ENGINEERED TREATMENTS FOR HAIR REPAIR AND LONG-LASTING COLOR RETENTION
20190314260 ยท 2019-10-17
Assignee
Inventors
Cpc classification
A61K8/65
HUMAN NECESSITIES
C12N15/70
CHEMISTRY; METALLURGY
A61Q5/002
HUMAN NECESSITIES
A61K8/64
HUMAN NECESSITIES
International classification
A61K8/65
HUMAN NECESSITIES
C12N15/70
CHEMISTRY; METALLURGY
Abstract
Disclosed herein are engineered constructs that have keratin-binding functionality, and uses thereof for hair treatment.
Claims
1. An engineered keratin-binding construct comprising at least one keratin-binding molecule, optionally comprising one or more of each of two or more types of keratin-binding molecule.
2. (canceled)
3. The engineered keratin-binding construct of claim 1, wherein the engineered keratin-binding construct comprises the formula X.sub.n-Y.sub.m, where X is one type of keratin-binding molecule, and Y is a different type of keratin-binding molecule, n=020 and m=020, wherein n and m cannot both be 0.
4. The engineered keratin-binding construct of claim 1, wherein at least one type of the at least one keratin-binding molecule is a keratin-binding protein, optionally wherein all of the types of the at least one keratin-binding molecule are keratin-binding proteins, optionally wherein the keratin-binding protein comprises 1-5 repeats of an amino acid sequence (QGQVQHLQAAFSQYKKVELFPKGG) set forth in SEQ ID NO: 1.
5.-6. (canceled)
7. The engineered keratin-binding construct of claim 1, further comprising a site for bioconjugation optionally wherein the site for bioconjugation is for bioconjugation of a lipid, optionally wherein the site for bioconjugation is located at or near an end of the engineered keratin-binding construct, optionally wherein at least one keratin-binding molecule is a protein, and the site for bioconjugation is located at the N-terminus of the protein or within 5 amino acid residues from the N-terminus of the protein, optionally wherein the site for bioconjugation comprises a pyridoxal 5-phosphate (PLP) reactive site, optionally wherein the PLP reactive site comprises the amino acid sequence alanine-lysine-threonine (AKT).
8.-12. (canceled)
13. The engineered keratin-binding construct of claim 1, further comprising a keratin conjugation site optionally wherein the keratin conjugation site comprises one or more cysteines, optionally wherein the keratin conjugation site is located at or near an end of the engineered keratin-binding construct, optionally wherein at least one keratin-binding molecule is a protein, and the keratin conjugation site is located at the C-terminus of the protein, optionally wherein at least one keratin-binding molecule is a protein, and wherein the one or more cysteines is part of a single polypeptide chain with the keratin-binding molecule.
14.-17. (canceled)
18. The engineered keratin-binding construct of claim 1, further comprising a melanin precursor optionally wherein the melanin precursor comprises one or more tyrosines, optionally wherein the one or more tyrosines comprise 4-20 tyrosines, optionally wherein at least one keratin-binding molecule is a protein, and wherein the one or more tyrosines is part of a single polypeptide chain with the keratin-binding molecule.
19.-21. (canceled)
22. The engineered keratin-binding construct of claim 1, further comprising melanin or a hair dye.
23. The engineered keratin-binding construct of claim 1, further comprising a lipid optionally wherein the lipid is conjugated to the site for bioconjugation, optionally wherein the site for bioconjugation is the amino acid sequence AKT, and wherein the lipid is conjugated to the lysine of the amino acid sequence AKT, optionally wherein the lipid is selected from the group consisting of myristoleic acid/alcohol/amine, palmitoleic acid/alcohol/amine, sapienic acid/alcohol/amine, oleic acid/alcohol/amine, elaidic acid/alcohol/amine, vaccenic acid/alcohol/amine, linoleic acid/alcohol/amine, linoelaidic acid/alcohol/amine, alpha linolenic acid/alcohol/amine, arachidonic acid/alcohol/amine, eicosapentaenoic acid/alcohol/amine, erucic acid/alcohol/amine, caprylic acid/alcohol/amine (octanoic acid/alcohol/amine), lauric acid/alcohol/amine, myristic acid/alcohol/amine, palmitic acid/alcohol/amine, lignoceric acid/alcohol/amine, arachidic acid/alcohol/amine, stearic acid/alcohol/amine, and sphingolipids including ceramide, sphingosine, sphingomyelin, alpha cerebroside, gangliosides, sulfatides, and phytosphingosine.
24.-26. (canceled)
27. A composition comprising the engineered keratin-binding construct of claim 1.
28.-29. (canceled)
30. A nucleic acid molecule encoding the engineered keratin-binding construct of claim 1.
31. A vector comprising the nucleic acid molecule of claim 30.
32. A cell comprising the nucleic acid molecule of claim 30.
33. The cell of claim 32, wherein the cell is a bacterial cell or a yeast cell, optionally wherein the bacterial cell is an E. coli cell.
34. (canceled)
35. A method of improving or repairing damage to hair comprising applying the engineered keratin-binding construct of claim 1 to the hair for a time sufficient to improve or repair the damage to the hair.
36.-39. (canceled)
40. A method of coloring or dyeing hair comprising applying the engineered keratin-binding construct of claim 1 to the hair for a time sufficient to color or dye the hair, wherein the engineered keratin-binding comprises melanin or a hair dye molecule conjugated to the at least one keratin-binding molecule.
41.-44. (canceled)
45. A method for producing an engineered keratin-binding construct comprising expressing the engineered keratin-binding construct of claim 1 in a cell, or chemically synthesizing the engineered keratin-binding construct of claim 1.
46.-47. (canceled)
48. A method for producing an engineered keratin-binding construct comprising a lipid, comprising expressing the engineered keratin-binding construct of claim 1 in a cell or chemically synthesizing the engineered keratin-binding construct of claim 1, and, conjugating a lipid to the engineered keratin-binding construct.
49.-50. (canceled)
51. A method for preparing a hair dye composition comprising expressing or chemically synthesizing the engineered keratin-binding construct of claim 1, wherein the engineered keratin-binding construct comprises a melanin precursor; and contacting the engineered keratin-binding construct with tyrosinase to convert the melanin precursor to melanin.
52.-56. (canceled)
57. A method for preparing a hair product composition comprising combining the engineered keratin-binding construct of claim 1 with one or more cosmetic ingredients.
58. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0020] The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present disclosure, which can be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein. It is to be understood that the data illustrated in the drawings in no way limit the scope of the disclosure.
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
DETAILED DESCRIPTION
[0041] The following description is merely intended to illustrate various embodiments of the invention. As such, specific embodiments discussed herein are not to be construed as limitations to the scope of the invention. It will be apparent to one skilled in the art that various changes or equivalents may be made without departing from the scope of the invention.
[0042] Hair is routinely damaged from ageing, environmental stress, heat styling, and use of chemical bleaches and dyes. The engineered keratin-binding constructs of the present disclosure form strong and long-lasting disulfide bonds and electrostatic bonds with keratin in hair, preventing and treating damaged hair. These strong and long-lasting bonds between the disclosed keratin-binding constructs and hair also make them ideal for use in hair dyes and compositions.
Keratin Binding Molecules
[0043] Provided herein are engineered keratin-binding constructs that include at least one keratin-binding molecule. In some embodiments, the engineered keratin-binding construct includes one or more of each of two or more types of keratin-binding molecules.
[0044] The engineered keratin-binding construct can be represented by the formula., X.sub.n-Y.sub.m, where X is one type of keratin-binding molecule, and Y is a different type of keratin-binding molecule, n=020 and m=020, wherein n and m cannot both be 0. Examples include X-Y, Y-X, X-X-Y, X-Y-X, X-Y-Y, X-X-Y-X, X-Y-X-Y, X-X-X-Y, Y-X-Y-X, Y-Y-X-X, X-X-X-Y-Y, etc.
[0045] The number and types of keratin-binding molecules is not limited, such that the engineered keratin-binding constructs can include 1, 2, 3, 4, 5, 6, 7, 8, 9, or more types of keratin-binding molecules.
[0046] Likewise, the number of any of the keratin-binding molecules is not limited, such that the number of any of the keratin-binding molecules can be 1, 3, 4, 5, 6, 7, 8, 9 or more.
[0047] Types of keratin binding molecule include keratin-binding proteins, antibody molecules that bind keratin, keratin-binding aptamers, or molecules selected by high throughput screening or directed evolution specifically for the property of binding to keratin.
[0048] Keratin-binding proteins may include, but are not limited to, trichoplein, pneumococcal serine rich repeat protein (PsrP), serine rich repeat protein (Srr-1), plectin, trichohyalin, myosin, TNF receptor 1-associated protein of TRADD, anti-Fas-binding factor 1 (Albatross), BMP, 14-3-3 proteins, plectin homology domain (TPHD), desmoplakin, the amino end of pinin, vitronectin, modified wheat gluten, pulmonary-associated surfactant protein D, p27kip1, primaquine and keratin binding polypeptides (see also Table 2).
[0049] Antibody molecules that bind keratin including monoclonal antibodies and antigen-binding fragments thereof, single domain antibodies such as VH, VL, VHH, and engineered constructs containing one or more of the antibodies, antigen-binding fragments thereof and/or single domain antibodies such as ScFv molecules, formatted camelid single variable domains, etc.).
[0050] The keratin-binding constructs disclosed herein may include one or more linker(s). The term linker, as used herein, refers to a chemical group or a molecule linking two molecules or moieties, e.g., two domains of a fusion protein, such as, for example, two keratin-binding domains. A linker may be, for example, an amino acid sequence, a peptide, or a polymer of any length and composition. Typically, the linker is positioned between, or flanked by, two groups, molecules, or other moieties and connected to each one via a covalent bond, thus connecting the two. In some embodiments, the linker is an amino acid or a plurality of amino acids (e.g., a peptide or protein). In some embodiments, the linker is an organic molecule, group, polymer, or chemical moiety. In some embodiments, the linker is 1-100 amino acids in length, for example, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 30-35, 35-40, 40-45, 45-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-150, or 150-200 amino acids in length. Longer or shorter linkers are also contemplated. For example, the linker may be a bond, one or more amino acids, a peptide, or a polymer, of any length and composition. In some embodiments, the linker is a Gly-Ser linker. In some embodiments, the linker comprises (GS)n (SEQ ID NO: 6), (GGS)n (SEQ ID NO: 7), (GGGS)n (SEQ ID NO: 8), (GGGGS)n (SEQ ID NO: 9), (G)n (SEQ ID NO: 10), (EAAAK)n (SEQ ID NO: 11), (SGGS)n (SEQ ID NO: 12), or (XP)n (SEQ ID NO: 13) motif, or a combination of any of these, wherein n is independently an integer between 1 and 30, and wherein X is any amino acid. It is to be understood that the linker lengths described as examples here are not meant to be limiting.
Lipids
[0051] As disclosed herein, one or more lipid molecules can be conjugated to the one or more keratin binding moieties of the engineered keratin-binding constructs. Lipids that can be used in the engineered keratin-binding constructs include all lipid chains containing a linear chain of carbon with 6 to 20 carbons that is fully saturated, all lipid chains containing a linear chain of carbon of 6 to 20 carbons that contains one or more double bonds (degree of unsaturation), all lipid chains and derivatives thereof containing a sterol or its derivative, and all lipid chains and derivatives thereof containing cholesterol or its derivative.
[0052] Specific lipids that can be used in the engineered keratin-binding constructs include those in the following non-limiting list of specific lipid molecules: myristoleic acid/alcohol/amine, palmitoleic acid/alcohol/amine, sapienic acid/alcohol/amine, oleic acid/alcohol/amine, elaidic acid/alcohol/amine, vaccenic acid/alcohol/amine, linoleic acid/alcohol/amine, linoelaidic acid/alcohol/amine, alpha linolenic acid/alcohol/amine, arachidonic acid/alcohol/amine, eicosapentaenoic acid/alcohol/amine, erucic acid/alcohol/amine, caprylic acid/alcohol/amine (octanoic acid/alcohol/amine), lauric acid/alcohol/amine, myristic acid/alcohol/amine, palmitic acid/alcohol/amine, lignoceric acid/alcohol/amine, arachidic acid/alcohol/amine, stearic acid/alcohol/amine, and sphingolipids including ceramide, sphingosine, sphingomyelin, alpha cerebroside, gangliosides, sulfatides, and phytosphingosine.
[0053] In addition, derivatives of the aforementioned lipid compounds can be used in bioconjugation reactions for bioconjugation to the keratin binding molecules. For example, the lipid may contain an aminooxy group for bioconjugation to a protein, but other reactive groups can be used instead as will be known to those of skill in the art. In addition, the aforementioned lipid compounds can be combined into di or tri-functional molecules via conjugation to a small molecule linker (for example, triglycerides, glycerophospholipids, sphingolipids, and sterol lipids), and used in bioconjugation reactions for bioconjugation to the keratin binding molecules.
Bioconjugation Reactions
[0054] Conjugates of keratin binding molecules to other molecules such as lipids or dyes, can be performed by a number of different reactions known in the art. For example, protein-lipid conjugates can be made by oxime formation, which produces a strong and stable bond between the protein and lipid. Oxime bioconjugation occurs in water and aqueous solvents and ambient environments. The protein molecule is stable during oxime chemistry bioconjugation. The resulting bioconjugated protein and lipid complex is stable on human hair through repeated hair washing.
[0055] Other methods of bioconjugation can be used in the preparation of engineered keratin-binding constructs, for example, NHS-amine coupling of the lipid to KBP.
[0056] Various additional reactions useful for bioconjugation with proteins are presented in Table 1 below. See also, Obermeyer and Olsen, ACS Macro Lett., 2015, 4(1): 101-110. In addition, small non-native/non-natural functional groups can be conjugated to the protein surface (e.g., enzymatically) for further functionalization. Some methodologies to modify these non-native/non-natural functional groups (bioorthogonal moieties), are shown in Scheme 2 of Obermeyer and Olsen, ACS Macro Lett., 2015, 4(1): 101-110.
TABLE-US-00001 TABLE 1 Amino Acid Bioconjugation Reaction Reagents lysine activated esters, reductive amination, thiazolidine-2-thione glutamine, aspartic acid amines and carbodiimides cysteine disulfides, maleimides, thiol-enes, dibromomaleimides and bis-sulfones tyrosine diazonium salts, Mannich-type coupling reagents, -allylpalladium complexes, cyclic diazodicarboxylate reagents, phenylenediamine reagents tryptophan p-phenylenediamine reagents, rhodium carbenoids N-terminus oxidation/alkoxyamines, Pictet-Spengler reagents
Compositions
[0057] Compositions disclosed herein may include one or more of the keratin-binding constructs disclosed herein, in combination with one or more cosmetic ingredients, surfactants, preservatives, emulsifiers, softeners, moisturizers, humectants, hydrolyzed proteins, reconstructors, acidifiers, acidity regulators, detanglers, polymers, glossers, lubricants, sequestrants, antistatic agents, sunscreens, thermal protectors, conditioners, buffers, stabilizers, thickeners, salts, emollients, antioxidants, alcohols, polysorbates, PEGs, polyquaternium polymers, quarternary ammonium compounds, fragrances, dyes or colors, oils, esters, fatty acids, bioactive additives, food products, silicones, and water.
[0058] In some embodiments, the compositions disclosed herein may be daily or frequent use products including but not limited to shampoos, conditioners, gels, mousses, pomades, anti-frizz agents, sprays, or hair dyeing products that may be applied to the hair as part of customary hair care procedures including washing, conditioning, dyeing, drying, and styling.
[0059] In some embodiments, the compositions may be for use in a salon. In some embodiments, the compositions may be suitable for home use.
[0060] The compositions may be liquids, solids, or gels, and can be filled and stored in any suitable container, including bottles, cartons, tubes, and canisters. The compositions disclosed herein may also be provided or used as part of a kit. In some embodiments, the kit is a hair repair kit, hair treatment kit or hair coloring kit.
Methods of Using the Engineered Keratin-Binding Constructs
[0061] The engineered keratin-binding constructs disclosed herein can be used to treat and/or repair damaged hair, prevent damage to hair, improve hair texture, moisture, shine and manageability. The above-described keratin-binding constructs may be used to treat, ameliorate, or improve hair that has suffered damage as a result of for example, sun damage, heat damage, chemical damage, and damage due to ageing. The engineered keratin-binding constructs may also be used prophylactically to prevent any such damage from occurring. The engineered keratin-binding constructs disclosed herein can be applied to the hair of a subject. The subject could be any mammal, preferably human. The engineered keratin-binding constructs disclosed herein can be applied by hand, applicator bottle, applicator brush, dropper, spray bottle, or by any other suitable method and/or applicator.
Methods of Making the Engineered Keratin-Binding Constructs
[0062] The engineered keratin-binding constructs disclosed herein can be made by expression in cells, or by synthetic methods. For example, if the engineered keratin-binding construct comprises a polypeptide, the polypeptide can be produced in cells such as bacterial or yeast cells. This can be done by standard methods, such as cloning a sequence encoding the engineered keratin-binding construct into an expression plasmid, introducing the recombinant expression plasmid into a cell, expressing the engineered keratin-binding construct polypeptide in the cell, and isolating the engineered keratin-binding construct polypeptide from the cell.
[0063] Alternatively, the engineered keratin-binding construct polypeptide can be synthesized using chemical synthesis according to standard synthetic protocols.
[0064] Optionally one or more modification methods can be performed on the engineered keratin-binding construct polypeptide (made by any method), such as contacting the polypeptide with tyrosinase to convert tyrosine to melanin, contacting the polypeptide with appropriately modified (e.g., functionalized) lipid(s) in the presence of reagents that result in bioconjugation of the lipid(s) to the polypeptide, and/or contacting the polypeptide with appropriately modified (e.g., functionalized) dye molecule(s) in the presence of reagents that result in bioconjugation of the dye molecule(s) to the polypeptide.
[0065] For engineered keratin-binding constructs that comprise a polypeptide and a non-polypeptide molecule, such as when two keratin-binding molecules are combined and one is not a polypeptide, the polypeptide can be produced in cells such as bacterial or yeast cells, or produced by synthetic methods, and then joined to the non-polypeptide keratin-binding molecule using linkers appropriate for the respective chemistries of the polypeptide and non-polypeptide keratin-binding molecule. Similar modifications as described above for the keratin-binding construct polypeptide can then be made to the keratin-binding construct that comprises a polypeptide and a non-polypeptide molecule.
EXAMPLES
Example 1: Structure and Synthesis of Exemplary Engineered Keratin-Binding Construct
[0066] An exemplary engineered keratin-binding construct was produced having the features and sequence (MAKTHHHHHHQGQVQHLQAAFSQYKKVELFPKGGQGQVQHLQAAFSQYKKVELF PKGGQGQVQHLQAAFSQYKKVELFPKGGYYYYC; SEQ ID NO: 2) shown in
[0067] This engineered construct provides a smaller molecule that can penetrate deep into hair fibers. The construct provides electrostatic interaction via the keratin-binding domain (hair carries a negative charge) and disulfide bonding to keratin proteins in hair via the C-terminal cysteine (see
[0068] In addition, the N-terminal amine is a site selective site for chemistry, providing a site for conjugation of lipid molecules (
[0069] A nucleic acid molecule encoding the exemplary engineered keratin-binding construct was prepared and cloned into a plasmid (For KBP in
[0070]
[0071]
[0072]
Example 2: Treatment of Damaged Hair
[0073] Chemically damaged hair shows bleached color and cuticle loss. As shown in
[0074] To provide damaged hair for treatment using the exemplary engineered keratin-binding construct, hair was incubated with 10% H2O2(v/v) in 0.1M Na2CO3/NaHCO3 (pH 9.0) buffer at 50 C. for 1 hr, and then the hairs were washed in deionized (DI) water.
[0075] For visualization of the effects of the exemplary engineered keratin-binding construct and demonstration of hair absorption, keratin-binding domain (peptide1 and peptide2) were conjugated to FITC as shown below for peptide2:
##STR00001##
[0076] Peptide1 is a keratin binding domain (AKTKKVELFPK; SEQ ID NO: 4). Peptide2 has the same keratin binding domain as peptide 1 plus a C-terminal cysteine (AKTKKVELFPKC; SEQ ID NO: 5).
[0077] Samples of healthy and damaged hair were incubated with the FITC-conjugated peptides at 37 C. for 1 hr, followed by washing the hair 10 times (
[0078] Damaged hair absorbed more of the FITC-labeled keratin binding peptides compared to healthy hair. Overall, peptide2-FITC bound to hair more than peptide1-FITC due to both physical and chemical interactions. Neither peptide1-FITC nor peptide1-FITC is shown as binding to healthy hair due to hydrophobic surfaces (hair cuticles). Compared to healthy undamaged hair, more labeled peptide was absorbed by damaged hair as shown in the fluorescence microscope images. This is because damaged hair has exposed keratin proteins.
Example 3: Expression of Exemplary Engineered Keratin-Binding Construct
[0079] Several different plasmids and cell types were assessed for optimal expression of the exemplary engineered keratin-binding construct. The sequence encoding the keratin-binding protein, with (KBPY) or without (KBP) tyrosine residues, was cloned into the plasmids pET20, pET22, pET23, and pCold. See
Example 4: Bioconjugation of Dye to the Exemplary Engineered Keratin-Binding Construct
[0080] Dye molecule (represented by a star) was conjugated to the exemplary engineered keratin-binding construct in a two-step process shown in
Example 5: Affinity of Keratin-Binding Protein for Damaged Hair
[0081] Keratin binding protein tagged with a fluorescent dye was incubated with damaged and undamaged (virgin) hair, and observed by fluorescence microscopy. The results are depicted in
[0082] The damaged hair incubated with keratin binding protein tagged with a fluorescent dye for varying amounts of time was then subjected to washing with shampoo. The results of fluorescence microscopy are shown in
Example 6: Thermal Stability of Keratin-Binding Protein
[0083] Keratin-binding protein, with (B22Y) or without (B22) tyrosine residues, was tested for thermal stability. Weight was measured as a function of increasing temperature. The results depicted in
Example 7: Immunogenicity of Keratin-Binding Protein (KBP) and KBP-Lipid Conjugates
[0084] Keratin-binding protein (B22) was tested for immune response by performing an IL-6 ELISA and IFN- ELISA. The effects of KBP and KBP-lipid conjugate on the immune response was assessed by measuring levels of IL-6 and IFN- in fibroblast cells. No protein was added to the cells as a negative control. Lipopolysaccharides (LPS) were used as a positive control. No production of IL-6 or IFN- was recorded, as shown in
Example 8: Solubility of Keratin-Binding Protein
[0085] Solubility tests were performed by adding keratin-binding protein to 7 different solvents at concentrations of 2.5 mg protein/10 mL solvent. As shown in
Example 9: Effects of Keratin-Binding Protein on Hair
[0086] Undamaged (virgin) hair has intact, covered cuticles, and thus a more hydrophobic surface. The effects of keratin-binding protein on the hair was assessed by measuring the water contact angle, as the water contact angle varies depending on the level of damage to the hair follicle. The water contact angles for damaged and undamaged hair tested are shown in
[0087] Samples of untreated hair, hair treated with surfactant, hair treated with keratin-binding protein, and hair treated with a KBP-lipid conjugate were examined using scanning-electron microscopy. The results are depicted in
TABLE-US-00002 TABLE 2 Keratin-binding molecules and reference therefor Reference Protein trichoplein J Cell Sci. 2005 Mar. 1; 118(Pt 5): 1081-90. pneumococcal serine rich repeat Open Biol. 2014 Jan. 15; 4: 130090. doi: protein (PsrP) 10.1098/rsob.130090. serine rich repeat protein-1 (Srr-1) https://doi.org/10.1016/j.ijbiomac.2014.12.048 plectin http://jcb.rupress.org/content/jcb/183/1/19.full.pdf trichohyalin http://jcs.biologists.org/content/118/5/1081 myosin Journal of Cell Science 118, 1081-1090 TNF receptor 1-associated protein http://jcs.biologists.org/content/joces/118/5/1081.full.pdf of TRADD Anti-Fas-binding factor 1 J Cell Biol. 2008 Oct. 6; 183(1): 19-28 (Albatross) BMP http://journals.plos.org/plosone/article?id=10.1371/journal.pone.0137233 14-3-3 proteins https://www.ncbi.nlm.nih.gov/pmc/articles/PMC123655/pdf/pq0702004373.pdf plectin homology domain (TPHD) https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2557036/pdf/jcb1830019.pdf Desmoplakin J Cell Biol. 1993 November; 123(3): 691-705. The amino end of pinin http://www.jbc.org/content/275/20/14910.full Vitronectin v1tronectin binds to uratin filaments modified wheat gluten DOI: 10.1098/rsos.171216 pulmonary-associated surfactant https://onlinelibrary.wiley.com/doi/epdf/10.1002/prot.24037 protein D p27kip1 https://www.aaas.org/abstract/keratin-17-maintains- proliferation-binding-p27kip1-and-facilitating-its- nuclear-export Small molecules Primaquine http://europepmc.org/abstract/med/12711178 keratin binding polypeptides https://patentscope.wipo.int/search/en/detail.jsf?docId= WO2005115306&recNum=1&maxRec=&office=& prevFilter=&sortOption=&queryString=&tab=PCT+ Biblio; https://patents.justia.com/patent/20090156485
[0088] All references, patents and patent applications disclosed herein are incorporated by reference with respect to the subject matter for which each is cited, which in some cases may encompass the entirety of the document.
[0089] The indefinite articles a and an, as used herein in the specification and in the claims, unless clearly indicated to the contrary, should be understood to mean at least one.
[0090] It should also be understood that, unless clearly indicated to the contrary, in any methods claimed herein that include more than one step or act, the order of the steps or acts of the method is not necessarily limited to the order in which the steps or acts of the method are recited.
[0091] In the claims, as well as in the specification above, all transitional phrases such as comprising, including, carrying, having, containing, involving, holding, composed of, and the like are to be understood to be open-ended, i.e., to mean including but not limited to. Only the transitional phrases consisting of and consisting essentially of shall be closed or semi-closed transitional phrases, respectively, as set forth in the United States Patent Office Manual of Patent Examining Procedures, Section 2111.03.