CYTOPLASMIC TRANSDUCTION PEPTIDE AND INTRACELLULAR MESSENGER COMPRISING SAME
20190315809 ยท 2019-10-17
Assignee
Inventors
Cpc classification
C12N2740/11022
CHEMISTRY; METALLURGY
C07K2319/10
CHEMISTRY; METALLURGY
C12N2740/16022
CHEMISTRY; METALLURGY
C12N2740/16322
CHEMISTRY; METALLURGY
C12N2740/13022
CHEMISTRY; METALLURGY
C12N2740/15022
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention relates to a cell membrane penetrating peptide and an intracellular delivery carrier including the same. The intracellular delivery carrier of the present invention has an advantage of efficiently transferring substances into cells even at a low concentration thereof compared with the existing cell membrane penetrating peptide derived from the virus.
Claims
1. A cell penetrating peptide comprising an amino acid sequence represented by the following Formula I:
Cys-Xaa1-Xaa2-Cys-Xaa3-Xaa4-Xaa5-Gly-His-Xaa6-Xaa7-Xaa8-Xaa9-Cys[Formula I] wherein Xaa1 is an amino acid selected from the group consisting of Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, Ser, Thr, Asn and Gln, wherein Xaa2 is an amino acid selected from the group consisting of Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, Arg, His, Lys, Asn, Ser, Thr and Gln, wherein Xaa3 and Xaa4 are individually an amino acid selected from the group consisting of Asp, Glu, Arg, His, Lys, Ser, Thr, Asn, Gln and Gly, wherein Xaa5 is an amino acid selected from the group consisting of Asp, Glu, Arg, His, Lys, Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp and Pro, wherein Xaa6 and Xaa7 are individually an amino acid selected from the group consisting of Ser, Thr, Asn, Gln, Ala, Val, Ile, Leu, Met, Phe, Tyr and Trp, wherein Xaa8 is an amino acid of Lys, Ala or Arg, and wherein Xaa9 is an amino acid selected from the group consisting of Asp, Glu, Ser, Thr, Asn and Gln.
2. An intracellular delivery carrier in which a cargo of an object to be delivered into a cell is conjugated with the end of a cell penetrating peptide of claim 1.
3. An intracellular delivery carrier in which a cargo of an object to be delivered into a cell is conjugated with the end of an NC peptide of a retrovirus.
4. The intracellular delivery carrier of claim 2, wherein the cargo of the object to be delivered into a cell is a chemical substance, a polypeptide, a nucleic acid, a carbohydrate or a lipid.
5. The intracellular delivery carrier of claim 3, wherein the retrovirus is selected from the group consisting of human immunodeficiency virus (HIV), murine leukemia virus (MLV), simian immunodeficiency virus (SIV), and RSV (rous sarcoma virus).
6. The intracellular delivery carrier of claim 2, wherein the peptide including the amino acid sequence represented by the Formula I is selected from the group consisting of polypeptides having the amino acid sequence represented by SEQ ID NO: 17 to SEQ ID NO: 23.
7. The intracellular delivery carrier of claim 3, wherein the NC peptide is selected from the group consisting of polypeptides having the amino acid sequence represented by SEQ ID NO: 12 to SEQ ID NO: 15.
8. A method for delivering a cargo of an object to be delivered into a cell, the method comprising contacting the intracellular delivery carrier of claim 2 with a cell.
9. A method for delivering a cargo of an object to be delivered into a cell, the method comprising contacting an intracellular delivery carrier of claim 3.
10. The method of claim 8, wherein the cargo of the object to be delivered into a cell is a chemical substance, a polypeptide, a nucleic acid, a carbohydrate or a lipid.
11. The method of claim 9, wherein the retrovirus is selected from the group consisting of human immunodeficiency virus (HIV), murine leukemia virus (MLV), simian immunodeficiencyvirus (SIV), and RSV (rous sarcoma virus).
12. The method of claim 8, wherein the peptide including the amino acid sequence represented by the Formula I is selected from the group consisting of polypeptides having the amino acid sequence represented by SEQ ID NO: 17 to SEQ ID NO: 23.
13. The method of claim 9, wherein the NC peptide is selected from the group consisting of polypeptides having the amino acid sequence represented by SEQ ID NO: 12 to SEQ ID NO: 15.
14. The intracellular delivery carrier of claim 3, wherein the cargo of the object to be delivered into a cell is a chemical substance, a polypeptide, a nucleic acid, a carbohydrate or a lipid.
15. The method of claim 9, wherein the cargo of the object to be delivered into a cell is a chemical substance, a polypeptide, a nucleic acid, a carbohydrate or a lipid.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
MODE FOR INVENTION
[0062] Hereinafter, one or more embodiments are described in more detail by way of Examples. However, these Examples are intended to illustrate one or more embodiments, and the scope of the present invention is not limited to these Examples.
Experimental Method
[0063] 1. Construction of a Recombinant Vector for NC Peptide Expression
[0064] A recombinant vector was prepared as follows to confirm the expression of a recombinant protein conjugated with NC peptide and EGFP and to purify the protein. Polymerase chain reaction (PCR) was performed using a primer including restriction enzyme recognition sequences in order to add restriction enzyme recognition sequences at the N-terminus of the NC peptide gene to allow NdeI which is a restriction enzyme (New England Biolabs; NEB, USA) to act on and at the C-terminus of the NC peptide gene to allow BspEI to act on. The primer sequences (SEQ ID NO: 1 and SEQ ID NO: 2) used in PCR and the PCR conditions, respectively, are shown in Tables 1 and 2 below.
TABLE-US-00001 TABLE1 SEQ.IDNO. Sequence NC-NdeI SEQ.IDNO.1 CATATGCAGCGGGGAACTT NC-BspEI SEQ.IDNO.2 TCCGGAGTTTGCCTGTCTC
TABLE-US-00002 TABLE 2 PCR reactants PCR cycle dH.sub.2O 37.5 l 95 C. 2 minutes dNTP (10X) 4 l 95 C. 1 minute 30 times F primer (10 M) 1 l 65 C. 30 seconds R primer (10 M) 1 l 74 C. 4 minutes NC peptide gene 1 l 74 C. 5 minutes DNA Taq polymerase 0.5 l 4 C. Unlimited buffer 5 l total 50 l
[0065] Next, in order to add restriction enzyme recognition sequences at the N-terminus of enhanced green fluorescent protein (EGFP) gene to allow BspEI to act on and at the C-terminus of the EGFP gene to allow HindIll to act on, PCR was carried out under the same conditions as in Table 2 as described above. However, the primers of SEQ ID NO: 3 and SEQ ID NO: 4 described in Table 3 below were used as the primers.
TABLE-US-00003 TABLE3 SEQ.IDNO. Sequence EGFP-BspEI-F SEQ.ID TCCGGAGTGAGCAAGGGCGA NO.3 EGFP-HindIII-R SEQ.ID AAGCTTCTTGTACACTCTCGT NO.4
[0066] The NC peptide gene and the EGFP gene to which the restriction enzyme recognition sequence was added were reacted at 16 C. for 12 hours, resulting in the ligation. PCR was performed on the ligated NC peptide-EGFP gene (hereinafter referred to as NC-EGFP gene) (using primers of SEQ ID NOS: 1, 2, 3 and 4) to obtain the entire sequence of NC-EFGP gene. The conditions of NC-EGFP gene ligation reaction are shown in Table 4 below.
TABLE-US-00004 TABLE 4 dH.sub.2O 6 l T4 DNA Ligase buffer (10X) 1 l NC peptide DNA (50 ng/l) 1 l EGFP gene DNA (50 ng/l) 1 l T4 DNA Ligase (400 units/l) 1 l Total 10 l
[0067] Then, pET21a (Novagen, USA) vector was cut with NdeI and HindIII restriction enzymes. Then, vector fragments were isolated according to the manufacturer's protocol using a PCR purification kit (Qiagen, USA). The restriction enzyme reaction was performed using NEBuffer #2 at 37 C. for 2 hours. The isolated pET21a vector fragment was ligated with the NC-EGFP gene, and then the recombination vector was isolated using the PCR Purification Kit. The recombinant vector into which the NC-EGFP gene was inserted was named pET21a NC-EGFP.
[0068] In order to replicate the pET21a NC-EGFP vector, the vector was transformed into E. coli DH5a and shake-cultured at 37 C. until the OD was 0.5 to 0.6 in LB liquid medium. After the culture was completed, the culture solution was centrifuged to collect the E. coli pellet, and the pET21a NC-EGFP vector was isolated from the E. coli pellet collected according to the manufacturer's protocol using a plasmid extraction kit (Qiagen). The isolated pET21a NC-EGFP vector was identified by quantifying the concentration using the UV method.
[0069] 2. Expression, Isolation and Purification of NC-EGFP
[0070] In order to confirm the protein expression of the pET21a NC-EGFP vector prepared as described above, the following experiment was conducted.
[0071] PET21a NC-EGFP vector was transformed into BL21 (DE3) (Thermo Fisher, USA), plated on LB plate and cultured at 37 C. for 12 hours. Colonies formed after 12 hours were inoculated into LB liquid medium and further cultured at 37 C. After about 12 hours, the culture solution having reached an OD of 0.5 to 0.6 was inoculated into 250 ml of LB liquid medium and cultured at 37 C. for 3 hours to 4 hours to have an OD of 0.5 to 0.6. When the OD of the culture solution reached 0.5 to 0.6, 0.5 mM isopropyl 13-D-thiogalactoside (IPTG) was added to the culture solution. Then, the culture was performed at 25 C. for 24 hours. After 24 hours, the culture solution was centrifuged to obtain BL21 pellet. The obtained pellet was suspended in a dissolution buffer (50 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 10 mM imidazole and pH 8.0), and then the E. coli was disrupted (amplitude 40%) using an ultrasonic wave crusher.
[0072] The E. coli debris was centrifuged and separated into supernatant and precipitate, and the supernatant was filled into a tube using a 0.45 m filter. The supernatant filled in the tube was placed in a column packed with Ni-NTA (nitrilotriacetic acid) resin to bind the protein and the resin to each other. In order to remove foreign proteins that did not bind to the resin, the resin was then washed with wash buffer (50 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 20 mM imidazole and pH 8.0). The final protein was obtained in a gradient mobile phase using an imidazole-added buffer (50 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 250 mM imidazole and pH 8.0). Next, in order to remove imidazole, the obtained protein was placed in a membrane tube, and buffer exchange by osmotic action was performed using a buffer (20 mM NaH.sub.2PO.sub.4, 300 mM NaCl and pH 7.2) not containing imidazole. Finally, the concentration of the protein dissolved in the buffer not containing imidazole was measured by Bradford assay to identify NC-EGFP protein expression. The results confirmed that even if other sequences were conjugated with the NC gene sequence, it did not affect the NC peptide expression.
[0073]
[0074] 3. Analysis of Cell Membrane Penetration Activity of NC peptides
[0075] 3-1. Cell Culture
[0076] HeLa, RAW 264.7 and 293 FT cells were cultured in DMEM medium supplemented with 10% FBS and 100 U/ml penicillin/streptomycin. MDCK cells were cultured in EMEM medium supplemented with 10% FBS and 100 U/ml penicillin/streptomycin (Hyclone, Logan, Utah, USA). THP-1 and CEM cells were cultured in RPMI-1640 medium supplemented with 10% FBS and 100 U/ml penicillin/streptomycin (Hyclone, Logan, Utah, USA). All cells were cultured in a humidified thermostat in 5% CO.sub.2 at 37 C.
[0077] 3-2. Analysis of Cell Membrane Penetration Activity of NC Peptide-Fluorescence-Activated Cell Sorting (FACS)
[0078] Various types of cells cultured in the Example 3-1 as described above were seeded into 6-well plates at a density of 110.sup.6 cells/well, and cultured for 24 hours to attach the cells to the plates. Then, cells were treated with the FITC-conjugated NC peptide (hereinafter referred to as FITC-NC peptide), the EGFP-conjugated NC peptide (hereinafter referred to as NC-EGFP peptide) and the EGFP-conjugated Tat peptide (hereinafter referred to as Tat-EGFP peptide), respectively, at different peptide concentrations (0.5, 1.0, 2.5, 5.0 and 10 M) or different peptide treatment time. The peptides were prepared by chempeptide (China) and Life tein (USA). The cells were then washed three times with PBS, and the cells were separated with trypsin-EDTA and suspended in PBS containing 2% FBS/0.1% bovine serum albumin (BSA). The suspension was centrifuged at 2,000 rpm for 2 minutes to obtain cell pellets, and the cells obtained were fixed with 3.7% formaldehyde for 20 minutes. Then, cell pellets were obtained by centrifugation at 2,000 rpm for 2 minutes, washed twice with PBS and then suspended in PBS containing 2% FBS and 0.1% BSA. Cells were analyzed by flow cytometry using a fluorescence activated cell sorter (FACS Calibur, Beckon Dickinson, Calif., USA).
[0079] 3-3. Analysis of Cell Membrane Penetration Activity of NC Peptide-Immunostaining
[0080] HeLa cells were seeded into a 12-well plate having glass at a density of 110.sup.3 cells/well, and then cultured for 24 hours to attach the cells to the glass. Then, cells were treated with FITC-NC peptides at 3 mM concentration for 3 hours. After 3 hours, the cells were washed three times with PBS, the cells were fixed with 3.7% formaldehyde for 20 minutes, and the cells were treated with PBS containing 0.2% Triton X-100 to increase the cell membrane penetration activity. Then, the cells were blocked with 3% BSA for 1 hour, reacted with lamin A/C antibody (Sigma-Aldrich, USA) at room temperature for 2 hours, and washed three times with PBS. Next, the cells were treated with Cy3-conjugated secondary antibody (Jackson ImmunoResearch, USA) at room temperature for 1 hour, washed twice with PBS, and then stained with DAPI (4,6-diamidino-2-phenylindol) for 10 minutes. The HeLa cell-attached glass was removed and placed on a slide glass. Then, the cells were observed with a confocal laser scanning microscope (LSM 700, Zeiss, Germany).
[0081] In addition, the following method was used to compare the penetration activity of NC peptides with other cell penetrating peptides.
[0082] The HeLa cells were seeded into a 12-well plate containing glass at a density of 110.sup.3 cells/well, and then cultured for 24 hours to attach the cells to the glass. Thereafter, the FITC-NC peptide, the trans-activating transcriptional activator peptide (FITC-Tat peptide), the FITC-MA11 peptide, the protein transduction domain-ys peptide (FITC-PTD-ys peptide), the translocation motif peptide (FITC-TLM peptide) and FITC-TD1 peptide were treated with the HeLa cells for 3 hours. After 3 hours, the cells were washed 3 times with PBS and the cells were fixed with 3.7% formaldehyde for 20 minutes. The cells were treated with PBS containing 0.2% Triton X-100 to increase cell membrane penetration activity and blocked with 3% BSA for 1 hour. Then, the cells were reacted with tubulin antibody (Santa Cruz Biotechnology, USA) at room temperature for 2 hours and washed three times with PBS. The cells were treated with Cy3 secondary antibody. They were reacted at room temperature for 1 hour, washed twice with PBS, and stained with DAPI for 10 minutes. The HeLa cell-attached glass was removed and placed on a slide glass. Then, the cells were observed with a confocal laser scanning microscope.
[0083] Further, in order to identify a change in cell membrane penetration activity by FITC-NC peptide, the HeLa cells were treated with hexapeptide, FITC-hexapeptide, FITC-NC-hexapeptide, FITC-13NC35 peptide and FITC-29NC50 peptide for 3 hours in the same manner as above and observed with a confocal laser scanning microscope. Meanwhile, the amino acid sequences of the hexapeptide, PTD-ys peptide, TLM peptide, TD1 peptide, NC-hexapeptide, 13NC35 peptide and 29NC50 peptide used are shown in Table 5 below.
TABLE-US-00005 TABLE5 Name SEQ.IDNO. AminoacidSequence Hexapeptide SEQ.IDNO.5 EEMQRR PTD-yspeptide SEQ.IDNO.6 YARVRRRGPRR TLMpeptide SEQ.IDNO.7 PLSSIFSRIGDP TD1peptide SEQ.IDNO.8 KAMININKFLNQC NC-hexapeptide SEQ.IDNO.9 VKCFNCGKEGHTARNCRAPRKKGCW KCGKEGHQMKDCTEEEMQRR 13NC35peptide SEQ.IDNO.10 VKCFNCGKEGHTARNCRAPRKKG 29NC50peptide SEQ.IDNO.11 RAPRKKGCWKCGKEGHQMKDCT
[0084] 3-4. Analysis of Cell Membrane Penetration Activity of NC Peptide-Fluorometer
[0085] RAW264.7 cells were seeded into 24-well plates at a density of 510.sup.4 cells/well and cultured for 24 hours to attach the cells to the plates. Then, each of the Tat-EGFP peptide and the NC-EGFP peptide was treated at different concentrations for 1 hour. After 1 hour, the cells were washed three times with PBS, and 100 ml of radio-immunoprecipitation assay (RIPA) buffer was added to dissolve the cells at 4 C. for 30 minutes. 100 ml of the cell lysate was transferred to a 96-well plate for fluorescence analysis, and GFP fluorescence was measured using a fluorescence analyzer (Synergy MX, BIOTEK, USA).
[0086] Further, NC peptides of FITC-conjugated Human immunodeficiency virus (HIV), Murine leukemia virus (MLV), Simian immunodeficiency virus (SIV) and RSV (Rous sarcoma virus) (hereinafter referred to as FITC-HIV-NC, FITC-MLV-NC, FITC-SIV-NC and FITC-RSV-NC, respectively) and Tat peptide were treated with RAW264.7 cells at a concentration of 1.0 M for 1 hour. Then, the fluorescence signal of the cells was measured.
[0087] 3-5. Change in RNA Transduction Efficiency by NC Peptide
[0088] MT4 cells were seeded into 24-well plates at a density of 210.sup.3 cells/well and cultured in a humidified thermostat in 5% CO.sub.2 at 37 C. for 24 hours. 2 l of NC peptides and 40 nM siGLO (Green transfection indicator, Dharmacon, D-001630-01-05) having different concentrations were mixed and reacted at room temperature for 30 minutes and then treated to MT4 cells. After further culture for 24 hours, MT4 cells were washed three times with PBS and analyzed by flow cytometry using a fluorescence activated cell sorter. Further, the cells were observed with a fluorescence inverted microscope (Olympus). 4. In Vivo Tissue Penetration of NC Peptide and Distribution of NC Peptide in Tissue Cells
[0089] The FITC-HIV-NC peptide and FITC-Tat peptide having a concentration of 3.2 mg/100 l, respectively, were injected into mouse tail vein using a 30 gauge syringe. The kidney, liver, lung, heart and spleen of the mice were removed 2 hours after the injection of the peptide and fixed with 4% paraformaldehyde for 1 hour. They were placed in 30% sucrose until the tissue was subsided. Then, each tissue was frozen using an OCT compound (Leica, Germany), and a tissue section slide was prepared with a freezing sectional device. Tissue section slides were stained with DAPI for 10 minutes according to methods known in the art and observed with a confocal laser scanning microscope.
[0090] In addition, 1 l of a 100 M stock of FITC-HIV-NC peptide was intravitreally injected, and 2 l of a 100 M stock of FITCHIV-NC peptide was subretinally injected. After 24 hours, mouse eye tissue was extracted. Eye tissue section slides were prepared in the same manner as described above. Slides were stained with DAPI for 10 min and observed with a confocal laser scanning microscope.
Experiment Result
[0091] 1. Identification of Cell Membrane Penetration Activity of Various Retroviral NC Peptides
[0092] In order to confirm whether the degree of cell membrane penetration activity was varied depending on the degree of similarity of NC peptide sequence, RAW264.7 Cells were treated with 1.0 M FITC-conjugated NC peptide of HIV, SIV, RSV and MLV and Tat peptide for 1 hour. As a result, as shown in
[0093] Meanwhile, the amino acid sequences of the NC peptides of HIV, SIV, RSV and MLV used above are shown in Table 6 below.
TABLE-US-00006 TABLE6 Name SEQ.IDNO. AminoacidSequence HIV-NCpeptide SEQ.IDNO.12 MQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKG CWKCGKEGHQMKDCTERQAN SIV-NCpeptide SEQ.IDNO.13 RGPLKCFNCGKFGHMQRECKAPRQIKCFKCGKIGH MAKDCKN RSV-NCpeptide SEQ.IDNO.14 GQTGSGGRARGLCYTCGSPGHYQAQCPKKRKSGNS RERCQLCDGMGHNAKQCRKRDGNQGQRP MLV-NCpeptide SEQ.IDNO.15 ATVVSGQKQDRQGGERRRSQLDRDQCAYCKEKGHW AKDCPKKPRGPRGPRPQTSLL
[0094] 2. Identification of Cell Membrane Penetration Activity of HIV-NC Peptide
[0095] In order to examine the cell membrane penetration activity of HIV-NC peptide (SEQ ID NO: 12) having the highest cell membrane penetration activity in the above experiment according to its concentrations, RAW264.7 macrophages were treated with FITC-HIV-NC peptide at a concentration of 0.5, 1, 2.5, 5.0 and 10 M for 1 hour. The fluorescence intensity of the cells was measured using a fluorescence microscope (Leica Micoscope Systems, Germany). As shown in
[0096] In order to verify the cell membrane penetration activity of HIV-NC peptides, HeLa cells were immunostained and observed with a confocal laser scanning microscope. As a result, it was confirmed that as shown in
[0097] 3. Identification of Cell Membrane Penetration Activity of HIV-NC Peptides in Various Cells
[0098] In order to identify whether the cell membrane penetration activity of HIV-NC peptide varies depending on kinds of cells, RAW264.7, THP-1, CEM, MDCK and 293FT cells were treated with FITC-HIV-NC peptide at a concentration of 1.0, 2.5 and 5.0 M for 1 hour or 2 hours. As a result, it was confirmed by fluorescence microscopy and FACS analysis that as shown in
[0099] 4. Comparison of Cell Membrane Penetration Activity Between HIV-NC and Tat Peptides
[0100] In order to confirm the degree of cell membrane penetration activity of HIV-NC peptides, a comparative experiment carried out with a Tat peptide known as a conventional cell penetrating protein. RAW264.7 cells were treated with green fluorescent protein (GFP)-conjugated HIV-NC peptide (hereinafter referred to as GFP-HIV-NC peptide) at 0.5, 1.0, 2.5 and 5.0 M and GFP-conjugated Tat peptide at 1.0, 2.5, 5.0 and 10 M, respectively, for 1 hour. After 1 hour, the fluorescence of the peptides was confirmed. As a result, it was confirmed that as shown in
[0101] Further, as a result of the fluorescence analysis, it was confirmed that as shown in
[0102] 5. Comparison of Cell Membrane Penetration Activity of HIV-NC Peptides and Other Cell Penetrating Peptides
[0103] The HeLa cells were treated with FITC-HIV-NC peptides, FITC-Tat peptides, FITC-MA11 peptides, FITC-PTD-ys peptides, FITC-TLM peptides and FITC-TD1 peptides, and then the penetration activity of each peptide was confirmed.
[0104] As a result, it was confirmed that as shown in
[0105] 6. Identification of the Cell Membrane Penetration Activity of Zinc Finger Domains in NC Peptides
[0106] Experimental result 1 confirmed that several retroviral NC peptides had cell membrane penetration activity. As shown in
[0107] In order to confirm whether the cell membrane penetration activity is caused by the zinc finger domain which is a consensus sequence in several NC peptides, FITC was conjugated with a peptide containing the first zinc finger domain consisting of the 13th amino acid to the 35th amino acid of the HIV-NC peptide (13NC35 peptide, SEQ ID NO: 10), and, FITC was conjugated with a peptide containing the second zinc finger domain consisting of the 29th amino acid to the 50th amino acid of the HIV-NC peptide (29NC50 peptide, SEQ ID NO: 11) so that the cell membrane penetration activity was confirmed in HeLa cells, respectively.
[0108] As a result, it was confirmed that as shown in
[0109] Meanwhile, the amino acid sequences of the zinc finger domains of NC peptides of HIV, SIV, RSV and MLV are shown in Table 7 below.
TABLE-US-00007 TABLE7 Aminoacid Name SEQ.IDNO. Sequence HIV-NC1.sup.stZincfingerdomain SEQ.IDNO.17 CFNCGKEGHTARNC HIV-NC2.sup.ndZincfingerdomain SEQ.IDNO.18 CWKCGKEGHQMKDC SIV-NC1.sup.stZincfingerdomain SEQ.IDNO.19 CFNCGKEGHMQREC SIV-NC2.sup.ndZincfingerdomain SEQ.IDNO.20 CFKCGKIGHMAKDC RSV-NC1.sup.stZincfingerdomain SEQ.IDNO.21 CYTCGSPGHYQAQC RSV-NC2.sup.ndZincfingerdomain SEQ.IDNO.22 CQLCDGMGHNAKQC MLV-NCZincfingerdomain SEQ.IDNO.23 CAYCKEKGHWAKDC
[0110] 7. In Vivo Tissue Penetration of HIV-NC Peptide and its Distribution in Tissue Cells
[0111] In order to confirm whether the NC peptides penetrate into tissues in vivo and are uniformly distributed in tissue cells, HIV-NC peptides were injected to the mouse tail vein. As a result, it was confirmed that as shown in
[0112] Further, HIV-NC peptides were injected through the intravitreal and subretinal injection routes. As a result, it was confirmed that as shown in
[0113] 8. Confirmation of Cell Membrane Penetration Activity of Polypeptide by HIV-NC Peptide
[0114] In order to confirm whether HIV-NC peptides using a polypeptide as a cargo can have cell membrane penetration activity, hexapeptide was conjugated to HIV-NC peptide, and cells were treated with the peptides to observe the fluorescence signal. As a result, it was confirmed that as shown in
[0115] 9. Confirmation of Cell Membrane Penetration Activity of Polynucleotide by HIV-NC Peptide
[0116] In order to confirm whether HIV-NC peptides using a polynucleotide as a cargo can have cell membrane penetration activity, siGLO RNA was conjugated to HIV-NC peptide, and cells were treated with the peptides to observe the fluorescence signal. As a result, it was confirmed that as shown in
[0117] Hereinabove, the present invention has been described with reference to the preferred embodiments. It will be understood by those skilled in the art that the present invention may be carried out as modified embodiments without departing from the spirit and scope of the present invention. Therefore, the disclosed embodiments should be considered in an illustrative rather than a restrictive sense. It should be construed that the scope of the present invention is defined by the appended claims rather than by the foregoing description, and all differences within the scope of equivalents thereof should be included in the present invention.