fusion protein is operably linked to the primary second promoter; infecting, into the mammalian host cell, a second lentiviral vector comprising (i) a second silencing nucleic acid molecule comprising a secondary first promoter and a second shRNA operably linked to the secondary first promoter, wherein the second shRNA silences expression of a second target protein and (ii) a second expression nucleic acid molecule comprising a secondary second promoter, a Coronatine Insensitive 1 (COI1) receptor operably linked to the secondary second promoter, and nucleic acid molecule encoding a second fusion protein comprising a jasmonate ZIM-domain (JAZ) degron fused to a second target protein, wherein the nucleic acid molecule encoding the second fusion protein is operably linked to the secondary second promoter; culturing said infected mammalian host cell under conditions that result in (i) silencing expression of the first and second target proteins and (ii) expression of the first and second fusion proteins; contacting said infected mammalian host cell with a molecule that binds the TIR1 receptor so that said first fusion protein undergoes degradation; and contacting said infected mammalian host cell with a molecule that binds the COI1 receptor so that said second fusion protein undergoes degradation.
47.-60. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
DETAILED DESCRIPTION OF THE INVENTION
[0029] In plants, auxin (indole-3-acetic acid; IA A) induces degradation of a family of short-lived transcriptional repressors, the IAA proteins, by mediating the interaction of a degron domain in the target protein with the substrate recognition domain of an F-box protein, TIR1 (Hayashi et al., The Interaction And Integration of Auxin Signaling Components, Plant Cell Physiol. 53: 965-975 (2012), which is hereby incorporated by reference in its entirety). Productive interaction of IAA proteins and TIR1 in the presence of auxin leads to ubiquitynation of the target by recruitment of a Skp1-Cullin-F box protein (SCF) ubiquitin E3 ligase complex, followed by proteasomal degradation. The SCF complex is highly conserved among eukaryotes (Zimmerman et al., Structural Assembly of Cullin-RING Ubiquitin Ligase Complexes, Curr. Opin. Struct. Biol. 20: 714-721 (2010), which is hereby incorporated by reference in its entirety), such that constitutive expression of TIR1 allows a reconstitution of the auxin induced degradation system in vertebrate cells. Due to the lack of an auxin-responsive system in animals, the hormone as well as the F-box protein are otherwise biologically silent and cause no measurable physiological changes in the absence of a target, thus minimizing possible side-effects of the treatment (Nishimura et al., An Auxin-Based Degron System for the Rapid Depletion of Proteins in Nonplant Cells, Nat. Methods 6: 917-922 (2009), which is hereby incorporated by reference in its entirety). The role of auxin signaling through the F-box protein TIR-1 is analogous to the role of COI1-mediated jasmonate ZIM-domain (JAZ) degradation in jasmonic acid (JA) signaling.
[0030] The phytohormone JA and its metabolites regulate a wide spectrum of plant physiology, participating in normal development and growth processes as well as defense responses to environmental and pathogenic stressors. JA is activated upon specific conjugation to the amino acid L-isoleucine, which produces the highly bioactive hormonal signal (3R,7S)-jasmonyl-L-isoleucine (JA-Ile). Coronatine (COR) is a Pseudomonas syringae virulence factor that structurally mimics JA-Ile.
[0031] The discovery of coronatine-insensitive mutants enabled the identification of COI1 as a key player in the JA pathway. Arabidopsis COI1 is an F-box protein that functions as the substrate-recruiting module of the SCF ubiquitin E3 ligase complex. Like other E3 ligases, SCF.sup.CO1 is involved in the ubiquitination of proteins, which targets the proteins for subsequent degradation by the 26S proteasome.
[0032] Arabidopsis JAZ proteins such as JAZ1, JAZ6, JAZ7, and JAZ8 are SCF.sup.CO1 substrate targets that associate with COI1 in a hormone-dependent manner. In the absence of hormone signal, the JAZ proteins actively repress the transcription factor MYC2, which binds to cis-acting elements ofjasmonate-response genes. In response to cues that upregulate JA-Ile synthesis, the hormone stimulates the specific binding of JAZ proteins to COI1, leading to poly-ubiquitynation and subsequent degradation of the JAZ proteins by the 26S proteasome. JAZ degradation relieves repression of MYC2 and probably other transcription factors, permitting the expression of JA-responsive genes.
[0033] The present invention relates to a system for F-box hormone receptor regulated protein expression. The system includes a silencing nucleic acid molecule comprising a first promoter and an shRNA operably linked to the first promoter, where the shRNA silences expression of a target protein. The system also includes an expression nucleic acid molecule comprising a second promoter, an F-box hormone receptor operably linked to the second promoter, and a nucleic acid molecule encoding a fusion protein comprising a degron fused to the target protein, where the nucleic acid molecule encoding the fusion protein is operably linked to the second promoter.
[0034] As used herein, the term promoter refers to an untranslated DNA sequence usually located upstream of a coding region, which contains the binding site for RNA polymerase and initiates transcription of the gene downstream of the promoter into mRNA. The promoters of the present invention may be constitutive promoters, which constitutively induce the expression of a target gene. The promoters of the present invention may also be inducible promoters, which induce the expression of a target gene at a specific site and a specific time.
[0035] In one embodiment, the first promoter is an RNA polymerase III promoter. Exemplary RNA polymerase III promoters include, without limitation, U6 and H1 promoters. In some embodiments, the RNA polymerase III promoter is a U6 promoter.
[0036] In one embodiment, the second promoter is an RNA polymerase II promoter. The RNA polymerase II promoter may be a non-viral promoter. Exemplary non-viral RNA polymerase II promoters include, without limitation, phosphoglycerate kinase-1 (PGK-1) and elongation factor 1 (EF1) promoters.
[0037] In another embodiment, the second promoter is a mammalian promoter. Suitable mammalian promoters include, without limitation, human, murine, bovine, canine, feline, ovine, porcine, ursine, and simian promoters. In one embodiment, the promoter is a human promoter.
[0038] The system of the present invention enables the genetic silencing of an endogenous protein of interest and its replacement with a degron-fused target protein in a mammalian cell. Silencing of the endogenous protein of interest is achieved through the expression of short hairpin RNA from the silencing nucleic acid molecule.
[0039] As used herein, the term short hairpin RNA or shRNA refers to an RNA molecule that leads to the degradation of mRNAs in a sequence-specific manner dependent upon complimentary binding of the target mRNA. shRNA-mediated gene silencing is well known in the art (see, e.g., Moore et al., Short Hairpin RNA (shRNA): Design, Delivery, and Assessment of Gene Knockdown, Methods Mol. Biol. 629: 141-158 (2010), which is hereby incorporated by reference in its entirety).
[0040] As used herein, the term target protein refers to a protein of interest. The silencing nucleic acid molecule of the present invention enables the silencing of an endogenous protein of interest. The expression nucleic acid molecule of the present invention enables the expression of a protein of interest whose degradation is induced by a molecule that binds to an F-box hormone receptor. Proteins of interest include all cellular proteins, including, but not limited to, proteins involved in embryonic stem cell division, proliferation, and differentiation.
[0041] The shRNA may target the 5-untranslated region (5-UTR), the coding region, or the 3-untranslated region (3-UTR) of a target protein. In one embodiment, the shRNA targets the 3-UTR of the target protein. In another embodiment, the shRNA targets the 5-UTR of the target protein. In yet another embodiment, the shRNA targets the coding region of the target protein.
[0042] In another embodiment, the shRNA targets a coding region of the target protein. In accordance with this embodiment, the fusion protein is resistant to silencing by the shRNA. For example, the nucleic acid molecule encoding the fusion protein may comprise silent mutations in the coding region of the target protein recognized by the shRNA (see, e.g., Jiang Y et al., Rescue of the TTF2 Knockdown Phenotype with an siRNA-Resistant Replacement Vector, Cell Cycle 3:1151-1153 (2004) and Kim et al., Coupling of RNAi-Mediated Target Downregulation with Gene Replacement, Antisense Nucleic Acid Drug Dev. 13:151-155 (2003), which are hereby incorporated by reference in their entirety).
[0043] As used herein, the term F-box hormone receptor refers to a plant protein or peptide containing at least one F-box domain that mediates the degradation of a degron-fused target protein in the presence of its respective hormone. The F-box hormone receptor may be codon-optimized for expression in mammalian cells. F-box hormone receptors are well known in the art (see, e.g., Spartz et al., Plant Hormone Receptors: New Perceptions, Genes Dev. 22(16): 2139-2148 (2008), which is hereby incorporated by reference in its entirety).
[0044] In one embodiment, the F-box hormone receptor is selected from the group consisting of an auxin receptor or a jasmonate-isoleucine receptor. In another embodiment, the F-box hormone receptor is an auxin receptor. The auxin receptor may be Transport Inhibitor Response 1 (TIR1). Exemplary TIR1 receptors include, without limitation, Oryza sativa TIR1 (OsTIR1; NP_001052659; SEQ ID NO: 11), Arabidopsis thaliana TIR1, Arabidopsis lyrata TIR1, and TIR1 homologs from other plant species, e.g., grape, tomato, corn, rubber tree, pea, wild tobacco, soybean, sorghum, or wheat. In one embodiment, the TIR1 receptor is OsTIR1. In accordance with this embodiment, the OsTIR1 receptor is a codon-optimized for expression in mammalian cells.
[0045] When the OsTIR1 receptor is a codon-optimized for expression in mammalian cells, the expression nucleic acid molecule may comprise SEQ ID NO: 12.
[0046] In another embodiment, the F-box hormone receptor is a jasmonate-isoleucine receptor. The jasmonate-isoleucine receptor may be Coronatine Insensitive 1 (COI1). Exemplary COI1 receptors include, without limitation, Arabidopsis thaliana COI1 (AtCOI1; NP_565919; SEQ ID NO: 10), Arabidopsis lyrata COI1, Oryza sativa COI1B (OsCOI1B; NP_001055700), and COI1 homologs from other plant species, e.g., grape, tomato, corn, rubber tree, pea, wild tobacco, soybean, sorghum, or wheat. In one embodiment, the COI1 receptor is AtCOI1.
[0047] As used herein, the term chimeric protein refers to a protein or polypeptide comprising two or more heterologous domains which are not found in the same relationship to one another in nature. The F-box hormone receptor of the present invention may be a chimeric F-box hormone receptor. Exemplary chimeric F-box hormone receptors may comprise amino acids sequences from Oryza sativa, Arabidopsis thaliana, Arabidopsis lyrata, or any other plant species having orthologous F-box hormone receptors.
[0048] Chimeric F-box hormone receptors may also comprise amino acid sequences from human F-box hormone receptors including, but not limited to, SKP2 (SEQ ID NO: 9).
[0049] In one embodiment, the chimeric F-box hormone receptor comprises amino acids 2-39 of SEQ ID NO: 11 coupled to amino acids 59-597 of SEQ ID NO: 13 (OsCOIB; NP_001055700.1). In accordance with this embodiment, the chimeric F-box hormone receptor has the amino acid sequence of SEQ ID NO: 14 (OsTIR.sup.F-box-OsCOI1B.sup.LRR):
TABLE-US-00002 MYPYDVPDYATYFPEEVVEHIFSFLPAQRDRNTVSLVCKVWYEIE RLSRKHVTVPFCYAASPAHLLARFPRLESLAVKGKPRAAMYGLIPEDWGA YARPWVAELAAPLECLKALHLRRMVVTDDDLAALVRARGHMLQELKLDKC SGFSTDALRLVARSCRSLRTLFLEECSIADNGTEWLHDLAVNNPVLETLN FHMTELTVVPADLELLAKKCKSLISLKISDCDFSDLIGFFRMAASLQEFA GGAFIEQGELTKYGNVKFPSRLCSLGLTYMGTNEMPIIFPFSALLKKLDL QYTFLTTEDHCQLIAKCPNLLVLAVRNVIGDRGLGVVADTCKKLQRLRVE RGDDDPGLQEEQGGVSQVGLTTVAVGCRELEYIAAYVSDITNGALESIGT FCKNLCDFRLVLLDREERITDLPLDNGVRALLRGCTKLRRFALYLRPGGL SDTGLGYIGQYSGIIQYMLLGNVGETDDGLIRFALGCENLRKLELRSCCF SEQALARAIRSMPSLRYVWVQGYKASKTGHDLMLMARPFWNIEFTPPSSE NANRMREDGEPCVDSQAQILAYYSLAGKRSDCPRSVVPLYPA.
The amino acid sequence of OsTIR.sup.F-box-OsCOI1B.sup.LRR comprises a start codon (amino acid 1 of SEQ ID NO: 13), an HA Tag (amino acids 2-9 of SEQ ID NO: 13), and amino acids 2-39 of SEQ ID NO: 11 coupled to amino acids 59-597 of SEQ ID NO: 13.
[0050] As used herein, the term degron refers to a signal that targets a protein to a ubiquitin ligase complex in a hormone-dependent manner. Exemplary degrons include, without limitation, auxin-induced degradation (AID) degrons and jasmonate ZIM-domain (JAZ) degrons. The degrons of the present invention may comprise a full length wild type degron sequence or a portion of a full length wild-type sequence. In some embodiments, the degron is codon-optimized for expression in mammalian cells.
[0051] When the auxin receptor is Transport Inhibitor Response 1 (TIR), the degron is an auxin-induced degradation (AID) degron. Exemplary AID degrons include, without limitation, Arabidopsis thaliana IAA14 (AtIAA14; SEQ ID NO: 1), Arabidopsis thaliana IAA7 (AtIAA7; SEQ ID NO: 2), Arabidopsis thaliana IAA17 (AtIAA14; SEQ ID NO: 3). In one embodiment, the AID degron comprises amino acids 63-109 of SEQ ID NO: 3 (AID.sup.47). In another embodiment, the AID degron consists of amino acids 63-109 of SEQ ID NO: 3 (AID.sup.47). In accordance with this embodiment, AID.sup.47 is codon optimized for expression in mammalian cells.
[0052] When the jasmonate-isoleucine receptor is Coronatine Insensitive 1 (COI1), the degron is a jasmonate ZIM-domain (JAZ) degron. Exemplary JAZ degrons include, without limitation, Oryza sativa JAZ1 (OsJAZ1; SEQ ID NO: 4), Oryza sativa JAZ2 (OsJAZ2; SEQ ID NO: 5), Oryza sativa JAZ3 (OsJAZ3; SEQ ID NO: 7), Oryza sativa JAZ7 (OsJAZ7; SEQ ID NO: 6), and Arabidopsis thaliana JAZ1 (AtJAZ1; SEQ ID NO: 8). The JAZ degron may comprise amino acids 109-141 or 104-146 of SEQ ID NO: 4. In one embodiment, the JAZ degron consists of SEQ ID NO: 15 (OsJAZ.sup.33):
TABLE-US-00003 HAAALPEMPIARKASLQRFLQKRKHRITTTSEP. Inyetanotherembodiment,theJAZdegron consistsofSEQIDNO:16(OsJAZ.sup.43): PPQPAHAAALPEMPIARKASLQRFLQKRKHRITTTSEPYKKAA.
[0053] As used herein, the term nuclear localization signal or NLS refers to an amino acid sequence that directs import of a protein into the nucleus of the cell. The fusion protein of the present invention may further comprise a nuclear localization signal (NLS). When the degron is a JAZ degron, the fusion protein may further comprise a NLS. Nuclear localization signals are well known in the art and include, without limitation, the SV40 large T-antigen NLS (PKKKRKV; SEQ ID NO: 17).
[0054] In one embodiment, the fusion protein comprises a target protein fused to the amino terminus of the degron. In another embodiment, the fusion protein comprises a target protein fused the carboxyl-terminus of the degron.
[0055] In some embodiments, the expression nucleic acid molecule further encodes a selectable marker operably linked to the second promoter. Suitable selectable markers include, without limitation, puromycin N-acetyl-transferase (PAC), blasticidin-S deaminase (BSD), 3-glycosyl phosphotransferase (Neo), and Hygromycin B phosphotransferase (Hpt). In one embodiment, the selectable marker is selected from the group consisting of puromycin N-acetyl-transferase and blasticidin-S deaminase.
[0056] The expression nucleic acid molecules of the present invention may further encode one or more self-cleaving peptides. The use of self-cleaving peptides in multi-gene expression systems (MGES) is well known in the art and is discussed further in, e.g., Wang et al., 2A Self-Cleaving Peptide-Based Multi-Gene Expression System in the Silkworm Bombyx mori, Scientific Reports 5:16273 (2015) and Kim et al., High Cleavage Efficiency of a 2A Peptide Derived from Porcine Teschovirus-1 in Human Cell Lines, Zebrafish and Mice, PLoS ONE 6:e18556 (2011), which are hereby incorporated by reference in their entirety. Self-cleaving peptides enable the simultaneous expression of multiple proteins from a single nucleic acid molecule.
[0057] In one embodiment, the expression nucleic acid molecule further encodes: (i) a first self-cleaving peptide between the F-box hormone receptor and the fusion protein and (ii) a second self-cleaving peptide between the fusion protein and the selectable marker. The first and second self-cleaving peptides may comprise porcine teschovirus-1 2A peptides.
[0058] The present invention also relates to a vector comprising the system of the present application, where the silencing nucleic acid molecule is coupled directly or indirectly to the expression nucleic acid molecule. The vector may be a lentiviral vector. As described above, lentiviral vectors enable the delivery of an independent rescue system containing continuously-expressed shRNA and an shRNA-immune hormone-degradable protein of interest that rescues the phenotype exerted by the shRNA. In some embodiments, the present invention relates to a mammalian cell infected with the lentiviral vector of the present application.
[0059] As used herein, the term embryonic stem cells refers to cells derived from embryonic sources that can self-renew and differentiate into multiple lineages.
[0060] As used herein, the term cell line or cell lines refers to a population of cultured cells derived from an identified parental cell type.
[0061] As used herein, the term primary cell or primary culture refers to a cell or a culture of cells that have been explanted directly from an organism, organ, or tissue. Primary cultures are typically neither transformed nor immortal.
[0062] In one embodiment, the mammalian cell is selected from the group consisting of embryonic stem cells, cell lines, and primary cells. Exemplary embryonic stem cells include, without limitation, cells from already established lines, embryo carcinoma cells, embryonic fibroblasts including murine embryonic cells, other embryo-like cells, cells of embryonic origin or cells derived from embryos, many of which are known in the art and available from the American Type Culture Collection, Manassas, Va. 20110-2209, USA, and other sources. Additional suitable cells include, without limitation, mouse and human induced-pluripotent cells, epiblast cells, epliblast-like cells, and primary fibroblasts.
[0063] The present invention further describes a method for F-box hormone receptor regulated protein degradation in a mammalian host cell. This method involves providing a mammalian host cell; introducing the system of the present application into the mammalian host cell to produce a transgenic mammalian host cell; culturing said transgenic mammalian host cell under conditions that result in (i) silencing expression of the target protein and (ii) expression of the fusion protein; and contacting said transgenic mammalian host cell with a molecule that binds the F-box hormone receptor so that said fusion protein undergoes degradation.
[0064] The silenced target protein may be endogenous to the mammalian host cell. As described above, the mammalian host cell may be selected from the group consisting of embryonic stem cells, cell lines, and primary cells.
[0065] In one embodiment, the F-box hormone receptor is Transport Inhibitor Response 1 (TIR1), the degron comprises amino acids 63-109 of SEQ ID NO: 3 (AID.sup.47), and the molecule that binds the F-box hormone receptor is auxin (Indole-3-acetic acid, IAA).
[0066] In another embodiment, the F-box hormone receptor is Transport Inhibitor Response 1 (TIR1), the degron comprises amino acids 63-109 of SEQ ID NO: 3 (AID.sup.47), and the molecule that binds the F-box hormone receptor is 1-Naphthaleneacetic acid (NAA).
[0067] The degron may consist of amino acids 63-109 of SEQ ID NO: 3 (AID.sup.47).
[0068] In one embodiment, the F-box hormone receptor has the amino acid sequence of OsTIR.sup.F-box-OsCOI1B.sup.LRR (SEQ ID NO: 14), the degron comprises amino acids 109-141 of SEQ ID NO: 4, and the molecule that binds the F-box hormone receptor is coronatine. The degron may consist of SEQ ID NO: 15 (OsJAZ.sup.33) or SEQ ID NO: 16 (OsJAZ.sup.43). When the degron comprises a JAZ degron, the fusion protein may further comprises a nuclear localization signal.
[0069] In a further embodiment, the silencing nucleic acid molecule is coupled directly or indirectly to the expression nucleic acid molecule within a vector.
[0070] In one embodiment, the introducing is carried out by infecting the mammalian cell with a vector. The vector may be a lentiviral vector.
[0071] The present invention also describes a method for F-box hormone receptor regulated target protein degradation in a mammalian host cell. This method involves providing a mammalian host cell and infecting, into the mammalian host cell, a first lentiviral vector comprising (i) a first silencing nucleic acid molecule comprising a primary first promoter and a first shRNA operably linked to the primary first promoter, where the first shRNA silences expression of a first target protein and (ii) a first expression nucleic acid molecule comprising a primary second promoter, a Transport Inhibitor Response 1 (TIR1) receptor operably linked to the primary second promoter, and a nucleic acid molecule encoding a first fusion protein comprising an auxin-induced degradation (AID) degron fused to a first target protein, where the nucleic acid molecule encoding the first fusion protein is operably linked to the primary second promoter. The method further involves infecting, into the mammalian host cell, a second lentiviral vector comprising (i) a second silencing nucleic acid molecule comprising a secondary first promoter and a second shRNA operably linked to the secondary first promoter, where the second shRNA silences expression of a second target protein and (ii) a second expression nucleic acid molecule comprising a secondary second promoter, a Coronatine Insensitive 1 (COI1) receptor operably linked to the secondary second promoter, and a nucleic acid molecule encoding a second fusion protein comprising a JAZ degron fused to a second target protein, where the nucleic acid molecule encoding the second fusion protein is operably linked to the secondary second promoter. The method further involves culturing the infected mammalian host cell under conditions that result in (i) silencing expression of the first and second target proteins and (ii) expression of the first and second fusion proteins; contacting the infected mammalian host cell with a molecule that binds the TIR1 receptor so that said first fusion protein undergoes degradation; and contacting the infected mammalian host cell with a molecule that binds the COI1 receptor so that said second fusion protein undergoes degradation.
[0072] The first and second silenced target proteins may be endogenous to the mammalian host cell. As described above, the mammalian host cell may be selected from the group consisting of embryonic stem cells, cell lines, and primary cells.
[0073] In one embodiment, the first expression nucleic acid molecule further encodes a selectable marker operably linked to the primary second promoter and (ii) the second expression nucleic acid molecule further encodes a selectable marker operably linked to the secondary second promoter. As described above, the selectable marker may be selected from the group consisting of puromycin N-acetyl-transferase (PAC) and blasticidin-S deaminase (BSD).
[0074] As described above, the nucleic acid molecules of the present invention may further encode one or more self-cleaving peptides. When the first and second expression nucleic acid molecules further encode a selectable marker, the first and second nucleic acid molecules may also encode (i) a first self-cleaving peptide between the F-box hormone receptor and the fusion protein and (ii) a second self-cleaving peptide between the fusion protein and the selectable marker. In one embodiment, the first and second self-cleaving peptides are porcine teschovirus-1 2A peptides.
[0075] Infection of the first lentiviral vector and the second lentiviral vector may occur sequentially or simultaneously.
[0076] The infected mammalian host cell can be contacted with a molecule that binds TIR1 receptor and with a molecule that binds the COI1 receptor sequentially or simultaneously.
[0077] In one embodiment, the AID degron consists of amino acid 63-109 of SEQ ID NO: 3.
[0078] In another embodiment, the COI1 receptor is OsTIR1.sup.F-box-OsCOIB1.sup.LRR (SEQ ID NO: 14).
[0079] The JAZ degron may comprise amino acids 109-141 of SEQ ID NO: 4. The JAZ degron may also consist of SEQ ID NO: 15 (OsJAZ.sup.33) or SEQ ID NO: 16 (OsJAZ.sup.43). When the degron comprises a JAZ degron, the fusion protein may further comprises a nuclear localization signal.
EXAMPLES
Material and Methods for Examples 1-4
[0080] Cell Culture.
[0081] HEK-293T, HCT-116 and NIH/393 cells were cultured in DMEM supplemented with 10% fetal bovine serum (FBS, Corning), 1 mM sodium pyruvate, 2 mM L-glutamine and PenStrep (all from Gibco). NCI-H358 and NCI-H1299 cells (obtained from the American Type Culture Collection) were cultured in RPMI-1640 (Cellgro) supplemented with 10% FBS, 1 mM sodium pyruvate, 2 mM L-glutamine and PenStrep. Validated, mycoplasma-free hESCs and mESCs were obtained from the Pluripotent Stem Cell Core Facility at ISMMS. ESCs were routinely monitored for ES-like morphology and expression of Nanog and Oct4 (Pou5f1) using quantitative real-time PCR. CCE and R1 mESCs, as well as P19 mouse embryonal carcinoma cells, were cultured in DMEM supplemented with 15% FBS, 1 mM sodium pyruvate, 2 mM L-glutamine, non-essential amino acids, PenStrep, 10 nM 2-mercaptoethanol and 100 U ml.sup.1 LIF (ESGRO) on plates coated with 0.1% gelatin (Millipore, catalogue number ES-006-B). H9 hESCs were cultured with mTeSR 1 (Stem Cell Technologies) on plates coated with Matrigel (BD Biosciences, catalog number 354234). For controlling the presence of FGF2 and TGF, TeSR-E8 and TeSR-E6, which contain and lack FGF2/TGFb, respectively, were used. All cells were grown at 37 C. in a humidified atmosphere of 5% CO.sub.2 and passaged on average twice per week. All cells were tested negative for mycoplasma using the e-Myco Mycoplasma PCR Detection Kit (iNtRON). Where indicated, cell numbers were recorded with each passage and population doublings were calculated as Log.sub.2 (cell output/cell input).
[0082] Lentiviral Infection and Selection.
[0083] For the production of lentiviral particles, 110.sup.7 HEK-293T cells were resuspended in growth media (as described above) and transfected with 20 mg lentiviral vector, 20 mg psPAX2 packaging plasmid and 10 mg pMD2.G envelope plasmid using the calcium phosphate method. Cells were then plated in a 10-cm dish and cultured for 1 day. On the second day, media were replaced and cells were incubated at 32 C. Viral supernatants were collected on the morning and evening of the third and fourth days, passed through a 0.22- or 0.45-mm cellulose acetate filter and concentrated 25-fold using an Amicon Ultra-15 Centrifugal Filter (Millipore). Cells were infected with concentrated virus diluted in their appropriate media in the presence of 8 mg ml.sup.1 polybrene (Sigma) for 16 h at 37 C. Selection was applied 2 days following infection with either 1-2 mg ml.sup.1 Puromycin (Fisher Scientific) or 10-20 mg ml.sup.1 Blasticidin-S(Fisher Scientific). Where indicated, colonies (clones) of mESCs and hESCs with typical ESC morphology were manually isolated and expanded.
[0084] Chemicals and Treatments.
[0085] Auxin (IAA, Fisher Scientific, catalogue number AC12216) was dissolved in ethanol to a final concentration of 500 mM. Cells were treated with 50 M IAA or 0.01% ethanol as a control, unless otherwise indicated. Coronatine (Sigma, catalogue number C8115) was first dissolved in dimethylsulfoxide (DMSO) to a concentration of 50 mM and then diluted in DMEM to a final concentration of 5 mM. Cells were treated with 50 M coronatine or with 0.1% DMSO as a control, unless otherwise indicated. Aphidicolin (Fisher Scientific, catalogue number AC61197) was diluted in DMSO to a final concentration of 10 mM. Cells were treated with 1 M aphidicolin or with 0.01% DMSO as a control, unless otherwise indicated. All trans-retinoic acid (Fisher Scientific, catalogue number 302-79-4) was dissolved in ethanol.
[0086] Staining.
[0087] Stemgent's Alkaline Phosphatase staining kit (catalog number 00-009) was used according to the manufacturer's protocol. Crystal violet (CV) staining was performed by incubating cells for 5 minutes with CV solution (10 mM CV, 10% ethanol in water), followed by three to five gentle washes with water. For both AP and CV staining, plates were scanned using a standard desktop scanner and images were digitally adjusted for brightness and contrast. Acetic acid was used to extract CV, which was then quantified using a spectrophotometer at 590 nm. DAPI (4,6-diamidino-2-phenylindole) staining was performed by fixing cells (plated on cover slips) with 4% paraformaldehyde in PBS for 30 minutes, washing twice with PBS (for 5 minutes), treating with 0.2% Triton X-100 and 1% BSA in PBS for 30 min, washing with PBS and incubating with 0.2 mg ml.sup.1 DAPI for 10 minutes. Cells were then washed once with PBS and mounted on microscope slides. Images acquired with a microscope were digitally adjusted for brightness and contrast. All images from the same experiment were processed identically.
[0088] Flow Cytometry.
[0089] Flow cytometry was performed on a BD LSRII machine. For GFP and mOrange fluorescence analysis, cells were trypsinized, neutralized with FBS-containing media, supplemented with 0.2 mg ml.sup.1 DAPI and kept on ice. Cells were gated on forward scatter area (FSC-A) and side scatter area (SSC-A), on FSC width (FSC-W) and FSC-A to eliminate cell aggregates, and on FSC-A and DAPI to eliminate dead cells. GFP and mOrange fluorescence intensities were detected using the fluorescein isothiocyanate (FITC) and DsRed channels, respectively. Background autofluorescence was measured using parental noninfected cells. Background-subtracted median fluorescence was normalized to the control-treated sample, to calculate relative median fluorescence. To calculate % degradation, relative median fluorescence was subtracted from 1. For measurement of apoptotic index, cells were collected by trypsinization together with all cells floating in the media, counted and 310.sup.5 cells per sample were washed twice with PBS and stained using Annexin V:PE Apoptosis Detection Kit I (BD Biosciences, catalog number 559763) according to the manufacturer's protocol. Cells were gated on FSC-A and SSC-A, and on FSC-W and FSC-A to eliminate cell aggregates. 7-aminoactinomycin D (7-AAD) was detected using the PerCP-Cy5.5 filter. Apoptotic index was calculated as the percentage of cells that are 7-AAD negative and Annexin V-Phycoerythrin positive. For measurement of mitotic index, cells were collected by trypsinization together with all cells floating in the media, neutralized with FBS-containing media, washed and fixed by slowly adding ice-cold 70% ethanol/Hank's balanced salt solution while vortexing. Cells were kept for at least 2 hours at 20 C., washed with PBS, incubated for 15 minutes on ice with 0.25% Triton X-100 in PBS and resuspended in 100 ml PBS-BA (PBS supplemented with 1% BSA and 0.02% sodium azide) containing 2 ml anti-Phospho-Histone H3 Ser10 antibody (Cell Signaling, catalog number 9706). Cells were incubated for 2 hours at room temperature with gentle rocking, washed twice with PBS-BA, resuspended in 100 ml PBS-BA supplemented with Alexa Fluor 546 secondary antibody (1:200, Life Technologies), incubated for 30 minutes at room temperature in the dark with gentle rocking, washed with PBS-BA, resuspended in 400 ml PBS containing 50 mg ml.sup.1 RNAse-A and incubated 30 minutes at 37 C. in the dark. Samples were then cooled, supplemented with DAPI to a final concentration of 2 mg ml.sup.1 and incubated on ice for 15 minutes. Unstained and secondary-antibody only samples served as controls. For analysis of cell-surface SSEA-1 expression, cells were trypsinized, washed three times with PBS supplemented with 0.5% BSA (PBSB) and 110.sup.5 cells were resuspended in 25 ml PBSB and 10 ml PE-conjugated anti-SSEA-1 antibody (R&D Systems, catalog number FAB2155P) or IgG-PE for isotype control, incubated 30 minutes on ice, washed twice with PBSB, filtered and supplemented with DAPI to a final concentration of 0.2 mg ml.sup.1.
[0090] Quantitative Real-Time PCR and Expression Heatmaps.
[0091] Total RNA was extracted using TRIZOL (Ambion) and 1-2 g were reverse transcribed using the High Capacity Reverse Transcription Kit (Life Technologies, catalog number 4368814) according to the manufacturer's protocol. QRT-PCR was performed in triplicates or quadruplicates using the Fast SYBR Green Master Mix (Life Technologies, catalog number 4385612) on a LightCycler480 Real-Time PCR System (Roche). Expression was calculated using the ACt method. Relative expression was calculated by dividing the average level of each gene to that of the housekeeping gene GAPDH measured in the same cDNA sample. Gene-specific primers are listed in Table 2. When data are displayed as bar charts, error bars represent the standard
TABLE-US-00004 TABLE2 QRT-PCRPrimers. ForwardPrimer SEQ ReversePrimer SEQID Target Sequence(5-3) IDNO. Sequence(5-3) NO. HumanGAPDH acccactcctccacctttga 18 ctgttgctgtagccaaattcgt 19 HumanHPRT1 gaccagtcaacaggggacat 20 cctgaccaaggaaagcaaag 21 HumanMDM2 gaatcatcggactcaggtacatc 22 tctgtctcactaattgctctcct 23 Humanp21(CDKN1A) tgtccgtcagaacccatgc 24 aaagtcgaagttccatcgctc 25 HumanHEY1 aggagagtgcggacgagaat 26 aacctagagccgaactcaagt 27 HumanHES5 accgcatcaacagcagcat 28 gaaggctttgctgtgcttcag 29 HumanT(Brachyury) cagtggcagtctcaggttaagaagga 30 cgctactgcaggtgtgagcaa 31 HumanSOX1 tttcccctcgctttctca 32 tgcaggctgaattcggtt 33 HumanGATA3 gcccctcattaagcccaag 34 ttgtggtggtctgacagttcg 35 HumanGATA6 gcgggctctacagcaagatg 36 acagttggcacaggacaatcc 37 HumanNANOG cctgaagacgtgtgaagatgag 38 gctgattaggctccaaccatac 39 HumanPAX6 aggtattacgagactggctcc 40 tcccgcttatactgggctattt 41 HumanCXCR4 atgaaggaaccctgtttccgt 42 agatgatggagtagatggtggg 43 HumanEndogenous cctgcccgttcttgaaatgt 44 ggagcatcttcttcggaacct 45 NOTCH1 MouseCdx2 caaggacgtgagcatgtatcc 46 gtaaccaccgtagtccgggta 47 MouseCxcl12 tgcatcagtgacggtaaacca 48 ttcttcagccgtgcaacaatc 49 MouseEsrrb caggcaaggatgacagacg 50 gagacagcacgaaggactgc 51 MouseFas(CD95,APO-1) tatcaaggaggcccattttgc 52 tgtttccacttctaaaccatgct 53 MouseGapdh agaacatcatccctgcatcc 54 cacattgggggtaggaacac 55 MouseGata4 ccctacccagcctacatgg 56 acatatcgagattggggtgtct 57 MouseGata6 ttgctccggtaacagcagtg 58 gtggtcgcttgtgtagaagga 59 MouseHand1 cccctcttccgtcctcttac 60 ctgcgagtggtcacactgat 61 MouseMdm2 tgtctgtgtctaccgagggtg 62 tccaacggactttaacaacttca 63 MouseMixl1 atccgcccggaccctccaaa 64 tcggttctggaaccacacctgga 65 MouseNestin(Nes) aggagaagaagaaccaagaatggag 66 tcggcttctggacctcccagt 67 ga MouseNoxa(Pmaip1) aaaagagcaggatgaggagcc 68 gtccttcaagtctgctggcac 69 Mousep21(Cdkn1a) cctggtgatgtccgacctg 70 ccatgagcgcatcgcaatc 71 MousePax3 gcagcgcaggagcagaacca 72 gcactcgggcctcggtaagc 73 MouseSox1 atgcaccgctacgacatggg 74 gctccgacttgaccagagatcc 75 MouseSox17 cgcacggaattcgaacagta 76 gtcaaatgtcggggtagttg 77 MouseSox7 cccccgaccttcaggggacaag 78 ggacagtgtcagcgccttccat 79 MouseT(Brachyury) gcttcaaggagctaactaacgag 80 ccagcaagaaagagtacatgg 81 c MouseTcl1 aaattccaggtgatcttgcg 82 tgtccttggggtacagttgc 83 eGFP-1 agccgctaccccgaccacat 84 cggttcaccagggtgtcgcc 85 eGFP-2 gacggcgacgtaaacggcca 86 cagcttgccggtggtgcaga 87
deviation of technical replicates. To generate gene expression heatmaps, normalized average expression levels were analysed using the Gene Cluster 3.0 Software (de Hoon et al., Open Source Clustering Software, Bioinformatics 20:1453-1454 (2004), which is hereby incorporated by reference in its entirety). Data were log transformed and genes were mean centered. Genes were then hierarchically clustered using uncentered correlation similarity metric and average linkage.
[0092] Western Blot Analysis.
[0093] Cells were lysed in RIPA-B buffer (20 mM Na.sub.2HPO.sub.4 pH 7.4, 150 mM NaCl and 1% Triton X-100) supplemented with Protease Inhibitor Cocktail (Roche) for 30 minutes on ice with occasional vortexing, followed by 30 minutes centrifugation at 13,000 relative centrifugal force at 4 C. For CDK.sup.pY15 detection, lysis buffer was supplemented with 1 mM dithiothreitol, 50 mM NaF, 30 mM tetrasodium pyrophosphate, 0.1 mM sodium orthovanadate, 10 mM -glycerophosphate, and 15 mM para-nitrophenylphosphate. The BCA Protein Assay Kit (Thermo Scientific, catalog number 23225) was used to determine protein concentration. Next, 20-75 g protein were separated by SDS-PAGE and transferred to polyvinylidene difluoride membranes (Bio-Rad). Membranes were blocked with TBST (10 mM Tris-HCl pH 7.9, 150 mM NaCl and 0.05% Tween-20) containing 3% skim milk, incubated with primary antibodies overnight, washed three times with TBST, incubated with horseradish peroxidase-conjugated secondary antibodies (Amersham), washed three times with TBST and subsequently reacted with ECL or ECL Prime (GE Healthcare). Luminescence was detected with X-ray films, which were scanned, or using the Bio-Rad ChemiDoc MP System. Blots were processed digitally by adjusting the brightness and contrast, and by rotating and cropping, when necessary. The following primary antibodies were used: rabbit anti-GFP (Invitrogen, catalog number A-6455, 1:500), mouse anti-CHK1 (FL-393, Santa Cruz Biotechnology, catalog number sc-8408, 1:1,000), mouse anti--actin (Sigma, catalog number A2066, 1:4,000), rabbit anti-p53 (DO-1, Santa Cruz Biotechnology, catalog number sc-6243, 1:1,000), mouse anti-p53 (Santa Cruz Biotechnology, catalog number sc-126, 1:500), rabbit anti-p21 (Santa Cruz Biotechnology, catalog number sc-397, 1:500), rabbit anti-NANOG (Millipore, catalog number AB5731, 1:1,000), mouse anti-HA (Abcam, catalog number ab 16918, 1:4,000), rabbit anti-phospho Cdc2 (CDK1) Tyr15 (Cell Signaling, catalogue number 9111, 1:500), mouse anti-CDC25A (Santa Cruz Biotechnology, catalog number sc-7389, 1:250), sheep anti-Notch-1 Intracellular Domain (R&D Systems, catalog number AF3647, 1:200), and mouse anti--Tubulin (Sigma, catalog number T9026, 1:1,500). Quantification of protein level was performed using the ImageJ software (Schneider et al., NIH Image to ImageJ: 25 Years of Image Analysis, Nat. Methods 9:671-675 2012), which is hereby incorporated by reference in its entirety). Uncropped immunoblot scans are displayed in
[0094] mRNA-Seq.
[0095] For testing the global transcriptional effect of coronatine treatment, H9 hESCs expressing pJAZ NLS-GFP-OsJAZ.sup.33 and pRAIDRS NLS-mOrange-AID.sup.47 were treated for 2 days with 50 M coronatine (Cor) or 0.1% DMSO (Con). The experiment was repeated twice (replicates A and B). RNA was extracted with TRIZOL (Ambion). Sample preparation and sequencing was performed by Girihlet Inc. Briefly, total RNA was evaluated for quality and quantity using the Agilent RNA 6000 Nano Kit on an Agilent Bioanalyzer. Libraries were prepared using TruSeq RNA Library Prep Kit (Illumina). mRNA was isolated from 500 ng of total RNA using poly T beads and cDNA was synthesized using SuperScript Reverse Transcriptase (ThermoFisher Scientific) and random primers. The cDNA ends were blunted, A base added and adapters ligated. A total of 15 cycles of PCR were performed to generate cDNA libraries. The libraries' concentration was measured using an Agilent DNA 1000 Kit on an Agilent Bioanalyzer. Libraries were sequenced on a NextSeq 500 machine (Illumina) with 1*75 bp reads.
[0096] Data Analysis.
[0097] The resulting fastq files were mapped to the human genome (version hgl9) using the TopHat programme (with Bowtie2). The output .bam files were processed through the Cuffquant programme to generate normalized read counts. The resulting .cxb files were processed through the Cuffdiff programme to generate fragments per kilobase of transcript per million mapped reads (FPKM) values. Raw data (fastq files), as well as FPKM values, were uploaded to the GEO database (GSE74457). On average, there were 7.710.sup.7 reads per sample, which mapped to 23,622 human genes. Lowly expressed genes with an average FPKM value <0.1 were excluded, narrowing the total gene count to 15,928. The BRB-Array Tools software (Simon et al., Analysis of Gene Expression Data Using BRB-Array Tools, Cancer Inform. 3:11-17 (2007), which is hereby incorporated by reference in its entirety) was used to calculate Spearman pairwise correlation between all samples (
[0098] Construction of pRAIDRS and pJAZ.
[0099] Initially, pRAIDRS and pJAZ vectors were synthesized as a cassette containing the following components (restriction enzyme-binding sites, REBSs, are italicized): AscI/pPGK-1 (partial sequence)/SalI/Kozak Sequence/Hormone Receptor/EcoRV/5-P2A/5-MC S/Degron/3-MC S/3-P2A/NsiI/Selectable Marker/AatII . . . KpnI. Cassettes were cloned using AscI+KpnI into an empty pLKO. 1-Puro lentiviral vector (Moffat et al., A Lentiviral RNAi Library for Human and Mouse Genes Applied to an Arrayed Viral High-content Screen, Cell 124:1283-1298 (2006), which is hereby incorporated by reference in its entirety). Different versions of the vectors were then constructed by shuffling components between existing versions or adding new components using restriction enzymes. Specifically, degrons were cloned using XmaI+XbaI, hormone receptors with SalI+EcoRV and selectable markers with PstI+AatII. When indicated, restriction-free cloning (RFC) (Ulrich et al., Exponential Megapriming PCR (EMP) Cloning-Seamless DNA Insertion into Any Target Plasmid without Sequence Constraints, PLoS ONE 7:e53360 (2012), which is hereby incorporated by reference in its entirety) was used. Primers and shRNA sequences are listed in Tables 3 and 4, respectively.
TABLE-US-00005 TABLE3 CloningPrimers. Primer SEQID Name Sequence(5 to3) NO. 1 F-Box-RF-F1 cagggggatcgtcgacgccaccatgacctacttccccgagg 88 2 F-Box-RF-R1 gggccattgtcacatgctcgcggctcagtctctcgatctcg 89 3 JAZ1-31-F1-XmaI atattacccgggcctacacctctgacagagctgcctatcgccag 90 4 JAZ1-31-R1-XbaI atactatctagaaggagccttgctggtcactctgtccttccgc 91 5 JAZ1-FL-F1-XmaI acgtggcccgggatgtcgagttctatggaatg 92 6 JAZ1-FL-R1-XbaI cgcggctctagatatttcagctgctaaaccgag 93 7 OsJAZ-33-F1 tatattcccgggcacgccgctgccctgcctgagatgcctatcgccag 94 8 OsJAZ-33-R1 tgactgtctagatggctcgcttgtggtggtgattctgtgcttccgc 95 9 HA-OsTir1-F1 gtctgagtcgacgccaccatgtacccatacgatgttccagattacgctacctacttccccgaggaag 96 10 P2A-BstBI-R atcttattcgaaggggccggggttctc 97 11 F-Box-RF-F3 cagggggatcgtcgacgccaccatgtacccatacgatgttccag 98 12 F-Box-RF-R3 aaggcacggtcacgtgctttctgctcagtctctcgatctcg 99 13 NheI-NLS-GFP-F gcagccgctagcccaaaaaagaaaagaaaagttatggtgagcaagggcgaggag 100 14 GFP-R2-XmaI gatgtgcccgggcttgtacagctcgtccatgcc 101 15 mOrange-R1-XmaI atcagtcccgggcttgtacagctcgtccatgc 102 16 GFP-F2-NheI gatgtggctagcatggtgagcaagggcgaggag 103 17 mOrange-NheI-F1 atcagagctagcatggtgagcaagggcgaggag 104 18 F-Box-RF-F2 ggggatcgtcgacgccaccatggtttcatgggactcccttcc 105 19 F-Box-RF-R2 ttgtcacatgctcgcgtgtctcagacgctaggcgatacca 106 20 HsSkp1-RF-F cagggggatcgtcgacgccaccatgccttcaattaagttgcagagt 107 21 HsSkp1-RF-R(a) ccacttcctcggggaagtaggtcttctcttcacaccactggt 108 22 HsSkp1-RF-R(b) gggccattgtcacatgctcgcgcttctcttcacaccactggt 109 23 HsSkp1-RF-R(c) ccacttcctcggggaagtaggtccccttgatcatattggcaaca 110 24 HsSkp1-RF-R(d) gggccattgtcacatgctcgcgccccttgatcatattggcaaca 111 25 pEF1-RF-F actttggccgcggctcgaggggctccggtgcccgtcag 112 26 pEF1-RF-R catggtggcgtcgacgatcccctcacgacacctgaaatggaa 113 27 mNanog-F1-XbaI tgtcagtctagaatgagtgtgggtcttcctgg 114 28 mNanog-R1-BamHI tgtcagggatcctatttcacctggtggagtc 115 29 mp53-F2-BstBI tgtcagttcgaaatgactgccatggaggagtc 116 30 mp53-R2-NheI tgtcaggctagcgtctgagtcaggccccactt 117 31 mChk1-F1-XbaI ggtcagtctagaatggcagtgccttttgtgg 118 32 mChk1-R1-BamHI ggtcagggatcctgtaacaggaaaccaaacc 119 33 mutAgeI-F3 gaggggtcggcaattgaagcggtgcctagagaaggtg 120 34 mutAgeI-R3 caccttctctaggcaccgcttcaattgccgacccctc 121 35 FLAG-Tir1-F1 gtctgagtcgacgccaccatggactacaaagacgatgacgacaagacctacttccccgaggaag 122 36 3Myc-Tir1-F1 gtctgagtcgacgccaccatggagcagaaactcattagcgaggaggacctgaacagcgaacagaaactcat 123 ttccgaagaggatctcaactccgagcagaagctgatcagcgaggaggacctgagatccacctacttccccga ggaag 37 hNICD-F1-NheI attctagctagcatgcggcggcagcatggccag 124 38 hNICD-R3-SnaBI ctcggatacgtacttgaaggcctccggaatgc 125 39 hdnMAML1-F2-BstBI attctattcgaactgccgcggcacagcgcggtc 126 40 hdnMAML1-R2-NheI attaaagctagcgtgcttcccggcgcgcttgg 127 41 hp53-F1-XbaI agcttctagaatggaggagccgcagtcag 128 42 hp53-R1-BamHI agctggatccgtctgagtcaggcccttctg 129
TABLE-US-00006 TABLE4 shRNAOligonucleotides # Name PrimerSequence(5 to3) SEQIDNO. 101 mNanog-shRNA-F ccgggccaacctgtactatgtttaactcgagttaaacatagtacaggaggctttttg 130 102 mNanog-shRNA-R aattcaaaaagccaacctgtactatgtttaactcgagttaaacatagtacaggttggc 131 103 mChk1-shRNA-F ccggcccatgtagtagtatcactttctcgagaaagtgatactactacatgggttttt 132 104 mChk1-shRNA-R aattaaaaacccatgtagtagtatcactttctcgagaaagtgatactactacatggg 133 105 hNOTCH1-shRNA-F ccggctttgtttcaggttcagtattctcgagaatactgaacctgaaacaaagtttttg 134 106 hNOTCH1-shRNA-R aattcaaaaactttgtttcaggttcagtattctcgagaatactgaacctgaaacaaag 135 107 Luciferase-shRNA- ccggcttacgctgagtacttcgactcgagtcgaagtactcagcgtaagtttttg 136 F 108 Luciferase-shRNA- aattcaaaaacttacgctgagtacttcgactcgagtcgaagtactcagcgtaag 137 R 109 hp53-shRNA-F ccgggagggatgtttgggagatgtactcgagtacatctcccaaacatccctctttttg 138 110 hp53-shRNA-R aattcaaaaagagggatgtagggagatgtactcgagtacatctcccaaacatccctc 139
Sequences were codon-optimized (using the GeneArt algorithm) to increase their human Codon Adaptation Index (CAI), while avoiding the generation of any REBS that would render unique REBSs in the other parts of the vector non-unique. Components were designed and constructed as follows: OsTIR1 is a codon-optimized (CAI=0.95): O. sativa (rice) TIR1 gene (encoding NP_001052659; SEQ ID NO: 11), excluding the STOP codon. AtCOI1 is a codon-optimized (CAI=0.96) A. thaliana COI1 gene (encoding NP_565919; SEQ ID NO: 10), excluding the STOP codon. OsTIR1.sup.F-box-AtCoi1.sup.LRR: a chimeric receptor composed of an OsTIR1 F-box domain (Tan et al., Mechanism of Auxin Perception by the TIR1 Ubiquitin Ligase, Nature 446:640-645 (2007), which is hereby incorporated by reference in its entirety) (amino acids 1-39) and an AtCOI1 leucine-rich repeat (Sheard et al., Jasmonate Perception by Inositol-phosphate-potentiated COI1-JAZ Co-Receptor, Nature 468:400-405 (2010), which is hereby incorporated by reference in its entirety) (amino acids 52-592) was constructed using RFC. Megaprimers were generated using pRAIDRS as a template and primers 1+2. These megaprimers were used with pJAZ 1 as a template, to generate pJAZ 2. OsCOI1B is a codon-optimized (CAI=0.95) rice COI1B (encoding NP_001055700.1; SEQ ID NO: 13). OsTIR1.sup.F-box-OsCOI1B.sup.LRR (SEQ ID NO: 14): a chimeric receptor composed of a Met-HA-tagged OsTIR1 F-box domain (Tan et al., Mechanism of Auxin Perception by the TIR1 Ubiquitin Ligase, Nature 446:640-645 (2007), which is hereby incorporated by reference in its entirety) (amino acids 2-39 of SEQ ID NO: 11) and an OsCOI1B leucine-rich repeat (Sheard et al., Jasmonate Perception by Inositol-phosphate-potentiated COI1-JAZ Co-Receptor, Nature 468:400-405 (2010), which is hereby incorporated by reference in its entirety) (amino acids 59-597 of SEQ ID NO: 13) was constructed using RFC. Megaprimers were generated using pJAZ 2.sup.HA as a template and primers 11+12. These megaprimers were used with pJAZ 5-Os23 or 5-At23 as a template, to generate versions 6-Os23 or 6-At23, respectively. 5-P2A is a 2A peptide derived from porcine teschovirus-1. Codons were edited to achieve low degree (81%) of homology with the 3-P2A sequence, to reduce recombination likelihood. 5-MCS: four tandemly arranged 6-bp REBSs (BstBI, NheI/Bmtl, SnaBI, and XmaI/SmaI). AID.sup.47 is a codon-optimized (CAI=0.93) 47-amino acid segment that corresponds to amino acids 63-109 of A. thaliana IAA17 (AtIAA17, NP_171921; SEQ ID NO: 2). AID (corresponding to AtIAA17 amino acids 63-95) was generated by PCR amplification using AID.sup.47 as a template and primers containing REBSs enabling replacement of the degron segment. AtJAZ.sup.23 is a codon-optimized (CAI=0.96) 23-amino acid segment that corresponds to amino acids 199-221 of A. thaliana JAZ1 (AtJAZ1, NP_973862; SEQ ID NO: 8). AtJAZ.sup.31 is an extended version of AtJAZ.sup.23 and was PCR-amplified with AtJAZ.sup.23 as a template and primers 3+4, and then cloned with XmaI+XbaI. AtJAZ.sup.FL is the full-length A. thaliana JAZ1 protein (non-codon optimized) and was PCR-amplified from a JAZ1-containing plasmid (Sheard et al., Jasmonate Perception by Inositol-phosphate-potentiated COI1-JAZ Co-Receptor, Nature 468:400-405 (2010), which is hereby incorporated by reference in its entirety) with primers 5+6, and cloned with XmaI+XbaI. OsJAZ.sup.23 is a codon-optimized (CAI=0.98) 23-amino acid segment corresponding to amino acids 114-136 of O. sativa JAZ1 (OsJAZ1, NP_001064513; SEQ ID NO: 4). OsJAZ.sup.33 is an extended version of OsJAZ.sup.23 (corresponding to OsJAZ1 amino acids 109-141) and was PCR amplified with OsJAZ.sup.23 as a template and primers 7+8, and cloned with XmaI+XbaI. 3-MCS: four tandemly arranged 6-bp REBSs (XbaI, HpaI, BamHI and PstI). It is noteworthy that PstI is not unique in vectors containing pEF1 or OsCOI1B.sup.LRR. 3-P2A is identical to 5-P2A, except for different codon usage. PuroR is a codon-optimized (CAI=0.92) N-acetyltransferase gene. BSD is a codon-optimized (CAI=0.96) Blasticidin-S deaminase gene. HA tag: to generate pRAIDRS 7.sup.HA, an HA tag (YPYDVPDYA), preceded by a methionine (Met), was inserted upstream of OsTIR1 by cassette PCR amplification with pRAIDRS as the template and primers 9+10, and cloning this cassette into pRAIDRS with SalI+BstBI. To generate pJAZ 2.sup.HA, a Met-preceded HA tag was cloned upstream of the OsTIR1.sup.F-box-AtCOI1.sup.LRR by cassette PCR amplification with pJAZ 2 as the template and primers 9+10, and cloning this cassette into pJAZ with SalI+BstBI. GFP: enhanced GFP was PCR amplified from pLKO.1-Puro-IRES-GFP with primers 16+14 and cloned into pJAZ or pRAIDRS using NheI+XmaI. mOrange was PCR amplified from pFUW-mOrange with primers 17+15 and cloned into pJAZ or pRAIDRS with NheI+XmaI. NLS: an SV40 large T-antigen NLS (PKKKRKV; SEQ ID NO: 17) was fused to the amino terminus of GFP or mOrange by PCR amplifying an NLS-GFP cassette with primers 13+14 or an NLS-mOrange cassette with primers 13+15, and cloning into pJAZ or pRAIDRS with NheI+XmaI. HsSKP2.sup.F-box-AtCOI1.sup.LRR: a chimeric receptor composed of an Homo sapiens SKP2 (HsSKP2) F-box domain (amino acids 95-132 of SEQ ID NO: 9) and AtCOI1 leucine-rich repeat (Sheard et al., Jasmonate Perception by Inositol-phosphate-potentiated COI1-JAZ Co-Receptor, Nature 468:400-405 (2010), which is hereby incorporated by reference in its entirety) (amino acids 50-592 of SEQ ID NO: 10) was constructed using RFC. Megaprimers were generated using HsSKP2-containing plasmid (Zheng et al., Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF Ubiquitin Ligase Complex, Nature 416:703-709 (2002), which is hereby incorporated by reference in its entirety) as a template and primers 18+19. These megaprimers were used with pJAZ 1 as a template to generate pJAZ 3. HsSKP1-AtCOI1.sup.LRR fusions: chimeric receptors composed of either full-length HsSKP1 or an N-terminal-truncated HsSKP1 lacking amino acids 1-129 (HsSKP1.sup.1-129) and either AtTIR1.sup.F-box-AtCOI1.sup.LRR or just AtCOI1.sup.LRR were constructed using RFC. Megaprimers were generated using pCDNA3.1-SKP1-HA as a template and the following primer combinations: 20+21 for HsSKP1-OsTIR1.sup.F-box-AtCOI1.sup.LRR, 20+22 for HsSKP1-AtCOI1.sup.LRR, 20+23 for HsSKP1.sup.1-129-OsTIR1F-box-AtCOI1.sup.LRR and 20+24 for HsSKP1.sup.1-129-AtCOI1.sup.LRR. Megaprimers were used with pJAZ 2 as a template to generate pJAZ 4a-d. pEF1: human EF1 promoter was cloned using RFC: megaprimers were generated using pEF1-BirA-V5-His as a template and primers 25+26. These megaprimers were used to switch pPGK-1 into pEF1 in pRAIDRS and pJAZ. Site-directed mutagenesis (Zheng et al., An Efficient One-Step Site-Directed and Site-Saturation Mutagenesis Protocol, Nucleic Acids Res. 32:el 15 (2004), which is hereby incorporated by reference in its entirety) was performed with primers 33+34 to eliminate the AgeI site in pEF1.
[0100] Construction of Rescue Systems.
[0101] In general, rescue system vectors were constructed using the two-step cloning protocol (
Example 1pRAIDRS Functions as an Auxin-Induced Degradation Rescue System
[0102] Applicants aimed to design a vector that enables depletion of an endogenous gene-of-interest and its replacement by an exogenous POI whose degradation is induced by auxin. Such an approach represents a genetic complementation (rescue) system, in which a phenotype exerted by silencing a gene-of-interest is conditionally reversed by exogenous expression of that gene product. To this end, pRAIDRS (RNAi and auxin-induced degradation rescue system), a lentiviral vector containing all elements for construction of an auxin-regulated rescue system was engineered. As depicted in
[0103] The full-length AtIAA17, originally used in pAID (Nishimura et al., An Auxin-based Degron System for the Rapid Depletion of Proteins in Nonplant Cells, Nat. Methods 6:917-922 (2009), which is hereby incorporated by reference in its entirety), is imperfect as a degron due to its large size (228 amino acids), its propensity to confer nuclear localization (Arase et al., IAA8 Involved in Lateral Root Formation Interacts with the TIR1 Auxin Receptor and ARF Transcription Factors in Arabidopsis, PLoS ONE 7:e43414 (2012), which is hereby incorporated by reference in its entirety) and other potentially undesirable activities it possesses as a plant transcription factor. Therefore, the minimal required AID degron was mapped to a 47-AA region (AID.sup.47) spanning AtIAA17 residues 63-109 (
Example 2pRAIDRS Enables Rapid and Titratable Conditional Regulation
[0104] To demonstrate the applicability of pRAIDRS as a rescue system in mammalian stem cells, mouse ESCs (mESCs) in which the protein level of NANOG is controlled by auxin were engineered. mESCs were infected with pRAIDRS harboring an shRNA targeting the 3-untranslated region (3-UTR) of Nanog mRNA and an AID.sup.47-fused Nanog coding sequence (A-NANOG) lacking UTRs. As a control, mESCs were infected with pRAIDRS containing only GFP-AID.sup.47 (GFP-A). Post-selection clones demonstrated effective silencing of endogenous NANOG by the shRNA, whereas exogenous A-NANOG, which was expressed at levels comparable to endogenous NANOG in control cells, was effectively and rapidly depleted following auxin treatment (
[0105] To exemplify the rapidity of degradation enabled by pRAIDRS, a rescue system for the checkpoint kinase CHK1 in mESCs was established. CHK1 is required for mouse development and its disruption severely impairs DNA damage responses (Liu et al., Chk1 is an Essential Kinase that is Regulated by Atr and Required for the G2/M DNA Damage Checkpoint, Genes Dev. 14:1448-1459 (2000) and Takai et al., Aberrant Cell Cycle Checkpoint Function and Early Embryonic Death in Chk1(/) Mice, Genes Dev. 14:1439-1447 (2000), which are hereby incorporated by reference in their entirety). Multiple roles are also attributed to CHK1 in normal cell cycle progression (Enders G H, Expanded Roles for Chk1 in Genome Maintenance, J. Biol. Chem. 283:17749-17752 (2008) and Sorensen et al., Safeguarding Genome Integrity: The Checkpoint Kinases ATR, CHK1 and WEE1 Restrain CDK Activity During Normal DNA Replication, Nucleic Acids Res. 40:477-486 (2012), which are hereby incorporated by reference in their entirety) and in mESC self-renewal (Lee et al., Regulation of Embryonic and Induced Pluripotency by Aurora Kinase-p53 Signaling, Cell Stem Cell 11:179-194 (2012), which is hereby incorporated by refence in its entirety). mESCs were infected with pRAIDRS harboring a Chk1 30-UTR-targeting shRNA and an AID47-fused Chk1 coding sequence (A-CHK1). A western blot analysis of selected clones demonstrated efficient silencing of endogenous CHK1 and complete auxin-dependent degradation of A-CHK1 (
[0106] Next, pRAIDRS was used to study the role of CHK1 in the mESC DNA damage response. To this end, cells were treated with aphidicolin, a DNA polymerase inhibitor that induces DNA breaks and activates the ATR-CHK1 pathway (Feijoo et al., Activation of Mammalian Chk1 During DNA Replication Arrest: A Role for Chk1 in the Intra-S Phase Checkpoint Monitoring Replication Origin Firing, J. Cell Biol. 154:913-923 (2001), which is hereby incorporated by reference in its entirety). CHK1 depletion dramatically sensitized mESCs to aphidicolin, as auxin-treated A-CHK1 cells died following treatment with 0.1 mM aphidicolin, whereas control cells survived following treatment with 100-fold higher concentrations of aphidicolin (
[0107] Auxin-induced degradation was shown to be reversible (Nishimura et al., An Auxin-based Degron System for the Rapid Depletion of Proteins in Nonplant Cells, Nat. Methods 6:917-922 (2009), which is hereby incorporated by reference in its entirety). To demonstrate this for pRAIDRS, p53-null lung adenocarcinoma cells (NCI-H1299) expressing an auxin-degradable wild-type p53-AID47 (p53-A) were engineered. These cells were infected and cultured in the presence of auxin to prevent the stabilization of p53, known for its ability to inhibit cell growth (Brosh et al., When Mutants Gain New Powers: News from the Mutant p53 Field, Nat. Rev. Cancer 9:701-713 (2009) and Brosh et al., Transcriptional Control of the Proliferation Cluster by the Tumor Suppressor p53, Mol. Biosyst. 6:17-29 (2010), which are hereby incorporated by reference in their entirety). However, following auxin removal p53 was rapidly stabilized, leading to the induction of the p53 target genes p21 (CDKN1A) and MDM2, and resulting in growth retardation (
Example 3pJAZ Functions as a Coronatine-Induced Degradation Rescue System
[0108] Simultaneous conditional regulation of two proteins represents a powerful tool for complex analyses. Next, a second rescue system that harnesses the plant jasmonate-induced degradation response was engineered. As described above, in plants, isoleucine-conjugated jasmonate (JA-Ile) mediates the binding of the F-box hormone receptor COI1 and the JAZ degron domain of target proteins, which are consequently ubiquitinated and degraded (Chini et al., The JAZ Family of Repressors is the Missing Link in Jasmonate Signalling, Nature 448:666-671 (2007) and Owen-Schaub et al., Wild-Type Human p53 and a Temperature-Sensitive Mutant Induce Fas/APO-1 Expression, Mol. CellBiol. 15:3032-3040 (1995), which are hereby incorporated by reference in their entirety) (
[0109] For initial testing, HEK-293T cells were infected with pJAZ harboring GFP-AtJAZ.sup.23 and treated with coronatine. Disappointingly, GFP degradation was extremely ineffective (
[0110] Next, cells expressing coronatine-degradable NLS-GFP-OsJAZ.sup.33 and auxin-degradable NLS-mOrange-AID.sup.47 were engineered using pJAZ and pRAIDRS harboring PuroR or BSD, respectively, and selecting these cells with puromycin and blasticidin. Flow cytometric and microscopic analyses demonstrated that pRAIDRS and pJAZ function effectively and independently in a variety of cell types, including hESCs (
Example 4A Dual Molecular Switch to Dissect the NOTCH1 Pathway
[0111] NOTCH signaling, which is inactive in undifferentiated hESCs, participates in their differentiation into embryonic lineages (Noggle et al., Notch Signaling is Inactive but Inducible in Human Embryonic Stem Cells, Stem Cells 24:1646-1653 (2006) and Yu et al., Notch Signaling Activation in Human Embryonic Stem Cells is Required for Embryonic, but not Trophoblastic, Lineage Commitment, Cell Stem Cell 2:461-471 (2008), which are hereby incorporated by reference in their entirety). In mice, NOTCH was also implicated in trophectoderm formation (Rayon et al., Notch and Hippo Converge on Cdx2 to Specify the Trophectoderm Lineage in the Mouse Blastocyst, Dev. Cell 30:410-422 (2014), which is hereby incorporated by reference in its entirety). Canonical NOTCH signaling involves ligand binding to the membrane receptor, leading to cleavage of the NOTCH intracellular domain (NICD) and its translocation to the nucleus, where it binds CSL (RBPJ) and MAML1 to activate gene transcription (Andersen et al., Non-canonical Notch Signaling: Emerging Role and Mechanism, Trends Cell Biol. 22:257-265 (2012), which is hereby incorporated by reference in its entirety). Applicants sought to construct a molecular switch to dissect NOTCH1 signaling in hESCs. hESCs were infected with pRAIDRS NICD-A, which harbors an shRNA targeting the full-length NOTCH1 receptor and an NICD-AID.sup.47 CDS (
[0112] The effect of NICD-AID.sup.47 accumulation following auxin removal in a self-renewal condition was analyzed in the presence of fibroblast growth factor 2 (FGF2) and transforming growth factor- (TGF) or in their absence (differentiation condition). As depicted in
Discussion of Examples 1-4
[0113] Examples 1-4 demonstrate a molecular system that facilitates experiments that were previously unfeasible or very complicated in mammalian cells in general and ESCs in particular. Both pRAIDRS and pJAZ are easy-to-construct single vectors (
[0114] The iterative engineering of pRAIDRS and pJAZ was aimed at enhancing their functionality in ESCs. A hormone receptor/P2A/degron-fused POI/P2A/selectable marker cassette that was codon optimized for human cells is transcriptionally driven by a PGK-1 or EFla promoter. These promoters offer strong and stable expression in a wide variety of cells, with pPGK-1 being more stable in ESCs and pEFla stronger (Norrman et al., Quantitative Comparison of Constitutive Promoters in Human ES Cells, PLoS ONE 5:e12413 (2010); Xia et al., Transgenes Delivered by Lentiviral Vector are Suppressed in Human Embryonic Stem Cells in a Promoter-dependent Manner, Stem Cells Dev. 16:167-176 (2007); and Qin et al., Systematic Comparison of Constitutive Promoters and the Doxycycline-inducible Promoter, PLoS ONE 5:e10611 (2010), which are hereby incorporated by reference in their entirety). The P2A peptides separating the aforementioned components are the most effective 2A peptide in mammalian cells (Kim et al., High Cleavage Efficiency of a 2A Peptide Derived from Porcine Teschovirus-1 in Human Cell Lines, Zebrafish and Mice, PLoS ONE 6:e18556 (2011), which is hereby incorporated by reference in its entirety). The AID degron was minimized fivefold, to reduce interference and spontaneous cleavage. To harness the jasmonate-induced degradation pathway, a chimeric receptor was engineered, as neither A. thaliana nor rice coronatine receptors function in mammalian cells, and identified the minimal rice JAZ degron motif compatible with this chimeric receptor. The use of selectable markers translated in-frame with the hormone receptor and POI should ensure that drug-resistant cells are hormone sensitive. Finally, the silencing of an endogenous gene-of-interest by the pU6-driven shRNA renders each lentiviral vector an independent rescue system.
[0115] A tetracycline-based complementation approach has proven useful for gene discovery and characterization in ESCs (Lee et al., Regulation of Embryonic and Induced Pluripotency by Aurora Kinase-p53 Signaling, Cell Stem Cell 11:179-194 (2012); Ang et al., Wdr5 Mediates Self-Renewal and Reprogramming Via the Embryonic Stem Cell Core Transcriptional Network, Cell 145:183-197 (2011); and Ivanova et al., Dissecting Self-Renewal in Stem Cells with RNA Interference, Nature 442:533-538 (2006), which are hereby incorporated by reference in their entirety).
Nevertheless, its slowness and the requirement for rtTA expression limit its use. Conversely, pAID enables rapid control of proteins, but does not offer endogenous gene inactivation, uses a large bioactive degron, and is inapplicable to mammalian stem cells (Table 1). Although auxin-dependent degradation was previously harnessed to generate molecular switches in somatic mammalian cells, this was achieved by sequential and laborious steps, such as TIR1 overexpression, POI-degron overexpression and gene-of-interest knockdown/out (Han et al., Catalytic Assembly of the Mitotic Checkpoint Inhibitor BubR1-Cdc20 by a Mad2-Induced Functional Switch in Cdc20, Mol. Cell 51:92-104 (2013); Holland et al., Inducible, Reversible System for the Rapid and Complete Degradation of Proteins in Mammalian Cells, Proc. Natl. Acad. Sci. USA 109:E3350-3357 (2012); and Rodriguez-Bravo et al., Nuclear Pores Protect Genome Integrity by Assembling a Premitotic and Mad1-dependent Anaphase Inhibitor, Cell 156:1017-1031 (2014), which are hereby incorporated by reference in their entirety) or, alternatively, by genomic targeting of AID degrons to both alleles of the endogenous gene combined with TIR1 overexpression (Lambrus et al., p53 Protects Against Genome Instability Following Centriole Duplication Failure, J. Cell Biol. 210:63-77 (2015), which is hereby incorporated by reference in its entirety). Although these approaches were effective in constructing single molecular tuners, the system of the present invention enables the engineering of a dual molecular tuner with unparalleled simplicity and quickness, and is particularly useful for studying ESCs, which are hard to otherwise manipulate genetically. Importantly, the rapidity of auxin-dependent protein depletion achieved with the pRAIDRS system (20-30 minutes for >95% degradation of NANOG and CHK1) is comparable with those reported by Han et al. (Han et al., Catalytic Assembly of the Mitotic Checkpoint Inhibitor BubR1-Cdc20 by a Mad2-Induced Functional Switch in Cdc20, Mol. Cell 51:92-104 (2013), which is hereby incorporated by reference in its entirety) (90 minutes), Holland et al. (Holland et al., Inducible, Reversible System for the Rapid and Complete Degradation of Proteins in Mammalian Cells, Proc. Natl. Acad. Sci. USA 109:E3350-3357 (2012), which is hereby incorporated by reference in its entirety) (60-100 minutes), Rodriguez-Bravo et al. (Rodriguez-Bravo et al., Nuclear Pores Protect Genome Integrity by Assembling a Premitotic and Mad1-dependent Anaphase Inhibitor, Cell 156:1017-1031 (2014), which is hereby incorporated by reference in its entirety) (>120 min) and Lambrus et al. (Lambrus et al., p53 Protects Against Genome Instability Following Centriole Duplication Failure, J. Cell Biol. 210:63-77 (2015), which is hereby incorporated by reference in its entirety) (10-30 minutes) in mammalian cells.
[0116] pRAIDRS and pJAZ combine the advantages of the genetic complementation and hormone-induced degradation strategies, while averting their limitations, as each vector represents a fully functional rescue system specifically tailored to mammalian stem cells and both offer rapid, reversible and titratable control of protein levels. Importantly, combining endogenous gene silencing with conditional rescue ensures high-confidence genotype-to-phenotype causal linkages. Moreover, in contrast to other conditional protein degradation/activation systems (Bonger et al., Small-Molecule Displacement of a Cryptic Degron Causes Conditional Protein Degradation, Nat. Chem. Biol. 7:531-537 (2011); Banaszynski et al., A Rapid, Reversible, and Tunable Method to Regulate Protein Function in Living Cells Using Synthetic Small Molecules, Cell 126:995-1004 (2006); Neklesa et al., Small-Molecule Hydrophobic Tagging-Induced Degradation of HaloTag Fusion Proteins, Nat. Chem. Biol. 7:538-543 (2011); and Braselmann et al., A Selective Transcriptional Induction System for Mammalian Cells Based on Gal4-estrogen Receptor Fusion Proteins, Proc. Natl. Acad. Sci. USA 90:1657-1661 (1993), which are hereby incorporated by reference in their entirety), pRAIDRS and pJAZ degrons are extremely short, diminishing interference with POI localization and function. Other advantages of pRAIDRS and pJAZ are listed in Table 1. Of note, although both pRAIDRS and pJAZ enable hormone-dependent degradation of cytoplasmic and nuclear POIs, with both systems the degradation of nuclear POIs is faster and requires lower hormone concentrations.
[0117] As a proof-of-concept, a molecular switch for the ESC master regulator NANOG was constructed. This switch enabled conditional and nearly complete rapid depletion of NANOG, recapitulating its well-established roles in mESCs (Cavaleri et al., Nanog: A New Recruit to the Embryonic Stem Cell Orchestra, Cell 113:551-552 (2003), which is hereby incorporated by reference in its entirety). By engineering a molecular switch for CHK1, a series of gene-specific phenotypes were elicited as early as 45 minutes following hormone treatment. This degree of rapidity can facilitate the distinction between primary and secondary events, and enables high-resolution kinetic studies. Furthermore, owing to the inert and specific nature of hormone-induced degradation, only minor effects were observed following CHK1 depletion in post-selection cells, contrasting with the current conception of the role of CHK1 in normal cycling cells (Enders G H, Expanded Roles for Chk1 in Genome Maintenance, J. Biol. Chem. 283:17749-17752 (2008); Sorensen et al., Safeguarding Genome Integrity: The Checkpoint Kinases ATR, CHK1 and WEE1 Restrain CDK Activity During Normal DNA Replication, Nucleic Acids Res. 40:477-486 (2012); and Niida et al., Depletion of Chk1 Leads to Premature Activation of Cdc2-cyclin B and Mitotic Catastrophe, J. Biol. Chem. 280:39246-39252 (2005), which are hereby incorporated by reference in their entirety) and in mESC self-renewal (Lee et al., Regulation of Embryonic and Induced Pluripotency by Aurora Kinase-p53 Signaling, Cell Stem Cell 11:179-194 (2012), which is hereby incorporated by reference in its entirety). Conversely, it was demonstrated that CHK1 plays a crucial protective role in DNA-damaged mESCs by restricting mitotic entry, which otherwise leads to apoptosis or differentiation. The CHK1 molecular switch represents a unique tool for screening and characterizing CHK1 inhibitors and DNA-damage sensitizers, a rapidly growing category of anti-cancer drugs (Zhang et al., Roles of Chk1 in Cell Biology and Cancer Therapy, Int. J. Cancer 134:1013-1023 (2014) and Ma et al., Death by Releasing the Breaks: CHK1 Inhibitors as Cancer Therapeutics, Trends Mol. Med. 17:88-96 (2011), which are hereby incorporated by reference in their entirety).
[0118] Applicants also engineered cancer cells expressing hormone-degradable p53 and demonstrated its unleashing by auxin removal (Brosh et al., Transcriptional Control of the Proliferation Cluster by the Tumor Suppressor p53, Mol. Biosyst. 6:17-29 (2010), which is hereby incorporated by reference in its entirety), highlighting the rapid reversibility of hormone-induced degradation. Stable ectopic expression of tumour suppressors is cumbersome, as cancer cells quickly evade their effects. However, effective auxin-induced p53 degradation enabled prolonged propagation of these cells without growth inhibition or transgene silencing. Applicants further demonstrated how pRAIDRS and pJAZ allow titratable control of protein levels, a feature that enables studies of protein dose responses and threshold levels.
[0119] By engineering a coronatine-dependent p53 switch, the applicability of pJAZ for rapid and simple construction of molecular switches in hESCs was demonstrated. Moreover, applicants showed how combining pRAIDRS and pJAZ yields a dual molecular switch, where auxin and coronatine control two different proteins independently. Applying this method to hESCs, unknown aspects of the canonical NOTCH1 pathway and its integration with the hESC self-renewal network were unveiled. Thus, the generation of such dual switches (or tuners) is valuable for dissecting the function of proteins and regulatory networks.
[0120] Although preferred embodiments have been depicted and described in detail herein, it will be apparent to those skilled in the relevant art that various modifications, additions, substitutions, and the like can be made without departing from the spirit of the invention and these are therefore considered to be within the scope of the invention as defined in the claims which follow.