CYTOPLASMIC TRANSDUCTION PEPTIDE AND INTRACELLULAR MESSENGER COMPRISING SAME

20190315809 ยท 2019-10-17

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to a cell membrane penetrating peptide and an intracellular delivery carrier including the same. The intracellular delivery carrier of the present invention has an advantage of efficiently transferring substances into cells even at a low concentration thereof compared with the existing cell membrane penetrating peptide derived from the virus.

Claims

1. A cell penetrating peptide comprising an amino acid sequence represented by the following Formula I:
Cys-Xaa1-Xaa2-Cys-Xaa3-Xaa4-Xaa5-Gly-His-Xaa6-Xaa7-Xaa8-Xaa9-Cys[Formula I] wherein Xaa1 is an amino acid selected from the group consisting of Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, Ser, Thr, Asn and Gln, wherein Xaa2 is an amino acid selected from the group consisting of Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, Arg, His, Lys, Asn, Ser, Thr and Gln, wherein Xaa3 and Xaa4 are individually an amino acid selected from the group consisting of Asp, Glu, Arg, His, Lys, Ser, Thr, Asn, Gln and Gly, wherein Xaa5 is an amino acid selected from the group consisting of Asp, Glu, Arg, His, Lys, Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp and Pro, wherein Xaa6 and Xaa7 are individually an amino acid selected from the group consisting of Ser, Thr, Asn, Gln, Ala, Val, Ile, Leu, Met, Phe, Tyr and Trp, wherein Xaa8 is an amino acid of Lys, Ala or Arg, and wherein Xaa9 is an amino acid selected from the group consisting of Asp, Glu, Ser, Thr, Asn and Gln.

2. An intracellular delivery carrier in which a cargo of an object to be delivered into a cell is conjugated with the end of a cell penetrating peptide of claim 1.

3. An intracellular delivery carrier in which a cargo of an object to be delivered into a cell is conjugated with the end of an NC peptide of a retrovirus.

4. The intracellular delivery carrier of claim 2, wherein the cargo of the object to be delivered into a cell is a chemical substance, a polypeptide, a nucleic acid, a carbohydrate or a lipid.

5. The intracellular delivery carrier of claim 3, wherein the retrovirus is selected from the group consisting of human immunodeficiency virus (HIV), murine leukemia virus (MLV), simian immunodeficiency virus (SIV), and RSV (rous sarcoma virus).

6. The intracellular delivery carrier of claim 2, wherein the peptide including the amino acid sequence represented by the Formula I is selected from the group consisting of polypeptides having the amino acid sequence represented by SEQ ID NO: 17 to SEQ ID NO: 23.

7. The intracellular delivery carrier of claim 3, wherein the NC peptide is selected from the group consisting of polypeptides having the amino acid sequence represented by SEQ ID NO: 12 to SEQ ID NO: 15.

8. A method for delivering a cargo of an object to be delivered into a cell, the method comprising contacting the intracellular delivery carrier of claim 2 with a cell.

9. A method for delivering a cargo of an object to be delivered into a cell, the method comprising contacting an intracellular delivery carrier of claim 3.

10. The method of claim 8, wherein the cargo of the object to be delivered into a cell is a chemical substance, a polypeptide, a nucleic acid, a carbohydrate or a lipid.

11. The method of claim 9, wherein the retrovirus is selected from the group consisting of human immunodeficiency virus (HIV), murine leukemia virus (MLV), simian immunodeficiencyvirus (SIV), and RSV (rous sarcoma virus).

12. The method of claim 8, wherein the peptide including the amino acid sequence represented by the Formula I is selected from the group consisting of polypeptides having the amino acid sequence represented by SEQ ID NO: 17 to SEQ ID NO: 23.

13. The method of claim 9, wherein the NC peptide is selected from the group consisting of polypeptides having the amino acid sequence represented by SEQ ID NO: 12 to SEQ ID NO: 15.

14. The intracellular delivery carrier of claim 3, wherein the cargo of the object to be delivered into a cell is a chemical substance, a polypeptide, a nucleic acid, a carbohydrate or a lipid.

15. The method of claim 9, wherein the cargo of the object to be delivered into a cell is a chemical substance, a polypeptide, a nucleic acid, a carbohydrate or a lipid.

Description

BRIEF DESCRIPTION OF DRAWINGS

[0049] FIG. 1 shows the results of confirming the expression of NC-EGFP protein by SDS-PAGE.

[0050] FIG. 2 shows peptide sequences of several retroviruses and the results of comparing the cell membrane penetration activity of several NC peptides conjugated with FITC, in which the red box represents the zinc finger domain.

[0051] FIGS. 3A to 3C show the results of confirming the cell membrane penetration activity of FITC-HIV-NC peptide (nucleocapsid peptide) in RAW264.7 cells in a concentration-dependent manner or time-dependent manner.

[0052] FIG. 4 shows the result of confirming the cell membrane penetration activity of the HIV-NC peptide by immunostaining.

[0053] FIGS. 5A to 5E show the results of confirming the cell membrane penetration activity of FITC-HIV-NC peptides in RAW264.7 (FIG. 5A), THP-1 (FIG. 5B), CEM (FIG. 5C), MDCK (FIG. 5D) and 293FT (FIG. 5E) in a concentration-dependent manner.

[0054] FIGS. 6A to 6C show the results of comparing cell membrane penetration activity of GFP-HIV-NC peptide and GFP-Tat peptide in RAW264.7 cells in a concentration-dependent manner.

[0055] FIG. 7 shows the results of comparing cell membrane penetration activity of FITC-HIV-NC peptide, FITC-Tat peptide, FITC-MA11 peptide, FITC-PTD-ys peptide, FITC-TLM peptide and FITC-TD1 peptide.

[0056] FIG. 8 shows the result of confirming the degree of cell membrane penetration activity of FITC-13NC35 peptide.

[0057] FIG. 9 shows the results of confirming the degree of cell membrane penetration activity of FITC-29NC50 peptide.

[0058] FIG. 10 shows the results of confirming whether the distribution of HIV-NC peptides in tissue cells after the penetration into tissues in vivo in which the scale bar represents 50 m in each photograph.

[0059] FIG. 11 shows the results of confirming the distribution of HIV-NC peptides in retinal cells after the penetration into ocular tissue: GCL means ganglion cell layer, INL means inner nuclear layer, and ONL means outer nuclear layer.

[0060] FIG. 12 shows the results of exhibiting cell membrane penetration activity of hexapeptide conjugated with HIV-NC peptide.

[0061] FIG. 13 shows the results of exhibiting the cell membrane penetration activity of RNA conjugated with HIV-NC peptide.

MODE FOR INVENTION

[0062] Hereinafter, one or more embodiments are described in more detail by way of Examples. However, these Examples are intended to illustrate one or more embodiments, and the scope of the present invention is not limited to these Examples.

Experimental Method

[0063] 1. Construction of a Recombinant Vector for NC Peptide Expression

[0064] A recombinant vector was prepared as follows to confirm the expression of a recombinant protein conjugated with NC peptide and EGFP and to purify the protein. Polymerase chain reaction (PCR) was performed using a primer including restriction enzyme recognition sequences in order to add restriction enzyme recognition sequences at the N-terminus of the NC peptide gene to allow NdeI which is a restriction enzyme (New England Biolabs; NEB, USA) to act on and at the C-terminus of the NC peptide gene to allow BspEI to act on. The primer sequences (SEQ ID NO: 1 and SEQ ID NO: 2) used in PCR and the PCR conditions, respectively, are shown in Tables 1 and 2 below.

TABLE-US-00001 TABLE1 SEQ.IDNO. Sequence NC-NdeI SEQ.IDNO.1 CATATGCAGCGGGGAACTT NC-BspEI SEQ.IDNO.2 TCCGGAGTTTGCCTGTCTC

TABLE-US-00002 TABLE 2 PCR reactants PCR cycle dH.sub.2O 37.5 l 95 C. 2 minutes dNTP (10X) 4 l 95 C. 1 minute 30 times F primer (10 M) 1 l 65 C. 30 seconds R primer (10 M) 1 l 74 C. 4 minutes NC peptide gene 1 l 74 C. 5 minutes DNA Taq polymerase 0.5 l 4 C. Unlimited buffer 5 l total 50 l

[0065] Next, in order to add restriction enzyme recognition sequences at the N-terminus of enhanced green fluorescent protein (EGFP) gene to allow BspEI to act on and at the C-terminus of the EGFP gene to allow HindIll to act on, PCR was carried out under the same conditions as in Table 2 as described above. However, the primers of SEQ ID NO: 3 and SEQ ID NO: 4 described in Table 3 below were used as the primers.

TABLE-US-00003 TABLE3 SEQ.IDNO. Sequence EGFP-BspEI-F SEQ.ID TCCGGAGTGAGCAAGGGCGA NO.3 EGFP-HindIII-R SEQ.ID AAGCTTCTTGTACACTCTCGT NO.4

[0066] The NC peptide gene and the EGFP gene to which the restriction enzyme recognition sequence was added were reacted at 16 C. for 12 hours, resulting in the ligation. PCR was performed on the ligated NC peptide-EGFP gene (hereinafter referred to as NC-EGFP gene) (using primers of SEQ ID NOS: 1, 2, 3 and 4) to obtain the entire sequence of NC-EFGP gene. The conditions of NC-EGFP gene ligation reaction are shown in Table 4 below.

TABLE-US-00004 TABLE 4 dH.sub.2O 6 l T4 DNA Ligase buffer (10X) 1 l NC peptide DNA (50 ng/l) 1 l EGFP gene DNA (50 ng/l) 1 l T4 DNA Ligase (400 units/l) 1 l Total 10 l

[0067] Then, pET21a (Novagen, USA) vector was cut with NdeI and HindIII restriction enzymes. Then, vector fragments were isolated according to the manufacturer's protocol using a PCR purification kit (Qiagen, USA). The restriction enzyme reaction was performed using NEBuffer #2 at 37 C. for 2 hours. The isolated pET21a vector fragment was ligated with the NC-EGFP gene, and then the recombination vector was isolated using the PCR Purification Kit. The recombinant vector into which the NC-EGFP gene was inserted was named pET21a NC-EGFP.

[0068] In order to replicate the pET21a NC-EGFP vector, the vector was transformed into E. coli DH5a and shake-cultured at 37 C. until the OD was 0.5 to 0.6 in LB liquid medium. After the culture was completed, the culture solution was centrifuged to collect the E. coli pellet, and the pET21a NC-EGFP vector was isolated from the E. coli pellet collected according to the manufacturer's protocol using a plasmid extraction kit (Qiagen). The isolated pET21a NC-EGFP vector was identified by quantifying the concentration using the UV method.

[0069] 2. Expression, Isolation and Purification of NC-EGFP

[0070] In order to confirm the protein expression of the pET21a NC-EGFP vector prepared as described above, the following experiment was conducted.

[0071] PET21a NC-EGFP vector was transformed into BL21 (DE3) (Thermo Fisher, USA), plated on LB plate and cultured at 37 C. for 12 hours. Colonies formed after 12 hours were inoculated into LB liquid medium and further cultured at 37 C. After about 12 hours, the culture solution having reached an OD of 0.5 to 0.6 was inoculated into 250 ml of LB liquid medium and cultured at 37 C. for 3 hours to 4 hours to have an OD of 0.5 to 0.6. When the OD of the culture solution reached 0.5 to 0.6, 0.5 mM isopropyl 13-D-thiogalactoside (IPTG) was added to the culture solution. Then, the culture was performed at 25 C. for 24 hours. After 24 hours, the culture solution was centrifuged to obtain BL21 pellet. The obtained pellet was suspended in a dissolution buffer (50 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 10 mM imidazole and pH 8.0), and then the E. coli was disrupted (amplitude 40%) using an ultrasonic wave crusher.

[0072] The E. coli debris was centrifuged and separated into supernatant and precipitate, and the supernatant was filled into a tube using a 0.45 m filter. The supernatant filled in the tube was placed in a column packed with Ni-NTA (nitrilotriacetic acid) resin to bind the protein and the resin to each other. In order to remove foreign proteins that did not bind to the resin, the resin was then washed with wash buffer (50 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 20 mM imidazole and pH 8.0). The final protein was obtained in a gradient mobile phase using an imidazole-added buffer (50 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 250 mM imidazole and pH 8.0). Next, in order to remove imidazole, the obtained protein was placed in a membrane tube, and buffer exchange by osmotic action was performed using a buffer (20 mM NaH.sub.2PO.sub.4, 300 mM NaCl and pH 7.2) not containing imidazole. Finally, the concentration of the protein dissolved in the buffer not containing imidazole was measured by Bradford assay to identify NC-EGFP protein expression. The results confirmed that even if other sequences were conjugated with the NC gene sequence, it did not affect the NC peptide expression.

[0073] FIG. 1 shows the results of the NC-EGFP protein by SDS-PAGE, which shows that the NC-EGFP protein having a size of about 35 kDa was expressed.

[0074] 3. Analysis of Cell Membrane Penetration Activity of NC peptides

[0075] 3-1. Cell Culture

[0076] HeLa, RAW 264.7 and 293 FT cells were cultured in DMEM medium supplemented with 10% FBS and 100 U/ml penicillin/streptomycin. MDCK cells were cultured in EMEM medium supplemented with 10% FBS and 100 U/ml penicillin/streptomycin (Hyclone, Logan, Utah, USA). THP-1 and CEM cells were cultured in RPMI-1640 medium supplemented with 10% FBS and 100 U/ml penicillin/streptomycin (Hyclone, Logan, Utah, USA). All cells were cultured in a humidified thermostat in 5% CO.sub.2 at 37 C.

[0077] 3-2. Analysis of Cell Membrane Penetration Activity of NC Peptide-Fluorescence-Activated Cell Sorting (FACS)

[0078] Various types of cells cultured in the Example 3-1 as described above were seeded into 6-well plates at a density of 110.sup.6 cells/well, and cultured for 24 hours to attach the cells to the plates. Then, cells were treated with the FITC-conjugated NC peptide (hereinafter referred to as FITC-NC peptide), the EGFP-conjugated NC peptide (hereinafter referred to as NC-EGFP peptide) and the EGFP-conjugated Tat peptide (hereinafter referred to as Tat-EGFP peptide), respectively, at different peptide concentrations (0.5, 1.0, 2.5, 5.0 and 10 M) or different peptide treatment time. The peptides were prepared by chempeptide (China) and Life tein (USA). The cells were then washed three times with PBS, and the cells were separated with trypsin-EDTA and suspended in PBS containing 2% FBS/0.1% bovine serum albumin (BSA). The suspension was centrifuged at 2,000 rpm for 2 minutes to obtain cell pellets, and the cells obtained were fixed with 3.7% formaldehyde for 20 minutes. Then, cell pellets were obtained by centrifugation at 2,000 rpm for 2 minutes, washed twice with PBS and then suspended in PBS containing 2% FBS and 0.1% BSA. Cells were analyzed by flow cytometry using a fluorescence activated cell sorter (FACS Calibur, Beckon Dickinson, Calif., USA).

[0079] 3-3. Analysis of Cell Membrane Penetration Activity of NC Peptide-Immunostaining

[0080] HeLa cells were seeded into a 12-well plate having glass at a density of 110.sup.3 cells/well, and then cultured for 24 hours to attach the cells to the glass. Then, cells were treated with FITC-NC peptides at 3 mM concentration for 3 hours. After 3 hours, the cells were washed three times with PBS, the cells were fixed with 3.7% formaldehyde for 20 minutes, and the cells were treated with PBS containing 0.2% Triton X-100 to increase the cell membrane penetration activity. Then, the cells were blocked with 3% BSA for 1 hour, reacted with lamin A/C antibody (Sigma-Aldrich, USA) at room temperature for 2 hours, and washed three times with PBS. Next, the cells were treated with Cy3-conjugated secondary antibody (Jackson ImmunoResearch, USA) at room temperature for 1 hour, washed twice with PBS, and then stained with DAPI (4,6-diamidino-2-phenylindol) for 10 minutes. The HeLa cell-attached glass was removed and placed on a slide glass. Then, the cells were observed with a confocal laser scanning microscope (LSM 700, Zeiss, Germany).

[0081] In addition, the following method was used to compare the penetration activity of NC peptides with other cell penetrating peptides.

[0082] The HeLa cells were seeded into a 12-well plate containing glass at a density of 110.sup.3 cells/well, and then cultured for 24 hours to attach the cells to the glass. Thereafter, the FITC-NC peptide, the trans-activating transcriptional activator peptide (FITC-Tat peptide), the FITC-MA11 peptide, the protein transduction domain-ys peptide (FITC-PTD-ys peptide), the translocation motif peptide (FITC-TLM peptide) and FITC-TD1 peptide were treated with the HeLa cells for 3 hours. After 3 hours, the cells were washed 3 times with PBS and the cells were fixed with 3.7% formaldehyde for 20 minutes. The cells were treated with PBS containing 0.2% Triton X-100 to increase cell membrane penetration activity and blocked with 3% BSA for 1 hour. Then, the cells were reacted with tubulin antibody (Santa Cruz Biotechnology, USA) at room temperature for 2 hours and washed three times with PBS. The cells were treated with Cy3 secondary antibody. They were reacted at room temperature for 1 hour, washed twice with PBS, and stained with DAPI for 10 minutes. The HeLa cell-attached glass was removed and placed on a slide glass. Then, the cells were observed with a confocal laser scanning microscope.

[0083] Further, in order to identify a change in cell membrane penetration activity by FITC-NC peptide, the HeLa cells were treated with hexapeptide, FITC-hexapeptide, FITC-NC-hexapeptide, FITC-13NC35 peptide and FITC-29NC50 peptide for 3 hours in the same manner as above and observed with a confocal laser scanning microscope. Meanwhile, the amino acid sequences of the hexapeptide, PTD-ys peptide, TLM peptide, TD1 peptide, NC-hexapeptide, 13NC35 peptide and 29NC50 peptide used are shown in Table 5 below.

TABLE-US-00005 TABLE5 Name SEQ.IDNO. AminoacidSequence Hexapeptide SEQ.IDNO.5 EEMQRR PTD-yspeptide SEQ.IDNO.6 YARVRRRGPRR TLMpeptide SEQ.IDNO.7 PLSSIFSRIGDP TD1peptide SEQ.IDNO.8 KAMININKFLNQC NC-hexapeptide SEQ.IDNO.9 VKCFNCGKEGHTARNCRAPRKKGCW KCGKEGHQMKDCTEEEMQRR 13NC35peptide SEQ.IDNO.10 VKCFNCGKEGHTARNCRAPRKKG 29NC50peptide SEQ.IDNO.11 RAPRKKGCWKCGKEGHQMKDCT

[0084] 3-4. Analysis of Cell Membrane Penetration Activity of NC Peptide-Fluorometer

[0085] RAW264.7 cells were seeded into 24-well plates at a density of 510.sup.4 cells/well and cultured for 24 hours to attach the cells to the plates. Then, each of the Tat-EGFP peptide and the NC-EGFP peptide was treated at different concentrations for 1 hour. After 1 hour, the cells were washed three times with PBS, and 100 ml of radio-immunoprecipitation assay (RIPA) buffer was added to dissolve the cells at 4 C. for 30 minutes. 100 ml of the cell lysate was transferred to a 96-well plate for fluorescence analysis, and GFP fluorescence was measured using a fluorescence analyzer (Synergy MX, BIOTEK, USA).

[0086] Further, NC peptides of FITC-conjugated Human immunodeficiency virus (HIV), Murine leukemia virus (MLV), Simian immunodeficiency virus (SIV) and RSV (Rous sarcoma virus) (hereinafter referred to as FITC-HIV-NC, FITC-MLV-NC, FITC-SIV-NC and FITC-RSV-NC, respectively) and Tat peptide were treated with RAW264.7 cells at a concentration of 1.0 M for 1 hour. Then, the fluorescence signal of the cells was measured.

[0087] 3-5. Change in RNA Transduction Efficiency by NC Peptide

[0088] MT4 cells were seeded into 24-well plates at a density of 210.sup.3 cells/well and cultured in a humidified thermostat in 5% CO.sub.2 at 37 C. for 24 hours. 2 l of NC peptides and 40 nM siGLO (Green transfection indicator, Dharmacon, D-001630-01-05) having different concentrations were mixed and reacted at room temperature for 30 minutes and then treated to MT4 cells. After further culture for 24 hours, MT4 cells were washed three times with PBS and analyzed by flow cytometry using a fluorescence activated cell sorter. Further, the cells were observed with a fluorescence inverted microscope (Olympus). 4. In Vivo Tissue Penetration of NC Peptide and Distribution of NC Peptide in Tissue Cells

[0089] The FITC-HIV-NC peptide and FITC-Tat peptide having a concentration of 3.2 mg/100 l, respectively, were injected into mouse tail vein using a 30 gauge syringe. The kidney, liver, lung, heart and spleen of the mice were removed 2 hours after the injection of the peptide and fixed with 4% paraformaldehyde for 1 hour. They were placed in 30% sucrose until the tissue was subsided. Then, each tissue was frozen using an OCT compound (Leica, Germany), and a tissue section slide was prepared with a freezing sectional device. Tissue section slides were stained with DAPI for 10 minutes according to methods known in the art and observed with a confocal laser scanning microscope.

[0090] In addition, 1 l of a 100 M stock of FITC-HIV-NC peptide was intravitreally injected, and 2 l of a 100 M stock of FITCHIV-NC peptide was subretinally injected. After 24 hours, mouse eye tissue was extracted. Eye tissue section slides were prepared in the same manner as described above. Slides were stained with DAPI for 10 min and observed with a confocal laser scanning microscope.

Experiment Result

[0091] 1. Identification of Cell Membrane Penetration Activity of Various Retroviral NC Peptides

[0092] In order to confirm whether the degree of cell membrane penetration activity was varied depending on the degree of similarity of NC peptide sequence, RAW264.7 Cells were treated with 1.0 M FITC-conjugated NC peptide of HIV, SIV, RSV and MLV and Tat peptide for 1 hour. As a result, as shown in FIG. 2, it was confirmed that NC peptides of HIV, SIV, RSV and MLV have excellent cell membrane penetration activity through the FITC fluorescence brightness. FACS analysis was performed to indicate that NC peptides of HIV, SIV, RSV and MLV, respectively, showed fluorescence in 96.8%, 54.0%, 24.2% and 5.7% of cells. The results of this experiment indicate that NC peptides of several retroviruses including HIV have excellent cell membrane penetration activity compared with that of the conventional Tat peptides. As shown in FIG. 2, it was confirmed that the NC peptides of HIV, SIV, RSV and MLV contained a zinc finger domain as a consensus sequence.

[0093] Meanwhile, the amino acid sequences of the NC peptides of HIV, SIV, RSV and MLV used above are shown in Table 6 below.

TABLE-US-00006 TABLE6 Name SEQ.IDNO. AminoacidSequence HIV-NCpeptide SEQ.IDNO.12 MQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKG CWKCGKEGHQMKDCTERQAN SIV-NCpeptide SEQ.IDNO.13 RGPLKCFNCGKFGHMQRECKAPRQIKCFKCGKIGH MAKDCKN RSV-NCpeptide SEQ.IDNO.14 GQTGSGGRARGLCYTCGSPGHYQAQCPKKRKSGNS RERCQLCDGMGHNAKQCRKRDGNQGQRP MLV-NCpeptide SEQ.IDNO.15 ATVVSGQKQDRQGGERRRSQLDRDQCAYCKEKGHW AKDCPKKPRGPRGPRPQTSLL

[0094] 2. Identification of Cell Membrane Penetration Activity of HIV-NC Peptide

[0095] In order to examine the cell membrane penetration activity of HIV-NC peptide (SEQ ID NO: 12) having the highest cell membrane penetration activity in the above experiment according to its concentrations, RAW264.7 macrophages were treated with FITC-HIV-NC peptide at a concentration of 0.5, 1, 2.5, 5.0 and 10 M for 1 hour. The fluorescence intensity of the cells was measured using a fluorescence microscope (Leica Micoscope Systems, Germany). As shown in FIG. 3A, it was confirmed that as the concentration of FITC-HIV-NC peptide increases, the penetration activity of the peptide increases. Further, as a result of the fluorescence analysis, as shown in FIG. 3B, it was confirmed that as the concentration of FITC-HIV-NC peptide was increased, the fluorescence signal was increased, indicating that the cell membrane penetration activity was increased. Further, in order to confirm the degree of cell membrane penetration of FITC-HIV-NC peptides according to the treatment time, the peptides were treated with RAW 264.7 cells at a concentration of 2.5 m for 20 minutes, 40 minutes and 60 minutes. As a result, it was confirmed by fluorescence microscopy and FACS analysis that as shown in FIG. 3C, the cell membrane permeability of the peptide was significantly increased with increasing time of FITC-HIV-NC peptide treatment.

[0096] In order to verify the cell membrane penetration activity of HIV-NC peptides, HeLa cells were immunostained and observed with a confocal laser scanning microscope. As a result, it was confirmed that as shown in FIG. 4, many HIV-NC peptides were uniformly distributed in the cell membrane, cytoplasm and nuclear membrane and that some HIV-NC peptides were distributed in the nucleus. The results indicate that HIV-NC peptides can penetrate cell membranes at low concentrations and that HIV-NC peptides penetrate cell membrane quickly.

[0097] 3. Identification of Cell Membrane Penetration Activity of HIV-NC Peptides in Various Cells

[0098] In order to identify whether the cell membrane penetration activity of HIV-NC peptide varies depending on kinds of cells, RAW264.7, THP-1, CEM, MDCK and 293FT cells were treated with FITC-HIV-NC peptide at a concentration of 1.0, 2.5 and 5.0 M for 1 hour or 2 hours. As a result, it was confirmed by fluorescence microscopy and FACS analysis that as shown in FIGS. 5A to 5E, the cell membrane penetration activity of the peptide was significantly increased as the concentration of FITC-HIV-NC peptide was increased. FIG. 5A shows the results of RAW264.7 (mouse macrophage). FIG. 5B shows the results of THP-1 (human mononuclear cell line) cells, FIG. 5C shows the results of CEM. FIG. 5D shows the results of MDCK (Madin-Darby canine kidney), and FIG. 5E shows the results of 293FT (derived from human fetal kidney cells). The above results indicate that HIV-NC peptides can penetrate various cell membranes of cancer cells, immune cells, epithelial cells and the like.

[0099] 4. Comparison of Cell Membrane Penetration Activity Between HIV-NC and Tat Peptides

[0100] In order to confirm the degree of cell membrane penetration activity of HIV-NC peptides, a comparative experiment carried out with a Tat peptide known as a conventional cell penetrating protein. RAW264.7 cells were treated with green fluorescent protein (GFP)-conjugated HIV-NC peptide (hereinafter referred to as GFP-HIV-NC peptide) at 0.5, 1.0, 2.5 and 5.0 M and GFP-conjugated Tat peptide at 1.0, 2.5, 5.0 and 10 M, respectively, for 1 hour. After 1 hour, the fluorescence of the peptides was confirmed. As a result, it was confirmed that as shown in FIGS. 6A and 6B, the GFP-HIV-NC peptide showed fluorescence at a low concentration of 0.25 M, while the GFP-Tat peptide showed slightly fluorescence at a high concentration of 10 M. Further, the cells were collected and analyzed by FACS. As a result, it was confirmed that as shown in FIGS. 6A and 6B, GFP-HIV-NC peptides showed fluorescence for 99.9% of cells at a concentration of 1 M, while GFP-Tat peptides showed fluorescence for 4.3% of cells at the same concentration.

[0101] Further, as a result of the fluorescence analysis, it was confirmed that as shown in FIG. 6C, as the concentration of GFP-HIV-NC peptide was increased, the cell membrane penetration activity was also increased, but the GFP-Tat peptide has very low cell membrane penetration activity regardless of the treatment concentration. The results indicate that HIV-NC peptides are highly efficient cell penetrating peptides as compared with Tat peptides, which are well-known as an existing cell penetrating protein.

[0102] 5. Comparison of Cell Membrane Penetration Activity of HIV-NC Peptides and Other Cell Penetrating Peptides

[0103] The HeLa cells were treated with FITC-HIV-NC peptides, FITC-Tat peptides, FITC-MA11 peptides, FITC-PTD-ys peptides, FITC-TLM peptides and FITC-TD1 peptides, and then the penetration activity of each peptide was confirmed.

[0104] As a result, it was confirmed that as shown in FIG. 7, the FITC-TLM peptides and the FITC-TD1 peptides were hardly penetrable to the cell membrane even though they were treated at a high concentration of 20 M, but the fluorescence signal was strong and the cell membrane penetration activity was remarkably excellent although FITC-HIV-NC peptides were treated at a low concentration of 3 M. Further, the cell membrane penetration activity of FITC-HIV-NC peptides is about 2.5 times higher than that of FITC-MA11 peptides, about 7 times higher than that of FITC-Tat peptides and about 10 times higher than that of FITC-PTD-ys peptides.

[0105] 6. Identification of the Cell Membrane Penetration Activity of Zinc Finger Domains in NC Peptides

[0106] Experimental result 1 confirmed that several retroviral NC peptides had cell membrane penetration activity. As shown in FIG. 2, it was confirmed that there are two zinc finger domains in HIV, SIV and RSV, and one zinc finger domain in MLV.

[0107] In order to confirm whether the cell membrane penetration activity is caused by the zinc finger domain which is a consensus sequence in several NC peptides, FITC was conjugated with a peptide containing the first zinc finger domain consisting of the 13th amino acid to the 35th amino acid of the HIV-NC peptide (13NC35 peptide, SEQ ID NO: 10), and, FITC was conjugated with a peptide containing the second zinc finger domain consisting of the 29th amino acid to the 50th amino acid of the HIV-NC peptide (29NC50 peptide, SEQ ID NO: 11) so that the cell membrane penetration activity was confirmed in HeLa cells, respectively.

[0108] As a result, it was confirmed that as shown in FIGS. 8 and 9, fluorescence signals were increased in proportion to the concentration of both 13NC35 peptide and 29NC50 peptide. This means that the zinc finger domain of the NC peptide is an important part of cell membrane penetration activity.

[0109] Meanwhile, the amino acid sequences of the zinc finger domains of NC peptides of HIV, SIV, RSV and MLV are shown in Table 7 below.

TABLE-US-00007 TABLE7 Aminoacid Name SEQ.IDNO. Sequence HIV-NC1.sup.stZincfingerdomain SEQ.IDNO.17 CFNCGKEGHTARNC HIV-NC2.sup.ndZincfingerdomain SEQ.IDNO.18 CWKCGKEGHQMKDC SIV-NC1.sup.stZincfingerdomain SEQ.IDNO.19 CFNCGKEGHMQREC SIV-NC2.sup.ndZincfingerdomain SEQ.IDNO.20 CFKCGKIGHMAKDC RSV-NC1.sup.stZincfingerdomain SEQ.IDNO.21 CYTCGSPGHYQAQC RSV-NC2.sup.ndZincfingerdomain SEQ.IDNO.22 CQLCDGMGHNAKQC MLV-NCZincfingerdomain SEQ.IDNO.23 CAYCKEKGHWAKDC

[0110] 7. In Vivo Tissue Penetration of HIV-NC Peptide and its Distribution in Tissue Cells

[0111] In order to confirm whether the NC peptides penetrate into tissues in vivo and are uniformly distributed in tissue cells, HIV-NC peptides were injected to the mouse tail vein. As a result, it was confirmed that as shown in FIG. 10, the peptides were well distributed in tissue cells of kidney, liver, lung, heart and spleen. In particular, the distribution efficiency to the kidney, liver and lung tissue cells was remarkably excellent. On the other hand, it was confirmed that Tat peptides were hardly distributed in other tissues except for kidney.

[0112] Further, HIV-NC peptides were injected through the intravitreal and subretinal injection routes. As a result, it was confirmed that as shown in FIG. 11, the fluorescence signal was strong so that HIV-NC peptides penetrated the eye tissue through the eye injection route to be well distributed in retinal cells.

[0113] 8. Confirmation of Cell Membrane Penetration Activity of Polypeptide by HIV-NC Peptide

[0114] In order to confirm whether HIV-NC peptides using a polypeptide as a cargo can have cell membrane penetration activity, hexapeptide was conjugated to HIV-NC peptide, and cells were treated with the peptides to observe the fluorescence signal. As a result, it was confirmed that as shown in FIG. 12, the hexapeptide itself did not penetrate the cell membrane, but when conjugated with the HIV-NC peptide, they could penetrate cell membrane and that cell membrane penetration activity was increased in proportion to the concentration.

[0115] 9. Confirmation of Cell Membrane Penetration Activity of Polynucleotide by HIV-NC Peptide

[0116] In order to confirm whether HIV-NC peptides using a polynucleotide as a cargo can have cell membrane penetration activity, siGLO RNA was conjugated to HIV-NC peptide, and cells were treated with the peptides to observe the fluorescence signal. As a result, it was confirmed that as shown in FIG. 13, the GFP fluorescence signal was increased according to the treatment concentration of HIV-NC peptide, and the degree of cell membrane penetration activity of siGLO was increased. These results indicate that HIV-NC peptides can significantly improve the cell membrane penetration activity of polynucleotides.

[0117] Hereinabove, the present invention has been described with reference to the preferred embodiments. It will be understood by those skilled in the art that the present invention may be carried out as modified embodiments without departing from the spirit and scope of the present invention. Therefore, the disclosed embodiments should be considered in an illustrative rather than a restrictive sense. It should be construed that the scope of the present invention is defined by the appended claims rather than by the foregoing description, and all differences within the scope of equivalents thereof should be included in the present invention.