METHOD OF DETECTING CLEAVED SNAP25 IN TISSUE SAMPLES

20190317095 ยท 2019-10-17

    Inventors

    Cpc classification

    International classification

    Abstract

    Methods and compositions for detecting BoNT/A enzymatic activity in tissues or a tissue sample are described herein. The invention encompasses antibodies that bind preferentially to BoNT/A cleaved SNAP25 and is able to preferentially detect BoNT/A cleaved SNAP25, as compared to intact (non-cleaved) SNAP25, in a tissue sample.

    Claims

    1. A method of diagnosing if a tissue has been exposed to BoNT/A enzymatic activity comprising contacting a tissue sample suspected of having been exposed to BoNT/A enzymatic activity with an anti-SNAP25 antibody wherein the antibody binds preferentially to BoNT/A cleaved SNAP25; and detecting whether the anti-SNAP25 antibody bound to the tissue sample, wherein the presence of the anti-SNAP25 antibody binding to the tissue sample indicates that the tissue sample has been exposed to BoNT/A activity.

    2. The method of claim 1, wherein the antibody does not bind to full length SNAP25.

    3. The method of claim 1, wherein the antibody is able to preferentially bind to BoNT/A cleaved SNAP25 in a tissue.

    4. The method of claim 1, wherein the tissue is a biopsy sample.

    5. The method of claim 1, wherein the antibody comprises a light chain sequence of SEQID NO:1 or SEQ ID NO:2 and is a recombinant murine antibody.

    6. The method of claim 1, wherein the antibody comprises a heavy chain sequence of SEQID NO:3 or SEQID NO:4 and is a recombinant murine antibody.

    7. The method of claim 1, wherein the antibody comprises a light chain sequence of SEQID NO: 5 or SEQID NO: 6 and is a recombinant human antibody.

    8. The method of claim 1, wherein the antibody comprises a heavy chain sequence of SEQID NO:7 or SEQID NO:8 and is a recombinant human antibody.

    9. The method of claim 1, wherein the antibody binds to the same epitope of an antibody with a heavy chain and/or light chain comprising one or more sequences of SEQID NOs:1-8.

    10. A kit for diagnosing if a tissue has been exposed to BoNT/A enzymatic activity comprising an anti-SNAP25 antibody, wherein the antibody binds preferentially to BoNT/A cleaved SNAP25.

    11. The kit of claim 10, wherein the antibody does not bind to full length SNAP25.

    12. The kit of claim 10, wherein the antibody is able to preferentially bind to BoNT/A cleaved SNAP25 in a tissue.

    13. The kit of claim 10, wherein the tissue is a biopsy sample.

    14. The kit of claim 10, wherein the antibody comprises a light chain sequence of SEQID NO:1 or SEQ ID NO:2 and is a recombinant murine antibody.

    15. The kit of claim 10, wherein the antibody comprises a heavy chain sequence of SEQID NO:3 or SEQID NO:4 and is a recombinant murine antibody.

    16. The kit of claim 10, wherein the antibody comprises a light chain sequence of SEQID NO: 5 or SEQID NO: 6 and is a recombinant human antibody.

    17. The kit of claim 10, wherein the antibody comprises a heavy chain sequence of SEQID NO:7 or SEQID NO:8 and is a recombinant human antibody.

    18. The kit of claim 10, wherein the antibody binds to the same epitope of an antibody with a heavy chain and/or light chain comprising one or more sequences of SEQID NOs:1-8.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0011] FIG. 1 shows a diagrammatic representation of the putative epitope for the humanized and murine recombinant monoclonal antibodies against SNAP25.sub.197. The diagram shows the 12-residue peptide, minus the N-terminal cysteine residue (used for conjugating to Keyhole Limpet Hemocyanin) that was used to generate the original monoclonal antibody.

    [0012] FIG. 2 (A-F) shows Western Blot analysis comparing the specificity of different antibodies for detecting full-length SNAP25.sub.206 and cleaved SNAP25.sub.197 in rat embryonic cortical cell lysates treated with (L.sub.3) or without (L.sub.2) BoNT/A at 3 nM concentration. (A) Blot probed with a commercially available anti-SNAP25 mAb (SMI-81R) that recognizes both the full-length (206) and cleaved (197) forms of SNAP25. In lane 2, only SNAP25.sub.206 is detected, whereas in lane 3, both SNAP25.sub.206 (arrow) and SNAP25.sub.197 (arrowhead) are detected. (B) Blot probed with a commercially available anti-SNAP25 mAb (MC-6050) that reportedly recognizes both SNAP25.sub.206 and SNAP25.sub.197. Only SNAP25.sub.197 appears as a single band in lane 3 (arrowhead). (C) Blot probed with a commercially available anti-SNAP25 mAb (MC-6053) that is reportedly specific for SNAP25.sub.197. This antibody recognizes a thin, faint SNAP25.sub.197 band in lane 3. (D) Blot probed with Ab632 anti-SNAP25.sub.197 rMAb. In lane 2, no band is detected, whereas in lane 3, a single band for SNAP25.sub.197 is detected (arrowhead). (E) Blot probed with Ab635 anti-SNAP25.sub.197 rMAb. In lane 2, no band is detected, whereas in lane 3, a single band for SNAP25.sub.197 is detected (arrowhead). (F) Blot probed with RGT-1092 anti-SNAP25.sub.197 pAb. This antibody primarily recognizes SNAP25.sub.197 in lane 3 (arrowhead), although two faint bands are visible just above and below the SNAP25.sub.197 band. Lane 1, protein ladder; Lane 2, untreated cortical cell lysate; Lane 3, BoNT/A-treated (3 nM) cortical cell lysate.

    [0013] FIG. 3 (A-F) shows Western Blot analysis comparing the specificity of different antibodies for detecting full-length SNAP25.sub.206 and cleaved SNAP25.sub.197 in SiMa cell lysates treated with (L.sub.3) or without (L.sub.2) BoNT/A at 3 nM concentration. (A) Blot probed with a commercially available anti-SNAP25 mAb (SMI-81R) that recognizes both the full-length (206) and cleaved (197) forms of SNAP25. In lane 2, only SNAP25.sub.206 is detected, whereas in lane 3, both SNAP25.sub.206 (arrow) and SNAP25.sub.197 (arrowhead) are detected. (B) Blot probed with a commercially available anti-SNAP25 mAb (MC-6050) that reportedly recognizes both SNAP25.sub.206 and SNAP25.sub.197. Only SNAP25.sub.197 appears as a single band in lane 3 (arrowhead). (C) Blot probed with a commercially available anti-SNAP25 mAb (MC-6053) that is reportedly specific for SNAP25.sub.197. The antibody does not appear to recognize any bands. (D) Blot probed with Ab632 anti-SNAP25.sub.197 rMAb. In lane 2, no band is detected, whereas in lane 3, a single band for SNAP25.sub.197 is detected (arrowhead). (E) Blot probed with Ab635 anti-SNAP25.sub.197 rMAb. In lane 2, no band is detected, whereas in lane 3, a single band for SNAP25.sub.197 is detected (arrowhead). (F) Blot probed with RGT-1092 anti-SNAP25.sub.197 pAb. This antibody primarily recognizes SNAP25.sub.197 in lane 3 (arrowhead), although two faint bands are visible just above and below the SNAP25.sub.197 band. Lane 1, protein ladder; Lane 2, untreated SiMa cell lysate; Lane 3, BoNT/A-treated (0.01 nM) SiMa cell lysate.

    [0014] FIG. 4(A, B) shows control Western Blot analysis for the cortical cell studies in FIG. 2 and SiMa cell studies in FIG. 3 probed with anti-GAPDH mAb demonstrating equal loading of samples in lanes 2 and 3. Lane 1, protein ladder; Lane 2, untreated cell lysate; Lane 3, BoNT/A-treated (3 nM) cortical cell lysate and (0.01 nM) SiMa cell lysate. FIG. 4(C, D) shows Western Blot analysis demonstrating the epitope specificity of Ab632-rMAb using SiMa cell lysates treated with BoNT/A (L.sub.3), BoNT/C (L.sub.4), BoNT/E (L.sub.5) or with no toxin (L.sub.2). (C) Blot probed with a commercially available anti-SNAP25 mAb (SMI-81R) that recognizes both the full-length (206) and cleaved (197 for BoNT/A, 198 for BoNT/C and 180 for BoNT/E) forms of SNAP25. In lane 2, only SNAP25.sub.206 is detected, whereas in lane 3, both SNAP25.sub.206 (arrow) and SNAP25.sub.197 are detected. In lane 4, both SNAP25.sub.206 (arrow) and SNAP25.sub.198 are detected and in lane 5, both SNAP25.sub.206 (arrow) and SNAP25.sub.180 are detected; (D) Blot probed with Ab632 anti-SNAP25.sub.197 rMAb. In lane 2, 4 and 5, no band is detected, whereas in lane 3, a single band for SNAP25.sub.197 is detected. Lane 1, protein ladder; Lane 2, untreated SiMa cell lysate; Lane 3, BoNT/A-treated SiMa cell lysate; Lane 4, BoNT/C-treated SiMa cell lysate; Lane 5, BoNT/E-treated SiMa cell lysate.

    [0015] FIG. 5 (A-J) shows immunohistochemical analysis comparing the specificity of antibodies against SNAP25 in sections of rat bladder following treatment with either onabotulinumtoxinA (10 U/kg) or vehicle. (A-E) Confocal images of bladder detrusor muscle (DM) injected with onabotulinumtoxinA and probed with (A) commercial mAb (SMI-81R) against full-length (206) and cleaved (197) SNAP25, (B) a second commercial mAb (MC-6050) against SNAP25.sub.197 & SNAP25.sub.206, (C) commercial mAb (MC-6053) against SNAP25.sub.197, (D) Ab632-rMAb against SNAP25.sub.197 and (E) RGT-1092 pAb against SNAP25.sub.197. (F-J) Confocal images of control rat bladder injected with vehicle and probed with the same five antibodies. Arrows (F and J) point to IR-signal within nerve fibers from vehicle treated rat bladder. DM, detrusor muscle; Scale bar=50 m.

    [0016] FIG. 6 (A-J) shows immunohistochemical analysis comparing the specificity of antibodies against SNAP25 in sections of rat glabrous skin following treatment with either onabotulinumtoxinA (30 U/kg) or vehicle. (A-E) Confocal images of rat skin injected with onabotulinumtoxinA and probed with (A) commercial mAb (SMI-81R) against full-length (206) and cleaved (197) SNAP25, (B) a second commercial mAb (MC-6050) against SNAP25.sub.197 & SNAP25.sub.206, (C) commercial mAb (MC-6053) against SNAP25.sub.197, (D) Ab632-rMAb against SNAP25.sub.197 and (E) RGT-1092 pAb against SNAP25.sub.197. (F-J) Confocal images of control rat skin injected with vehicle and probed with the same five antibodies. Arrows (F, G, H and J) point to IR-signal within nerve fibers from vehicle treated rat skin. Asterisks (B, C, G and H) point to non-specific IR-signal within the lumen of blood vessels. BV, blood vessel; CT, connective tissue; Scale bar=50 m.

    [0017] FIG. 7 (A-H) shows immunohistochemical analysis comparing the specificity of antibodies against SNAP25 in skeletal muscle underlying rat glabrous skin following treatment with either onabotulinumtoxinA (30 U/kg) or vehicle. (A-D) Confocal images showing motor nerve terminals (MNT, arrows) within the underlying muscle of the rat paw injected with onabotulinumtoxinA and probed with (A) commercial mAb (SMI-81R) against full-length (206) and cleaved (197) SNAP25; (B) a second commercial mAb (MC-6050) against SNAP25.sub.197 & SNAP25.sub.206; (C) a commercial mAb (MC-6053) against SNAP25.sub.197 and (D) Ab632-rMAb against SNAP25.sub.197; (E-H) Confocal images from control rat paw injected with vehicle and probed with the same four antibodies. SNAP25-IR signal is in green (shown as gray in black and white drawings) and DIC illumination was used to delineate the underlying muscle fibers (MF). Arrow (E) points to IR-signal within a MNT from vehicle treated rat paw; asterisks (B,C,F and G) point to non-specific IR-signal within the muscle. Scale bar=50 m.

    [0018] FIG. 8 (A-T) shows immunohistochemical analysis comparing the specificity of various SNAP25.sub.197-specific antibodies in sections of rat glabrous skin (FIGS. 7A-7J) and rat bladder (FIGS. 7K-7T) following treatment with either BOTOX or vehicle. (A-J) Confocal images of rat skin injected with BOTOX and probed with (A) an older generated lot (May 2, 2011) of the humanized Ab632-rMAb, (B) a more recent lot of humanized Ab632-rMAb, (C) a recent lot of the murine Ab635-rMAb, (D) the Ab507 mAb (clone 2E2A6 used for the Cell-Based Assay in 18383-CIP), and (E) the original non-recombinant 3C1A5 mAb purified from ascites. (F-J) Confocal images of control rat skin injected with vehicle and probed with the same five antibodies. Arrows (A, B, C) point to specific immunoreactive-signal within nerve fibers surrounding blood vessels. (K-T) Confocal images of bladder smooth muscle (SM) injected with BOTOX and probed with (K) an older generated lot (May 2, 2011) of the humanized Ab632-rMAb, (L) a more recent lot of humanized Ab632-rMAb, (M) a recent lot of the murine Ab635-rMAb, (N) the Ab507 mAb (clone 2E2A6 used for the Cell-Based Assay in 18383-CIP), and (O) the original non-recombinant 3C1A5 mAb purified from ascites. (P-T) Confocal images of control rat bladder injected with vehicle and probed with the same five antibodies. Arrows (K, L, M and O) point to specific immunoreactive-signal in nerve fibers within the bladder smooth muscle. BV, blood vessel; CT, connective tissue; SM, detrusor muscle. Scale bar=50 m.

    [0019] FIG. 9 (A-H) shows immunohistochemical comparison of the commercially-available (MC-6053) mAb against SNAP25.sub.197 vs. Ab635-rMAb in sections of human back skin following treatment with either onabotulinumtoxinA (10U) or vehicle. Confocal images of blood vessels in onabotulinumtoxinA (A, B) and vehicle-treated (E, F) human skin probed with either (A, E) the MC-6053 mAb or (B, F) Ab635-rMAb. Sweat glands in onabotulinumtoxinA (C, D) and vehicle-treated (G, H) human skin probed with either (C, G) the MC-6053 mAb or (D, H) Ab635-rMAb. Arrows point to IR-signal within nerve fibers from vehicle treated human skin. BV, blood vessel; CT, connective tissue; SG, sweat gland; Scale bar=50 m.

    [0020] FIG. 10 (A-F) shows confocal images of BoNT/A (3 nM)- or vehicle-treated dorsal root ganglia (DRG) cultures probed with antibodies to different forms of SNAP25. (A-C) DRG cultures exposed to BoNT/A for 3 hr and later stained with (A) commercial (SMI-81R) mAb against full-length (206) and cleaved (197) SNAP25, (B) commercial (MC-6053) mAb against SNAP25.sub.197 and (C) Ab632-rMAb against SNAP25.sub.197. (D-F) Control DRG cultures exposed to vehicle and probed with the same three antibodies. Arrowhead in E points to a neuronal soma exhibiting background labeling.

    DETAILED DESCRIPTION OF THE INVENTION

    I. Definitions

    [0021] Unless defined otherwise, all technical and scientific terms used herein have the meaning commonly understood by a person skilled in the art to which this invention belongs. As used herein, the following terms have the meanings ascribed to them unless specified otherwise.

    [0022] BoNT/A refers to botulinum toxin serotype A produced by Clostridium botulinum.

    [0023] Onabotulinumtoxin A refers to the trade name of BOTOX, which is an FDA-approved formulation of the 900 kDa botulinum neurotoxin serotype A complex.

    [0024] An epitope that specifically binds or preferentially binds (used interchangeably herein) to an antibody or a polypeptide is a term that is well understood in the art, and methods to determine such specific or preferential binding are also well known in the art. A molecule is said to exhibit specific binding or preferential binding if it reacts or associates more frequently, more rapidly, with greater duration and with greater affinity with a particular cell or substance than it does with alternative cells or substances. An antibody specific binding or preferential binding to a target if it binds with greater affinity, avidity, more readily, more exclusively and/or with greater duration than it binds to other substances. It is understood by reading this definition that, for an example, an antibody (or moiety or epitope) that specifically or preferentially binds to a first target may or may not specifically or preferentially bind to a second target. As such, specific binding or preferential binding does not necessarily require (although it can include) exclusive binding. Generally, but not necessarily, reference to binding herein means preferential binding.

    [0025] SNAP25.sub.197 as used herein refers to the 197 amino acid fragment of synaptosomal-associated protein, 25 kDa (SNAP25) that is produced when full-length SNAP25 protein is cleaved by botulinum toxin serotype A or a recombinant botulinum toxin with enzymatic (light chain) activity of botulinum toxin serotype A.

    [0026] SNAP25.sub.206 as used herein refers to the full length SNAP25 protein containing 206 amino acids.

    [0027] It is to be understood that this invention is not limited to particularly exemplified antibodies, formulations, or methods of using such antibodies, which as such, may vary. It is also to be understood that the technical terminology used herein is for the purpose of describing particular embodiments of the invention only, and is not intended to be limiting.

    II. Antibodies that Bind to SNAP25.SUB.197

    [0028] BoNT/A molecular targets, including synaptic vesicle glycoprotein 2C (SV2C), fibroblast growth factor receptor 3 (FGFR3) and SNAP25.sub.206, are broadly expressed and co-localized in autonomic and sensory nerve fibers throughout the body, including rat and primate urinary bladder and glabrous skin. Consequently, the nerve endings are likely equally susceptible to the inhibitory effects of BoNT/A. Although antibodies exist against various molecular targets of BoNT/A, there has not been an optimal antibody identified that is useful for detecting cleaved (i.e., BoNT/A activity) SNAP25 (e.g., SNAP25.sub.197 fragment) in both Western blotting technique and also in tissue samples (e.g., using immunofluorescence).

    [0029] Aspects of the present disclosure comprise, in part, an anti-SNAP25 antibody that is specific for the BoNT/A SNAP25 cleavage product that can be used in ELISA assays, Western blot applications, in cell culture assays and in tissue samples to detect BoNT/A activity. Another aspect of the present invention is an anti-SNAP25 antibody with an epitope to the carboxy terminus of the SNAP25.sub.197 fragment that does not substantially bind to full length SNAP25 (SNAP25.sub.206).

    [0030] Methods for making antibodies (monoclonal or polyclonal) are known in the art. One method which may be employed is the method of Kohler and Milstein, Nature 256:495-497 (1975) or a modification thereof. Typically, monoclonal antibodies are developed in non-human species such as mice. In general, a mouse or rat is used for immunization but other animals may also be used. Also, once an antibody is identified to have the binding characteristics that are desired, the antigen-binding site including their complementarity determining regions (CDRs) can be fused to the constant domains or supporting framework region of antibodies of other species including human. In some instances, producing these recombinant monoclonal antibodies can minimize unwanted immunological response in patients or host animals that these antibodies are injected into. In other instances, producing these recombinant monoclonal antibodies can expand the utility of a specific antibody with certain binding characteristics for diagnostic or use for detecting BoNT/A activity in tissues of different species of animals. In some instances, recombinant monoclonal antibodies may have an advantage of minimal off target signal because of the selectively of not only the CDR, but also due to the recombinant IgG backbone, which can be very different than the endogenous IgG of the tissue of interest.

    [0031] Anti-SNAP25.sub.197 antibodies were generated and described in US Patent Publication No. US2012/0225436A1, hereby incorporated by reference. The CDRs of one of these monoclonal antibodies, selected for its superior performance in immunohistochemical (IHC) assays, were sequenced and recombinantly engineered into immunoglobulin backbones from either human (IgG1) or murine (IgG2A) origin. These antibodies were further characterized along with commercially available antibodies for their specificity to cleaved SNAP25 (SNAP25.sub.197) in both Western blot assays and for use in tissue samples (either rat tissue or human tissue) using immunofluorescence. Table 1 below includes a list of anti-SNAP25 that were used in this comparison.

    TABLE-US-00001 TABLE 1 List of anti-SNAP25 antibodies Anti- IgG- SNAP25.sub.197 body Specificity Vendor Species/Type isotype antigen SMI-81R SNAP25.sub.206/197 Covance, Murine/mAb IgG1 Uncleaved Princeton, SNAP25 NJ MC-6050 SNAP25.sub.206/197 R&D Abs, Murine/mAb n/a 15-mer, LV, NV C.sub.OOH-term MC-6053 SNAP25.sub.197 R&D Abs, Murine/mAb n/a 15-mer, LV, NV C.sub.OOH-term Ab507 SNAP25.sub.197 Allergan Murine/mAb n/a 12-mer, C.sub.OOH-term Ab632 SNAP25.sub.197 Allergan rHuman/rMAb IgG1 12-mer, C.sub.OOH-term Ab635 SNAP25.sub.197 Allergan rMurine/rMAb IgG2A 12-mer, C.sub.OOH-term RGT- SNAP25.sub.197 Allergan Rabbit/pAb IgG 7-mer, 1092 C.sub.OOH-term n/a = not available; mAb = mouse monoclonal antibody; rMAb = recombinant monoclonal antibody; pAb = rabbit polyclonal antibody

    III. Characterization of Anti-SNAP25.SUB.197 .Antibodies

    [0032] Several methods can be used to characterize anti-SNAP25 antibodies. One method is to identify the epitope to which it binds. Epitope mapping is commercially available from various sources, for example, Pepscan Systems (Edelhertweg 15, 8219 PH Lelystad, The Netherlands). Epitope mapping can be used to determine the sequence to which an anti-SNAP25 antibody binds. The epitope can be a linear epitope, i.e., contained in a single stretch of amino acids, or a conformational epitope formed by a three-dimensional interaction of amino acids that may not necessarily be contained in a single stretch. Peptides of varying lengths (e.g., at least 4-6 amino acids long) can be isolated or synthesized (e.g., recombinantly) and used for binding assays with anti-SNAP25 antibodies. The epitope to which anti-SNAP25 antibody binds can be determined in a systematic screening by using overlapping peptides derived from the extracellular sequence and determining binding by an anti-SNAP25 antibody.

    [0033] Another method that can be used to characterize an anti-SNAP25 antibody is to use competition assays with other antibodies that bind to the same antigen or even the same epitope on the same antigen. Competition assays are well known to those skilled in the art.

    [0034] Another method of characterizing anti-SNAP25 antibodies is by the antigen to which it binds. Anti-SNAP25 antibodies can be used in Western blots. Specifically, in some embodiments, anti-SNAP25 antibodies were used in Western blot assays to determine its specificity to BoNT/A cleaved SNAP25 (SNAP25.sub.197). Anti-SNAP25 antibodies that preferentially bind to SNAP25.sub.197 and not full-length (i.e., uncleaved) SNAP25 in Western blot assays are preferred embodiments of the present disclosure. Characterization of anti-SNAP25 antibodies in Western blot assays are detailed in the Examples below.

    IV. Methods of Diagnosing BoNT/A Activity in Tissue Samples

    [0035] Antibodies that binds to BoNT/A cleaved SNAP25 (SNAP25.sub.197) may be used to identify the presence or absence of BoNT/A activity in a variety of tissues. Such tissues may include skin, including but not limited to, glabrous or hairy, muscle, including but not limited to skeletal muscle and smooth muscle, bladder, glandular tissues, including but not limited to prostate, lacrimal gland, endocrine glands, and exocrine glands, blood vessels, spinal cord and brain, including nerve fibers within any and all of these tissues. Such tissues may be procured as part of a biopsy or skin punch.

    [0036] An antibody that is suitable for use to detect BoNT/A activity in tissues would need to (1) be specific to binding to SNAP25.sub.197 and not to full-length or uncleaved SNAP 25 (SNAP25.sub.206); and (2) be able to detect SNAP25.sub.197 preferentially (and not full-length or uncleaved SNAP25) in tissue samples. Another characteristic that would be desirable is that the antibody would preferentially bind to BoNT/A cleaved SNAP25 (SNAP25.sub.197) in tissue samples without substantially binding to non-specific antigens (i.e., low or no background, non-specific binding).

    [0037] Determining the absence or presence of BoNT/A, or BoNT/A-like compound activity in a particular tissue sample may be important for a variety of clinical and non-clinical diagnostic purposes including, but not limited to: 1) understanding the mechanism of action for BoNT/A in a particular tissue or clinical indication; 2) assessment of BoNT/A activity and/or spread beyond the site of injection; 3) assessment of suspected immunity to BoNT/A; 4) assessment and understanding of local diffusion of BoNT/A (e.g., from an injected muscle to a neighboring muscle or tissue); 5) assessment of potential exposure to BoNT/A in the setting of human botulism performed by biopsy; and 6) clinical pharmacological studies.

    [0038] In one embodiment, the use can involve the formation of a complex between SNAP25.sub.197 and an antibody that specifically binds to SNAP25.sub.197. In one embodiment of the diagnostic methods of this invention, the anti-SNAP25.sub.197 antibody can bear a detectable label. Examples of labels may be used include a radioactive agent, a fluorophore, chemical label, a biological agent such as but not limited to, biotin/streptavidin detection, or an enzymatic substrate label. In other embodiments, a secondary antibody of another species that can bear a detectable label can be used to detect the anti-SNAP25.sub.197 antibody. The use of a secondary antibody may in some cases, boost the signal of the primary anti-SNAP25.sub.197 antibody, thereby detecting low/lower levels of BoNT/A activity in tissue samples.

    V. Compositions of this Invention

    [0039] This invention also encompasses compositions comprising an anti-SNAP25.sub.197 antibody that can preferentially detect BoNT/A cleaved SNAP25 without detecting uncleaved SNAP25 (SNAP25.sub.206) in ELISA, Western blot assays and in tissue samples. In some embodiments, the anti-SNAP25.sub.197 antibody is a recombinant monoclonal antibody where the CDR has been fused with the supporting framework of an antibody of a different species. In other embodiments, the anti-SNAP25.sub.197 antibody is a recombinant monoclonal antibody where the CDR has been fused with the supporting framework of an antibody of the same species. In some embodiments, the anti-SNAP25.sub.197 antibody is a recombinant monoclonal antibody where the CDR has been fused with the supporting framework of a human antibody. In some embodiments, the anti-SNAP25.sub.197 antibody is a recombinant monoclonal antibody where the CDR has been fused with the supporting framework of a mouse antibody.

    [0040] It was found that one antibody, 3C1A5, that has been previously preliminarily described in US2012/0225436 was especially useful in the present invention because of its inherent ability to detect SNAP25.sub.197 in BoNT/A-treated tissues. It was known that 3C1A5 preferentially bound to SNAP25.sub.197 in an immuno-based (e.g., ELISA) assay and/or in a cell-based assay. FIG. 1 shows a depiction of the putative epitope binding site of the 3C1A5 antibody on SNAP25.sub.197. As described in detail in the Examples, this antibody (and its recombinant human and murine versions) also preferentially detected (or bind to) BoNT/A cleaved SNAP25 (SNAP25.sub.197) in Western blot assays. Surprisingly, this antibody (and its recombinant human and murine versions) also was able to preferentially detect (or bind to) BoNT/A cleaved SNAP25 (SNAP25.sub.197) in rat and human tissue samples. Although there exists reports of anti-cleaved SNAP25 antibodies being able to preferentially detect (or bind to) SNAP25.sub.197 in Western blot assays and in tissue sample, as shown in detail in the Examples, 3C1A5 (or its recombinant human and murine versions) was the only antibody that consistently detected SNAP25.sub.197 in all assays and on different tissues and did not exhibit non-specific binding to other epitopes.

    [0041] In some cases, the antibody of the present invention is 3C1A5. In other cases, the antibody of the present invention is a recombinant antibody comprising the antigen binding site of 3C1A5, but has been fused with the framework regions of another antibody from the same or different species.

    [0042] In one embodiment, the light chain/heavy chain of the anti-SNAP25.sub.197 antibody comprises one or more of the sequences listed below in Table 2.

    TABLE-US-00002 TABLE2 Ab635and632AntibodySequence Murine-3C1A5(Ab635)Sequence-(pOptiVec/pcDNA3) LightChainMurine3C1A5(Ab635) SEQIDNO:1 DVVMTQTPLTLSVTIGQPASISCKSSQSLLNTNGKTYLTWLIQRPGQSPQ RLIYLVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCLQSSHFP FTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDIN VKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCE ATHKTSTSPIVKSFNRNEC LightChainVariableDomainMurine3C1A5(Ab635) SEQIDNO:2 DVVMTQTPLTLSVTIGQPASISCKSSQSLLNTNGKTYLTWLIQRPGQSPQ RLIYLVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCLQSSHFP FTFGSGTKLEIK HeavyChainMurine3C1A5(Ab635) SEQIDNO:3 QVKLQESGAELVKPGASVKISCKASGYTFTDHSIHWVKQKPGQGLEWIGY LFPGNGNFEYNEKFKGKATLTADKSSSTVYMYLNSLTSEDSAVYFCKRMG YWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVT VTWNSGSLSSGVHTFPAVLESDLYTLSSSVTVPSSPRPSETVTCNVAHPA SSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTC VVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQ DWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKD KVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLN VQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK HeavyChainVariableDomainMurine3C1A5(Ab635) SEQIDNO:4 QVKLQESGAELVKPGASVKISCKASGYTFTDHSIHWVKQKPGQGLEWIGY LFPGNGNFEYNEKFKGKATLTADKSSSTVYMYLNSLTSEDSAVYFCKRMG YWGQGTTVTVSS Human-3C1A5(Ab632)Sequence-(pOptiVec/pcDNA3) LightChainHuman3C1A5(Ab632) SEQIDNO:5 DVVMTQTPLTLSVTIGQPASISCKSSQSLLNTNGKTYLTWLIQRPGQSPQ RLIYLVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCLQSSHFP FTFGSGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGEC LightChainVariableDomainHuman3C1A5(Ab632) SEQIDNO:6 DVVMTQTPLTLSVTIGQPASISCKSSQSLLNTNGKTYLTWLIQRPGQSPQ RLIYLVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCLQSSHFP FTFGSGTKLEIK HeavyChainHuman3C1A5(Ab632) SEQIDNO:7 QVKLQESGAELVKPGASVKISCKASGYTFTDHSIHWVKQKPGQGLEWIGY LFPGNGNFEYNEKFKGKATLTADKSSSTVYMYLNSLTSEDSAVYFCKRMG YWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVT VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHK PSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK HeavyChainVariableDomainHuman3C1A5(Ab632) SEQIDNO:8 QVKLQESGAELVKPGASVKISCKASGYTFTDHSIHWVKQKPGQGLEWIGY LFPGNGNFEYNEKFKGKATLTADKSSSTVYMYLNSLTSEDSAVYFCKRMG YWGQGTTVTVSS

    [0043] In some cases, the antibodies of the invention comprises a light chain sequence of SEQID NO:1 or SE ID NO:2 and is a recombinant murine antibody. In other cases, the antibodies of the invention comprises a heavy chain sequence of SEQID NO:3 or SEQID NO:4 and is a recombinant murine antibody. In other cases, the antibodies of the invention comprises a light chain sequence of SEQID NO: 5 or SEQID NO: 6 and is a recombinant human antibody. In other cases, the antibodies of the invention comprises a heavy chain sequence of SEQID NO:7 or SEQID NO:8 and is a recombinant human antibody.

    [0044] Still in other embodiments the antibodies of the invention can be an antibody that binds to the same epitope of an antibody with a heavy chain and/or light chain comprising one or more sequences of SEQID NOs:1-8. In some cases, the antibodies of the invention can be an antibody that will compete for binding to the same epitope of an antibody with a heavy chain and/or light chain comprising one or more sequences of SEQID NOs:1-8.

    [0045] The following Examples are provided to illustrate, but not to limit the invention.

    IV. EXAMPLES

    Example 1. Western Blot Comparison

    [0046] SNAP25 antibodies (listed in Table 1) were first compared by Western blot analysis in their ability to recognize the full-length (206) or BoNT/A-cleaved (197) forms of SNAP25 from rat embryonic cortical cell lysates and in SiMa cell lysates treated with and without BoNT/A. (See FIGS. 2 and 3).

    [0047] Rat cortical neurons were harvested from embryonic pups (E18) and digested in a papain dissociation system (Worthington Biochemical Corp., Lakewood, N.J.) at 37 C. for 15 minutes to obtain individual cells. Cortical cells were then transferred to Neurobasal medium (Life Technologies, Carlsbad, Calif.) containing B-27 supplements, 0.5 mM L-glutamine and penicillin/streptomycin. Rat dorsal root ganglia (DRG) harvested from neonatal pups (P7-P14) were pooled and digested in papain-containing HBSS (final concentration of 20 units of papain per ml in 1 mM L-cysteine) at 37 C. for 15 minutes. Ganglia were washed and subsequently digested in Ca2+/Mg2+-free HBSS containing Type 1 collagenase (1.7 mg/ml, Sigma, St Louis, Mo.) and incubated at 37 C. for an additional 15 minutes. The ganglia were then washed in Neurobasal-A media (Life Technologies, Carlsbad, Calif.) containing B-27 supplements, 0.5 mM L-glutamine, penicillin/streptomycin and 20 ng/ml 2.5S nerve growth factor (NGF) and gently triturated through Pasteur pipettes. Cortical and DRG cells were homogenously dispersed, plated onto poly-D-lysine/laminin-coated 12-mm coverslips (BD Biosciences, San Jose, Calif.) placed in 100-mm culture dishes and grown for 6 to 7-DIV prior to treatment. All animal protocols and procedures were approved by the Allergan Institutional Animal Care and Use Committee and performed in accordance with NIH guidelines.

    [0048] On select days, cultures were treated with or without 3 nM BoNT/A (150 kDa; Metabiologics, Madison, Wis.) for 3 hr at 37 C. Following treatment, cells were rinsed with and then incubated in fresh culture medium overnight. Cortical cells were then washed with PBS, lysed in freshly prepared Lysis Buffer (20 mM Tris pH 7.5, 0.15 M sodium chloride, 1 nM EDTA, 1 mM EGTA, 10% Triton X-100 and one tablet of EDTA-free protease inhibitors) for 20 min on ice and then centrifuged at 4000 rpm for 20 min to eliminate debris prior to Western blot (WB) analysis. DRG cells were washed, fixed with 4% paraformaldehyde for 10-15 min and processed for immunocytochemistry according to the protocol below.

    [0049] SiMa cells (DSMZ, Germany) were cultured in BD Biosciences brand Collagen IV flasks (VWR, Radnor, Pa.) with vented caps (Marini, P., MacLeod, R. A., Treuner, C., Bruchelt, G., Bohm, W., Wolburg, H., Schweizer, P., and Girgert, R., 1999. SiMa, a new neuroblastoma cell line combining poor prognostic cytogenetic markers with high adrenergic differentiation. Cancer Genet. Cytogenet. 112, 161-164.). Growth media consisted of RPMI 1640, 0.1 mM Non-Essential Amino-Acids, 10 mM HEPES, 1 mM Sodium Pyruvate, 100 U/mL Penicillin, 100 g/mL Streptomycin, and 10% Fetal Bovine Serum. Cells were treated with or without BoNT/A (0.01 nM) for 24 hrs at 37 C. Following treatment, SiMa cells were washed with PBS, lysed in freshly prepared Lysis Buffer for 20 min on ice and then centrifuged at 4000 rpm for 20 min to eliminate debris prior to WB analysis.

    [0050] For WB assays, we employed rat embryonic cortical neurons as well as a human neuroblastoma cell line (SiMa), which is known for its sensitivity to BoNT/A-mediated SNAP25 cleavage (Fernandez-Salas, E., Wang, J., Molina, Y., Nelson, J. B., Jacky, B. P., and Aoki, K. R., 2012. Botulinum neurotoxin serotype A specific cell-based potency assay to replace the mouse bioassay. PLoS. One. 7, e49516.). Total cell lysates from these cultures were separated by electrophoresis (Biorad TGX Any Kd gel) and the gel was transferred onto a PVDF membrane. Blots were blocked in buffer (5% dry milk in 1TBS-0.1% Tween-20) for 1 hr at room temperature and then incubated overnight at 4 C. with primary antibodies in blocking buffer. Following washes, blots were incubated with HRP-conjugated secondary antibodies (Bio Rad, Hercules, Calif.) and developed by ECL Plus (GE Healthcare, Pittsburgh, Pa.). A separate control blot was probed for glyceraldehyde 3-phosphate dehydrogenase (GAPDH) to show equal loading of cell lysate samples. Western blots were scanned using a variable mode GE Typhoon 9410 imager and analyzed with ImageQuant TL v. 2005 software (GE Healthcare, Pittsburgh, Pa.).

    [0051] First a commercially available and widely-used monoclonal antibody (SMI-81R) directed against all forms of the SNAP25 protein recognized both SNAP25.sub.206 and SNAP25.sub.197 (FIG. 2A). In contrast, a second commercially available monoclonal antibody (MC-6050) described as recognizing both forms of SNAP25 was surprisingly specific for SNAP25.sub.197 in lysates from toxin-treated cells (FIG. 2B). Furthermore, another antibody from the same company (MC-6053), described as recognizing only BoNT/A-cleaved SNAP25 revealed a thin, faint band exclusively in the toxin-treated lane (FIG. 2C).

    [0052] The human (Ab632) and murine (Ab635) rMAbs directed against BoNT/A-cleaved SNAP25 were very specific for SNAP25.sub.197; only a single band was detected in toxin-treated lysates, while no bands were detected in the untreated, control lanes (FIG. 2D, E). Similarly, our in-house rabbit pAb (RGT-1092) against SNAP25.sub.197 only detected a band in the BoNT/A-treated sample, while no bands were detected in the control lane (FIG. 2F). It was noted however, that the pAb recognized two additional faint bands, one just above the SNAP25.sub.197 band and another at 20 kDa present only in toxin-treated samples, which could not be readily explained. Nevertheless, the upper band is not likely to be intact SNAP25, as no band was observed in the untreated lane. Similar WB results were obtained using lysates from BoNT/A-treated and untreated SiMa cell cultures (FIG. 3), except that no band was observed for MC-6053 in either control or toxin-treated lanes (FIG. 3C). Control blots probed for GAPDH showed equal loading of all samples for both cortical and SiMa cell lysate experiments (FIG. 4A, B).

    [0053] A separate WB analysis was performed to examine the epitope specificity of our rMAbs using BoNT/C- and BoNT/E-treated SiMa cell lysates compared to the BoNT/A-treated lysate. It is well established that BoNT/C cleaves SNAP25 at amino acid (aa) residue 198, while BoNT/E cleaves SNAP25 at aa residue 180 [11]. While the SMI-81R mAb recognized both full length and BoNT-cleaved forms of SNAP25 (FIG. 4C), our human rMAb only detected a single band in the BoNT/A-treated lysate sample, as expected (FIG. 4D).

    [0054] FIG. 2 shows WB analysis comparing the specificity of antibodies against SNAP25 using rat embryonic cortical neuronal cell lysates treated with (L3) or without (L2) BoNT/A. (A) Blot probed with a commercially available anti-SNAP25 mAb (SMI-81R) that recognizes both the full-length (206) and cleaved (197) forms of SNAP25. In lane 2, only SNAP25206 is detected, whereas in lane 3, both SNAP25206 (arrow) and SNAP25197 (arrowhead) are detected. (B) Blot probed with a commercially available anti-SNAP25 mAb (MC-6050) that reportedly recognizes both SNAP25206 and SNAP25197. Only SNAP25197 appears as a single band in lane 3 (arrowhead). (C) Blot probed with a commercially available anti-SNAP25 mAb (MC-6053) that is reportedly specific for SNAP25197. This antibody recognizes a thin, faint SNAP25197 band in lane 3. (D) Blot probed with Ab632 anti-SNAP25197 rMAb. In lane 2, no band is detected, whereas in lane 3, a single band for SNAP25197 is detected (arrowhead). (E) Blot probed with Ab635 anti-SNAP25197 rMAb. In lane 2, no band is detected, whereas in lane 3, a single band for SNAP25197 is detected (arrowhead). (F) Blot probed with RGT-1092 anti-SNAP25197 pAb. This antibody primarily recognizes SNAP25197 in lane 3 (arrowhead), although two faint bands are visible just above and below the SNAP25197 band. Lane 1, protein ladder; Lane 2, untreated cortical cell lysate; Lane 3, BoNT/A-treated (3 nM) cortical cell lysate.

    [0055] FIG. 3 shows WB analysis comparing the specificity of antibodies against SNAP25 using SiMa cell lysates treated with (L3) or without (L2) BoNT/A. (A) Blot probed with a commercially available anti-SNAP25 mAb (SMI-81R) that recognizes both the full-length (206) and cleaved (197) forms of SNAP25. In lane 2, only SNAP25206 is detected, whereas in lane 3, both SNAP25206 (arrow) and SNAP25197 (arrowhead) are detected. (B) Blot probed with a commercially available anti-SNAP25 mAb (MC-6050) that reportedly recognizes both SNAP25206 and SNAP25197. Only SNAP25197 appears as a single band in lane 3 (arrowhead). (C) Blot probed with a commercially available anti-SNAP25 mAb (MC-6053) that is reportedly specific for SNAP25197. The antibody does not appear to recognize any bands. (D) Blot probed with Ab632 anti-SNAP25197 rMAb. In lane 2, no band is detected, whereas in lane 3, a single band for SNAP25197 is detected (arrowhead). (E) Blot probed with Ab635 anti-SNAP25197 rMAb. In lane 2, no band is detected, whereas in lane 3, a single band for SNAP25197 is detected (arrowhead). (F) Blot probed with RGT-1092 anti-SNAP25197 pAb. This antibody primarily recognizes SNAP25197 in lane 3 (arrowhead), although two faint bands are visible just above and below the SNAP25197 band. Lane 1, protein ladder; Lane 2, untreated SiMa cell lysate; Lane 3, BoNT/A-treated (0.01 nM) SiMa cell lysate.

    [0056] FIG. 4(A, B) shows control blots for the cortical cell studies in FIG. 2 and SiMa cell studies in FIG. 3 probed with anti-GAPDH mAb showing equal loading of samples in lanes 2 and 3. Lane 1, protein ladder; Lane 2, untreated cell lysate; Lane 3, BoNT/A-treated (3 nM) cortical cell lysate and (0.01 nM) SiMa cell lysate. FIG. 4(C, D) shows Western Blot analysis demonstrating the epitope specificity of Ab632-rMAb using SiMa cell lysates treated with BoNT/A (L.sub.3), BoNT/C (L.sub.4), BoNT/E (L.sub.5) or with no toxin (L.sub.2). (C) Blot probed with a commercially available anti-SNAP25 mAb (SMI-81R) that recognizes both the full-length (206) and cleaved (197 for BoNT/A, 198 for BoNT/C and 180 for BoNT/E) forms of SNAP25. In lane 2, only SNAP25.sub.206 is detected, whereas in lane 3, both SNAP25.sub.206 (arrow) and SNAP25.sub.197 are detected. In lane 4, both SNAP25.sub.206 (arrow) and SNAP25.sub.198 are detected and in lane 5, both SNAP25.sub.206 (arrow) and SNAP25.sub.180 are detected; (D) Blot probed with Ab632 anti-SNAP25.sub.197 rMAb. In lane 2, 4 and 5, no band is detected, whereas in lane 3, a single band for SNAP25.sub.197 is detected. Lane 1, protein ladder; Lane 2, untreated SiMa cell lysate; Lane 3, BoNT/A-treated SiMa cell lysate; Lane 4, BoNT/C-treated SiMa cell lysate; Lane 5, BoNT/E-treated SiMa cell lysate.

    Example 2. Immunohistochemical ComparisonRat Tissue

    [0057] The specificity of the antibodies was then tested using immunohistochemistry (IHC) in rat bladder and glabrous skin that had been treated with either onabotulinumtoxinA or saline and then harvested 2-days post-injection. Throughout these IHC studies, adjacent sections processed without primary antibodies showed only background staining (data not shown).

    [0058] Male Sprague-Dawley rats (Charles River Laboratories, Wilmington, Mass.) were used for this study. Rats were pair-housed in the RD3 vivarium with free access to food and water on a 12 hour light-dark cycle. All procedures were approved by the Allergan Institutional Animal Care and Use Committee and adhered to NIH guidelines.

    [0059] Working solutions of onabotulinumtoxinA (BOTOX, Allergan, Inc., Irvine, Calif.) and BoNT/A (150 kDa; Metabiologics, Madison, Wis.) were prepared in either 0.9% saline or 0.5% BSA/0.9% saline, respectively. For bladder injections, rats were first anesthetized and prepped for surgery. A lower midline abdominal incision was made, exposing the urinary bladder, seminal vesicles, and prostate gland. The urinary bladder wall was then injected at four equidistant sites along the midline circumference with 10 l of onabotulinumtoxinA (2.5 U/kg) yielding a final toxin load of 10 U/kg. Control animals received 10 l injections of vehicle (0.9% saline) into comparable target sites. For glabrous skin injections, onabotulinumtoxinA (30 U/kg) or vehicle was administered as a single intradermal (ID) injection (25 l) into the center of the right hindlimb paw between the footpads.

    [0060] Rats were sacrificed at 2-days post-injection and bladders or the central portion of the planter surface of the hindpaws were harvested and fixed overnight at 4 C. in Zamboni's fixative (American MasterTech, Lodi, Calif.). Tissues were washed and cryoprotected in 30% sucrose/PBS solution overnight at 4 C. Bladder and skin samples were hemisected along the midline, embedded in O.C.T. (Tissue-Tek) and stored frozen at 80 C. until sectioning. Tissue blocks were cryostat-sectioned (14 m-thick), slide-mounted and slides were kept at 20 C. until use.

    [0061] Slide-mounted tissue sections and cell culture coverslips were first blocked for non-specific signal in blocking buffer (1PBS+0.1% Triton X-100+10% Normal Donkey Serum) and then incubated with primary antibodies at the desired concentrations in blocking buffer overnight at 4 C. Following several washes, sections and coverslips were incubated with secondary antibodies (Jackson ImmunoResearch, West Grove, Pa.) diluted in blocking buffer for 2 hr at 4 C. and then washed again. Coverslips with cultures were inverted and mounted onto microscope slides using Fluoromount-G (EM Sciences, Hatfield, Pa.) containing 1.5 g/ml DAPI. Slide-mounted sections were coversliped using the same mounting media. Adjacent sections processed without primary antibodies served as negative controls to show background signal. Alternate sections were stained with hematoxylin & eosin for better anatomical identification.

    [0062] Images were captured and analyzed using either a Zeiss LSM-710 confocal microscope with ZEN software (Carl Zeiss, Thornwood, N.Y.) or an Olympus FV1000 confocal microscope (Olympus, Center Valley, Pa.). Imaris (Bitplane, South Windsor, Conn.) software was utilized for qualitative analysis of nerve fibers. Nerve fiber-types were identified on the basis of their morphology and neurochemistry.

    [0063] In the rat bladder, the SMI-81R antibody directed against SNAP25 showed IR-signal in nerve fibers throughout the detrusor muscle. The SNAP25-IR pattern was identical in both onabotulinumtoxinA and saline-treated bladders, as expected (FIG. 5A, F). The MC-6050 monoclonal antibody, which is reported to recognize both intact and BoNT/A-cleaved forms of SNAP25, demonstrated IR-signal in nerve fibers from the detrusor muscle of toxin-treated, but not saline-treated bladder (FIG. 5B, G), comparable to the results from the Western Blot analysis. Likewise, the MC-6053 monoclonal antibody demonstrated IR-signal only in toxin-treated, but not saline-treated bladder (FIG. 5C, H). In contrast with the specificity detected in the WB analysis, RGT-1092 pAb generated against SNAP25.sub.197 demonstrated IR-signal in both toxin-treated and saline-treated bladders (FIG. 5E, J). Most importantly, Ab632-rMAb showed clear IR-signal in nerve fibers from the detrusor muscle of toxin-treated bladders (FIG. 5D), while no signal was detected in saline-treated control bladders (FIG. 51). Moreover, in separate studies, Ab635-rMAb showed similar specificity as Ab632-rMAb to SNAP25.sub.197 in rat bladder (FIG. 8M, R)).

    [0064] In the rat glabrous skin, the SMI-81R antibody exhibited IR-signal in nerve fibers surrounding blood vessels (among other skin regions). As expected for this antibody, the SNAP25-IR pattern was identical in both onabotulinumtoxinA and saline-treated skin (FIG. 6A, F). The MC-6050 monoclonal antibody demonstrated IR-signal primarily in nerve fibers from toxin-treated skin. However, slight IR-signal was also evident in nerve fibers from saline-treated skin (FIG. 6B, G). The MC-6050 antibody also showed strong IR-signal in the lumen of blood vessels (FIG. 6B, G). But as this particular IR-signal was never demonstrated by other SNAP25 antibodies, it was determined to be non-specific. Similarly, the MC-6053 monoclonal antibody showed IR-specific signal in nerve fibers surrounding blood vessels from both toxin and saline-treated skin, as well as non-specific signal in the lumen of blood vessels (FIG. 6C, H). Once again, RGT-1092 pAb generated against SNAP25.sub.197 demonstrated IR-signal in both toxin-treated and saline-treated rat skin (FIG. 6E, J), suggesting that despite its specificity in WB analysis, this antibody is not amenable for IHC. In clear contrast, Ab632-rMAb exhibited IR-signal in nerve fibers only in toxin-treated, but not in saline-treated skin (FIG. 6D, I) supporting its superb specificity.

    [0065] Our samples of rat glabrous skin often contain underlying skeletal muscle, providing an excellent opportunity to validate our rMAbs on their ability to recognize BoNT/A-cleaved SNAP25 within motor nerve terminals (MNT). Similar results for antibody specificity were observed in MNTs as in other skin nerve fiber-types (FIG. 7). While the SMI-81R mAb recognized both full length and BoNT/A-cleaved forms of SNAP25 in MNTs and axons, the commercial mAbs, MC-6050 and MC-6053 demonstrated IR-signal primarily in nerve fibers from toxin-treated skin. However, non-specific IR-signal was also observed in saline-treated tissue for these commercial mAbs (FIG. 7F,G). In contrast, Ab632-rMAb exhibited IR-signal in MNTs and axons only in toxin-treated, but not in saline-treated skin (FIG. 7D,H).

    [0066] To further exemplify the Ab632-rMAb's superior specificity for SNAP25.sub.197 in tissues, we compared the immuno-reactive signal of Ab632 and Ab635 to an initial batch lot of the human rMAb (May 2, 2011), the original, native 3C1A5 mAb purified from ascites and the 2E2A6 (Ab507) mAb used for Allergan's cell-based potency assay for BOTOX (Fernandez-Salas, E., Wang, J., Molina, Y., Nelson, J. B., Jacky, B. P., and Aoki, K. R., 2012. Botulinum neurotoxin serotype A specific cell-based potency assay to replace the mouse bioassay. PLoS. One. 7, e49516.). The IR signal for these antibodies was compared in rat glabrous skin and bladder tissues following treatment with onabotulinumtoxin A.

    [0067] In rat glabrous skin, both Ab632 and Ab635 showed strong IR-signal for SNAP25.sub.197 in nerve fibers surrounding blood vessels (FIG. 8B, C) and other areas (data not shown) following BOTOX treatment, but this IR-signal was absent in nerve fibers from vehicle-treated controls (FIG. 8G, H). Similarly, an older and less refined batch lot of the human rMAb showed good IR-signal in skin nerve fibers following toxin treatment (FIG. 8A), but not in saline-treated controls (FIG. 8F). In contrast, no specific IR-signal for SNAP25.sub.197 was detected in toxin-treated skin nerve fibers using either the native 3C1A5 mAb or the Ab507 mAb (FIG. 8D, E).

    [0068] Comparable results were demonstrated in the rat bladder following BOTOX treatment. All three rMAbs (Ab632, Ab635 and the older human batch lot) showed specific IR-signal for SNAP25.sub.197 in nerve fibers throughout the detrusor muscle of the bladder (FIG. 8K, L, M). Specific IR-signal was also observed in rat bladder nerve fibers with the native 3C1A5 mAb (FIG. 8O). However, as in the rat glabrous skin, no specific SNAP25.sub.197 IR-signal was detected in toxin-treated bladders using the Ab507 mAb (FIG. 8N), which is used in Allergan's cell-based potency assay for BOTOX. No IR-signal was detected in vehicle-treated control rat bladders with any of the antibodies utilized (FIG. 8P-T).

    [0069] FIG. 5 shows immunohistochemical analysis comparing the specificity of antibodies against SNAP25 in sections of rat bladder following treatment with either onabotulinumtoxinA (10 U/kg) or vehicle. (A-E) Confocal images of bladder detrusor muscle (DM) injected with onabotulinumtoxinA and probed with (A) commercial mAb (SMI-81R) against full-length (206) and cleaved (197) SNAP25, (B) a second commercial mAb (MC-6050) against SNAP25.sub.197 & SNAP25.sub.206, (C) commercial mAb (MC-6053) against SNAP25.sub.197, (D) Ab632-rMAb against SNAP25.sub.197 and (E) RGT-1092 pAb against SNAP25.sub.197. (F-J) Confocal images of control rat bladder injected with vehicle and probed with the same five antibodies. Arrows (F and J) point to IR-signal within nerve fibers from vehicle treated rat bladder. DM, detrusor muscle; Scale bar=50 m.

    [0070] FIG. 6 shows immunohistochemical analysis comparing the specificity of antibodies against SNAP25 in sections of rat glabrous skin following treatment with either onabotulinumtoxinA (30 U/kg) or vehicle. (A-E) Confocal images of rat skin injected with onabotulinumtoxinA and probed with (A) commercial mAb (SMI-81R) against full-length (206) and cleaved (197) SNAP25, (B) a second commercial mAb (MC-6050) against SNAP25.sub.197 & SNAP25.sub.206, (C) commercial mAb (MC-6053) against SNAP25.sub.197, (D) Ab632-rMAb against SNAP25.sub.197 and (E) RGT-1092 pAb against SNAP25.sub.197. (F-J) Confocal images of control rat skin injected with vehicle and probed with the same five antibodies. Arrows (F, G, H and J) point to IR-signal within nerve fibers from vehicle treated rat skin. Asterisks (B, C, G and H) point to non-specific IR-signal within the lumen of blood vessels. BV, blood vessel; CT, connective tissue; Scale bar=50 m.

    [0071] FIG. 7. shows immunohistochemical analysis comparing the specificity of antibodies against SNAP25 in skeletal muscle underlying rat glabrous skin following treatment with either onabotulinumtoxinA (30 U/kg) or vehicle. (A-D) Confocal images showing motor nerve terminals (MNT, arrows) within the underlying muscle of the rat paw injected with onabotulinumtoxinA and probed with (A) commercial mAb (SMI-81R) against full-length (206) and cleaved (197) SNAP25; (B) a second commercial mAb (MC-6050) against SNAP25.sub.197 & SNAP25.sub.206; (C) a commercial mAb (MC-6053) against SNAP25.sub.197 and (D) Ab632-rMAb against SNAP25.sub.197; (E-H) Confocal images from control rat paw injected with vehicle and probed with the same four antibodies. SNAP25-IR signal is in green (shown as gray in black and white drawings) and DIC illumination was used to delineate the underlying muscle fibers (MF). Arrow (E) points to IR-signal within a MNT from vehicle treated rat paw; asterisks (B,C,F and G) point to non-specific IR-signal within the muscle. Scale bar=50 m.

    [0072] FIG. 8 shows immunohistochemical analysis comparing the specificity of SNAP25.sub.197-specific antibodies in sections of rat glabrous skin (A-J) and rat bladder (K-T) following treatment with BOTOX or vehicle. (A-E) Confocal images of rat skin following BOTOX injection show IR-signal for SNAP25.sub.197 in nerve fibers surrounding blood vessels with all the rMAbs (old and new batches, arrow). The 2E2A6 clone (Ab507) and the 3C1A5 ascites antibodies both failed to detect any SNAP25.sub.197 signal in this tissue. (F-J) In vehicle-treated controls, no SNAP25-IR is detected with any of the antibodies. (K-O) SNAP25.sub.197-IR signal is detected in the nerve fibers coursing through the detrusor muscle in rat bladder (arrows) following BOTOX treatment with all the antibodies except the 2E2A6 clone. (P-T) In vehicle-treated controls, no SNAP25.sub.197-IR is detected with any of the antibodies. BV, blood vessel; CT, connective tissue; SM, smooth muscle.

    Example 3. Immunohistochemical ComparisonHuman Tissue

    [0073] Among the commercially available antibodies against SNAP25, the MC-6053 monoclonal antibody targeting SNAP25.sub.197 is most similar to our murine Ab635-rMAb with regard to the type and species of antibody (Table 1). We therefore performed a head-to-head comparison of the SNAP25-IR expression patterns between our Ab635-rMAb and the MC-6053 mAb in biopsy samples of onabotulinumtoxinA and saline-treated human back skin. The presumption was that since this was a probe of human tissue using a mouse antibody, the non-specific IR-signal (regardless of the source) would be minimal.

    [0074] Human skin biopsy samples were obtained through a Phase 1 Allergan clinical study. The study was conducted in accordance with the guidelines and regulations for Good Clinical Practice and all relevant local and country privacy guidelines. The study protocol, informed consent, and all appropriate study-related documents were approved by the Institutional Review Board/Ethics Committee.

    [0075] Adult human back skin was injected ID with either 10 U of onabotulinumtoxinA or vehicle. Punch biopsy samples from back skin were harvested 14-days post-treatment and fixed overnight in the same fixative. Tissues were washed and cryoprotected in 30% sucrose/PBS solution overnight at 4 C. Skin samples were hemisected along the midline, embedded in O.C.T. (Tissue-Tek) and stored frozen at 80 C. until sectioning. Tissue blocks were cryostat-sectioned (14 m-thick), slide-mounted and slides were kept at 20 C. until use. IHC and data analysis was performed as outlined above.

    [0076] In the human back skin, the IR-signal for both antibodies was observed in nerve fibers surrounding blood vessels and sweat glands within the skin (FIG. 9). IR-signal for the MC-6053 mAb was observed in nerve fibers from both onabotulinumtoxinA and saline-treated back skin. In sharp contrast, IR-signal for our murine Ab635-rMAb was only observed in nerve fibers from onabotulinumtoxinA-treated, but not saline-treated human back skin (FIG. 9) demonstrating its superior specificity and more importantly, its utility as a clinical diagnostics tool.

    [0077] FIG. 9 shows immunohistochemical comparison of the commercially-available (MC-6053) mAb against SNAP25.sub.197 vs. Ab635-rMAb in sections of human back skin following treatment with either onabotulinumtoxinA (10U) or vehicle. Confocal images of blood vessels in onabotulinumtoxinA (A, B) and vehicle-treated (E, F) human skin probed with either (A, E) the MC-6053 mAb or (B, F) Ab635-rMAb. Sweat glands in onabotulinumtoxinA (C, D) and vehicle-treated (G, H) human skin probed with either (C, G) the MC-6053 mAb or (D, H) Ab635-rMAb. Arrows point to IR-signal within nerve fibers from vehicle treated human skin. BV, blood vessel; CT, connective tissue; SG, sweat gland; Scale bar=50 m.

    [0078] Given the difficulty in detecting BoNT/A location and movement within cells, the proprietary recombinant humanized -SNAP25.sub.197 and proprietary recombinant murine -SNAP25.sub.197 can be used to cross detect SNAP25.sub.197 in the other species. While other -SNAP25 antibodies are capable of detection, using recombinant murine -SNAP25.sub.197 to detect SNAP25.sub.197 in human tissue or using recombinant humanized -SNAP25.sub.197 to detect SNAP25.sub.197 in murine allows for in-depth analysis of BoNT/A mechanism of action not possible with other available antibodies.

    Example 4. Immunocytochemical Comparison

    [0079] Some antibodies may work better for one assay/indication over another. Therefore, in order to complete our analysis, we compared the IR-signal from several of the antibodies in DRG cell cultures that were treated with either BoNT/A (3 nM) or saline.

    [0080] DRG cell cultures were prepared and treated as outlined above. Immunocytochemistry and data analysis was performed as detailed above.

    [0081] As in the tissues, the the SMI-81R antibody showed strong IR-signal in both BoNT/A and saline-treated cultures (FIG. 10A, D). Both the MC-6053 commercially available mAb and our human Ab632-rMAb demonstrated specific SNAP25.sub.197-IR signal in neuronal cells from BoNT/A-treated cultures (FIG. 10B, C). No signal was detected in saline-treated cultures (FIG. 10E, F). However, the MC-6053 mAb exhibited a faint background signal over the neuronal soma in the saline-treated cultures (FIG. 10E).

    [0082] FIG. 10 shows confocal images of BoNT/A (3 nM)- or vehicle-treated dorsal root ganglia (DRG) cultures probed with antibodies to different forms of SNAP25. (A-C) DRG cultures exposed to BoNT/A for 3 hr and later stained with (A) commercial (SMI-81R) mAb against full-length (206) and cleaved (197) SNAP25, (B) commercial (MC-6053) mAb against SNAP25.sub.197 and (C) Ab632-rMAb against SNAP25.sub.197. (D-F) Control DRG cultures exposed to vehicle and probed with the same three antibodies. Arrowhead in E points to a neuronal soma exhibiting background labeling.

    [0083] The presence of active BoNT/A in cells expressing SNAP25 can often be determined by using a selective antibody against the cleaved substrate (SNAP25.sub.197). In the present study, we introduce several rMAbs that were developed in-house against SNAP25.sub.197 and compared their immuno-reactive signal against that of commercial antibodies using a variety of different methods (Table 3). Both our human and murine rMAbs consistently detected SNAP25.sub.197 in all assays and on different tissues, and as expected, did not detect full-length SNAP25 (SNAP25.sub.206). This was not the case with other purportedly SNAP25.sub.197-selective antibodies, which displayed variable assay-dependent specificity. These results confirm that the BoNT/A-cleaved SNAP25 epitope is difficult to target specifically with an antibody without also recognizing the intact SNAP25 protein, which could lead to potential misinterpretation of results if the proper controls are not in place. Therefore, any given SNAP25.sub.197 antibody should be tested under multiple conditions and tissue types to ensure its fidelity in detecting the presence of BoNT/A-cleaved SNAP25.

    [0084] Site-specific antibodies are increasingly being used for both in vitro and in vivo analysis. These antibodies can detect sites of phosphorylation or sites of enzymatic cleavage and are invaluable tools for our understanding of the maturation, activity and degradation of proteins (Mort, J. S. and Buttle, D. J., 1999. The use of cleavage site specific antibodies to delineate protein processing and breakdown pathways. Mol. Pathol. 52, 11-18.; Mort, J. S., Flannery, C. R., Makkerh, J., Krupa, J. C., and Lee, E. R., 2003. Use of anti-neoepitope antibodies for the analysis of degradative events in cartilage and the molecular basis for neoepitope specificity. Biochem. Soc. Symp. 107-114.; Nagata, K., Izawa, I., and Inagaki, M., 2001. A decade of site- and phosphorylation state-specific antibodies: recent advances in studies of spatiotemporal protein phosphorylation. Genes Cells 6, 653-664.). Within the field of botulinum neurotoxins, cleavage site-specific antibodies can help detect the activity of minute quantities of BoNT light-chain that may otherwise be very difficult to perceive. To that end, the use of polyclonal antibodies may be of limited value because a mixed immunoglobulin population could be produced, not all of which would have the required specificity for the cleavage epitope (Mort, J. S. and Buttle, D. J., 1999. The use of cleavage site specific antibodies to delineate protein processing and breakdown pathways. Mol. Pathol. 52, 11-18.). Furthermore, the peptide antigen should be relatively short in order to reduce the possibility of generating antibodies that bind to a part of the sequence remote from the target epitope.

    [0085] The anti-SNAP25.sub.197 mAb presented in the current study was initially screened and selected for its superior performance in IHC assays. The rMAbs (Ab632 and Ab635) that were subsequently generated from this antibody demonstrated superb specificity to BoNT/A-cleaved SNAP25 in several different assays, including IHC. Furthermore, these rMAbs showed superior SNAP25.sub.197 specificity compared to other antibodies tested (Table 3). Accordingly, our rMAbs represent effective new tools for the detection of BoNT/A activity within cells and in clinical samples, and will be utilized in future studies to characterize the efficacy of BoNT/A in tissues of interest. The specific sequences for these antibodies are presented in Table 2 above.

    [0086] Overall, the antibodies tested in Western blot assays, immunohistochemistry on tissues and immunocytochemistry on cells showed various specificity to BoNT/A cleaved SNAP25 (SNAP25.sub.197) and uncleaved SNAP25 (SNAP25.sub.206). A summary of the results are shown in Table 3 below.

    TABLE-US-00003 TABLE 3 Summarized Results of Antibody Specificity to full length SNAP25 (206) or BoNT/A-cleaved SNAP25 (197). Rat Human Rat DRG Antibody Specificity Western Blot bladder Rat skin skin culture SMI-81R SNAP25.sub.206/197 206 + 197 206 + 197 206 + n/t 206 + 197 197 MC-6050 SNAP25.sub.206/197 197 197 206 + n/t n/t 197 + b MC-6053 SNAP25.sub.197 197 197 206 + 206 + 197 197 + b 197 + b Ab632 SNAP25.sub.197 197 197 197 n/t 197 Ab635 SNAP25.sub.197 197 197 n/t 197 n/t RGT- SNAP25.sub.197 197 206 + 197 206 + n/t n/t 1092 197 n/t = not tested; b = background

    [0087] It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application. All publications, patents and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes to the same extent as if each individual publication, patent or patent application were specifically and individually indicated to be so incorporated by reference.