CHIMERIC ANTIGEN RECEPTOR THERAPY WITH REDUCED CYTOTOXICITY FOR VIRAL DISEASE
20190307798 ยท 2019-10-10
Inventors
- Robert Layne Kruse (Houston, TX, US)
- Karl-Dimiter Bissig (US)
- Stephen M. G. Gottschalk (Houston, TX, US)
- Thomas C. T. Shum (Houston, TX, US)
Cpc classification
A61K39/4611
HUMAN NECESSITIES
A61K35/17
HUMAN NECESSITIES
C07K2319/33
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
A61K2239/38
HUMAN NECESSITIES
A61P1/16
HUMAN NECESSITIES
International classification
A61K35/17
HUMAN NECESSITIES
C12N15/11
CHEMISTRY; METALLURGY
A61P1/16
HUMAN NECESSITIES
Abstract
Embodiments of the disclosure encompass immunotherapy for Hepatitis B viral (HBV) infection in an individual in need thereof. The immunotherapy comprises one or more chimeric antigen receptors (CAR) that target a HBV antigen, including CAR molecules that utilize specific scFv antibodies. In certain cases, the CAR comprises one or more mutations to reduce binding to Fc receptors. In specific aspects, cells that express the CAR(s) have reduced cytotoxicity that is safer and/or beneficial to individuals that are immunocompromised.
Claims
1. A polynucleotide encoding a chimeric antigen receptor (CAR), wherein the CAR comprises one or more agents that target one or more Hepatitis B antigens and wherein the one or more agents is not C8 single chain variable fragment (scFv) or 5a19 scFv.
2. The polynucleotide of claim 1, wherein the one or more agents that target a hepatitis B antigen is a single chain antibody, single chain variable fragment (scFv), peptide, camelid variable domain, shark IgNAR variable domain, single domain antibody, affimer or VHH antibody.
3. The polynucleotide of claim 2, wherein the scFv is derived from monoclonal antibody 19.79.5, 17.1.41, OST577, A5, VHH-S4, VHH-S5, HzKR127, KR359, 2B6, 2D9, 2E7, 2G3, ADRI-2F3, E6F6, HB-C7A, or 1C9.
4. The polynucleotide of claim 2, wherein the peptide targeting hepatitis B antigen is Peptide A5, Peptide ETGAKPH, Peptide P7, Peptide pC, Peptide p2, Peptide p5, Peptide p18, Peptide 4B10, or Peptide SRLLYGW.
5. The polynucleotide of claim 1, wherein the CAR comprises a linker region of at least two immunoglobulin domains.
6. The polynucleotide of claim 5, wherein the linker region comprises an IgG Fc region.
7. (canceled)
8. The polynucleotide of claim 6, wherein the IgG Fc region is from IgG4.
9. The polynucleotide of claim 6, wherein the IgG Fc region comprises one or more mutations.
10. The polynucleotide of claim 9, wherein the CAR has reduced binding to an Fc Receptor.
11. The polynucleotide of claim 9, wherein the IgG Fc region lacks the CH2 domain, has a CH2 domain from a different IgG, or has an immunoglobulin domain from a different human protein.
12. The polynucleotide of claim 11, wherein the different human protein is CD4, Cd8, CD19, or CD22.
13. The polynucleotide of claim 12, wherein the IgG Fc region is the IgG2 Fc region that comprises the IgG4 CH2 domain instead of the native IgG2 CH2 domain.
14. The polynucleotide of claim 1, wherein a mutation is in the glycosylation site of the IgG Fc domain or in the hinge region of the Fc domain.
15. (canceled)
16. (canceled)
17. (canceled)
18. (canceled)
19. (canceled)
20. (canceled)
21. The polynucleotide of claim 1, wherein the CAR lacks one or more signaling endodomains that trigger perforin secretion or granzyme secretion or has a mutation in one or more residues for signaling in the signaling endodomain(s)
22. The polynucleotide of claim 1, wherein the CAR lacks the zeta chain or has a mutation in the zeta chain disrupting optimal signaling.
23. The polynucleotide of claim 1, wherein the CAR lacks the CD16 gamma chain.
24. (canceled)
25. (canceled)
26. (canceled)
27. (canceled)
28. A cell, comprising the polynucleotide of claim 1.
29. (canceled)
30. (canceled)
31. The cell of claim 28, wherein the cell is an immune cell.
32. The cell of claim 27, wherein the immune cell is a T cell, NK cell, NK T cell, macrophage, or monocyte.
33. (canceled)
34. The cell of claim 28, wherein the cell is present in a plurality of cells that lack CD45RA-positive cells.
35. The cell of claim 28, wherein the cell is a T cell that lacks native T-cell receptors or has reduced levels of native T-cell receptors compared to a normal T cell.
36. The cell of claim 35, wherein the cell is genetically modified by a CRISPR/Cas9, TALE nuclease, meganuclease, homing endonuclease, zing finger nuclease system, or via homology-directed repair without nuclease enzymes to lack native T-cell receptors or have reduced level of native T-cell receptors.
37. The cell of claim 35, wherein the cell is genetically modified to lack or have a reduced level of one or more genes that encode one or more components of TCRalpha, TCRbeta, or both.
38. (canceled)
39. (canceled)
40. (canceled)
41. (canceled)
42. The cell of claim 28, wherein the cell comprises an engineered receptor that is different from the receptor encoded by the polynucleotide.
43. The cell of claim 42, wherein the engineered receptor is a CAR, chimeric cytokine receptor, membrane-bound antibody, or ?? T cell receptor.
44. The cell of claim 42, wherein the engineered receptor binds to a different epitope of an HBV antigen not targeted by the receptor encoded by the polynucleotide.
45. The cell of claim 44, wherein the engineered receptor and the receptor encoded by the polynucleotide associate with each other in order to generate synergistic affinity.
46. The cell of claim 42, wherein the engineered receptor comprises one or more agents that target a Hepatitis B antigen.
47. (canceled)
48. (canceled)
49. (canceled)
50. (canceled)
51. (canceled)
52. (canceled)
53. (canceled)
54. The cell of claim 28, wherein the cell is an allogeneic NK-T cell with restricted T cell receptor to CD1d.
55. The cell of claim 28, wherein the cell comprises a genetic knockout of MHC class I and/or MHC class II expression.
56. The cell of claim 55, wherein the cell comprises a genetic knockout of RFX and/or CIITA.
57. (canceled)
58. (canceled)
59. (canceled)
60. A method of treating an individual for hepatitis B, comprising the step of delivering to the individual a therapeutically effective amount of cells of claim 25.
61. The method of claim 60, wherein the individual is immunocompromised.
62. The method of claim 60, wherein the individual has cirrhotic HBV infection, allograft infection or chronic kidney disease.
63. The method of claim 60, wherein the cells are T cells that lack native T-cell receptors or have reduced levels of native T-cell receptors compared to normal T cells.
64. The method of claim 60, wherein the individual is lymphodepleted prior to administration of the cells.
65. The method of claim 60, wherein the cells are irradiated prior to the delivering step.
66. (canceled)
67. (canceled)
68. (canceled)
69. (canceled)
70. The method of claim 60, wherein the cells are allogeneic or autologous to the individual.
71. The method of claim 60, wherein the cell comprises an engineered receptor other than the receptor encoded by the polynucleotide.
72. The method of claim 61, wherein the engineered receptor is a CAR, chimeric cytokine receptor, membrane-bound antibody, or ?? T cell receptor.
73. (canceled)
74. (canceled)
75. (canceled)
76. (canceled)
77. (canceled)
78. (canceled)
79. (canceled)
80. (canceled)
81. (canceled)
82. The method of claim 60, wherein the individual is given an additional therapy for Hepatitis B infection.
83. The method of claim 60, wherein prior to, during, and/or after the delivery of the cells the individual is given a therapeutically effective amount of one or more antibodies that recognize a Hepatitis B antigen.
84. (canceled)
85. (canceled)
86. (canceled)
87. (canceled)
88. (canceled)
89. (canceled)
90. A method of generating HBV-targeting CAR-positive cells in an individual, comprising the step of administering a vector that expresses an HBV-targeting CAR directly into the bone marrow of the individual for in vivo transduction of cells.
91. (canceled)
92. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
DETAILED DESCRIPTION
[0057] As used herein, the use of the word a or an when used in conjunction with the term comprising in the claims and/or the specification may mean one, but it is also consistent with the meaning of one or more, at least one, and one or more than one. Some embodiments of the invention may consist of or consist essentially of one or more elements, method steps, and/or methods of the invention. It is contemplated that any method or composition described herein can be implemented with respect to any other method or composition described herein.
I. General Embodiments
[0058] The present disclosure discloses a novel immunotherapy therapy platform that is useful in treating viral diseases in individuals. In a specific embodiment, the disclosure concerns therapy for hepatitis B virus (HBV). In particular aspects the HBV therapy comprises immunotherapy using one or more chimeric antigen receptors (CARs).
[0059] In specific embodiments, the CAR comprises one or more specific elements that facilitate its use for HBV therapy. Particular single chain antibodies described herein are suitable for function in the CAR, in specific embodiments. For example, in some cases an optimal length for the spacer domain of the CAR is utilized in order to target a certain viral surface antigen, as well as some embodiments that utilize mutations and designs in the molecule in order to make the CAR inert and avoid binding of off-target receptors, namely the Fc receptor. The disclosure further describes methods of targeting multiple viral antigens or epitopes in order to maximize the diversity of serotypes/genotypes covered by a single therapeutic product. In other embodiments, there are methods of tailoring the CAR therapy to a desired outcome, for example either a cytopathic T cell response, or a non-cytopathic cytokine driven T cell response. Regarding the latter, the inventors have designed strategies to suppress or knockout particular proteins (for example perform, granzymes, Fas, TNF-alpha) in cytotoxic function, thereby producing T cells that have reduced, or no, cytotoxic function. This is useful for reducing liver toxicity in HBV wherein target organ damage should be minimized, allowing it to be a safer therapy, lending to a more off-the-shelf strategy. The disclosure also concerns the combination of CAR therapy with safety systems in order to avoid tissue damage in certain clinical scenarios.
II. Examples of Chimeric Antigen Receptors (CARs)
[0060] Embodiments of the disclosure utilize one or more CAR compositions that target one or more HBV antigens. The CARs in both polynucleotide form and protein form are encompassed herein, including as they may reside in a cell in either form, for example. The CAR is chimeric, non-natural and engineered at least in part by the hand of man. The one or more components of the CAR facilitate targeting or binding of a cell that expresses it to the desired antigen-comprising tissue, cell, or soluble particle and/or molecule.
[0061] The CAR may be of any kind, including first generation (e.g., a CAR comprising a primary signaling domain such as CD3?), second generation (e.g., a CAR comprising a primary signaling domain such as CD3?, in combination with a co-stimulatory domain), or third generation (e.g., a CAR comprising a primary signaling domain such as CD3?, in combination with two or more co-stimulatory domains). In particular embodiments, the CAR comprises one or more agents that target one or more hepatitis B antigens. In some cases the CAR targets multiple antigens or epitopes because it comprises as the agent(s) two or more antigen binding domains on the same ectodomain. The one or more agents may be of any kind, but in specific aspects they are one of a single chain antibody, a single chain variable fragment (scFv), peptide, a single domain, camelid antibody, single domain or VHH antibody. Specific scFv molecules may or may not be utilized. In specific aspects, the CARs described herein do not comprise antibody C8 or 5a19, or a binding portion of C8 or 5a19, e.g., a C8 scFv or a 5a19 scFv. In certain specific aspects provided herein is any of the CARs described herein that comprises C8 scFv or 5a19 scFv. In particular embodiments, a CAR provided herein comprises an scFv from antibodies 19.79.5 19.79.5 scFv, 17.1.41 scFv, and/or OST577 scFv are employed in the CAR. In specific embodiments, human scFvs are utilized in CAR molecules, because multiple infusions would cause an immunogenic reaction to any mouse scFvs or any peptide strategies (as examples). In an alternative embodiment, non-human scFvs (ex: mouse, rat, rabbit) are utilized. In some cases, peptide strategies are utilized.
[0062] In specific embodiments, CARs using a hinge domain that is from derivatives of Fc receptors are utilized, and they may possess inherent dimeric binding of two single CAR molecules, as mediated through the disulfide bond formation in the flexible hinge domain of the Fc fragment, as well as hydrophobic interactions between the two CH3 domains. In particular embodiments, when two different CAR molecules both with Fc based domains are expressed in the same cell, they could either pair with each other, or with themselves in forming the steady state dimeric CAR molecule. This may be considered random pairing then, because it is uncontrollable, but in specific embodiments of the disclosure it is advantageous because engaging multiple epitopes on a viral HBsAg particle improves affinity, thereby helping to prevent viral escape. Thus, in some embodiments the CAR complex is a heterologously paired CAR formed from two molecules yielding a dimer, wherein two different CARs are co-expressed, allowing random pairing of their antibody linkers, creating enhanced affinity for target infected cell or pathogen.
[0063] In particular aspects, the CAR comprises a linker that operably links one or more ectodomains of the CAR (that comprise the one or more agents that target HBV) with one or more endodomains. The linker comprises one or more (including at least two) immunoglobulin domains, in certain cases, and in specific embodiments the linker comprises at least one IgG Fc region. The IgG Fc region may be of any kind, but in specific embodiments it is from IgG1, IgG2, IgG3, or IgG4. Although in some cases the IgG Fc region is wild type and thereby allows the CAR molecule to bind Fc receptors, in some cases it is desired to prevent binding to Fc receptors or at least to have reduced binding to Fc receptors compared to standard conditions. Such reduction in binding allows the cells expressing the CARs to have improved persistence in vivo. Thus, in certain embodiments, the IgG Fc region comprises one or more mutations that render it unable to bind a Fc receptor. Although the mutation may be of any kind and could be tested for Fc receptor binding using routine methods in the art, in specific embodiments the mutation is in the antibody hinge domain, CH2 domain, CH3 domain, or both, and/or in certain cases the mutation is in a glycosylation site of the IgG Fc region (for example, of Asn.sup.297 in CH2 domain). In certain cases, a CH2 domain that is different from the CH2 domain of the IgG Fc region being used in the CAR is employed. For example, one may exchange a CH2 domain of IgG4 with the CH2 domain of IgG2. The CH2 domain may be removed, or the CH2 and CH3 domains are removed. In these cases, they may be replaced with immunoglobulin-like domains from other human proteins.
[0064] In certain embodiments, one or more endodomains, for example cytoplasmic signaling domains, such as those derived from the T cell receptor zeta-chain, are employed as at least part of the CAR in order to produce stimulatory signals for cell proliferation and effector function following engagement of the CAR with the target antigen. Certain co-stimulatory domains or combinations thereof may be employed. Examples would include, but are not limited to, endodomains from co-stimulatory molecules such as CD28, 4-1BB, OX40, CD27, DAP10, or ICOS. In particular embodiments, co-stimulatory molecules are employed to enhance the activation, proliferation, and cytotoxicity of T cells produced by the CAR after antigen engagement. In at least certain cases the CAR employs the CD3 zeta chain, whereas in other cases it lacks the CD3 zeta chain and/or the CD16 gamma chain.
[0065] In particular aspects the linker of the CAR is of a certain length, for example, to allow sufficient access to the antigen to which the CAR is targeting. An appropriate length may be determined by one of skill in the art using methods as described herein, for example. In particular embodiments the linker is at least a certain number of amino acids in length and/or in is no more than a certain number of amino acids in length. In particular aspects the linker is greater than 100 amino acids and/or less than 500 amino acids in length. In some cases, the linker is at least or no more than 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, or 500 amino acids in length.
[0066] In particular embodiments, the CAR comprises one or more of a linker region that is between 100-500 amino acids in length, a CD8 alpha stalk, an IgG Fc region, and/or comprised one or more immunoglobulin domains. In specific aspects, the IgG Fc region comprises a) one or more mutations to disrupt FcR binding, b) a deletion of the CH2 domain, and/or c) replacement of the CH2 domain, for example with another immunoglobulin domain from a different human protein (such as an immunoglobulin from an alternative human protein selected from human CD4 domains D2 through D4). Mutations that disrupt FcR binding may be located in the hinge region and/or glycosylation site of IgG Fc domain (including IgG1 Fc domain, IgG2 Fc domain, or IgG4 Fc domain, for example.
[0067] Also provided herein are polynucleotides that encode the HBsAg-specific CARs disclosed herein. In certain embodiments, the polynucleotide is comprised within an expression vector. The expression vector may be either a viral vector or non-viral vector (such as a plasmid). Viral vectors that can be used to express the CARs provided herein include adenoviral vectors, lentiviral vectors, retroviral vectors, and adeno-associated viral vectors, for example. The expression vector may or may not also comprise a region that encodes a gene product other than the CAR, such as another type of engineered receptor (another CAR, a chimeric cytokine receptor, membrane-bound antibody, or an ?? T cell receptor, for example) and/or one or more siRNAs or shRNAs or miRNAs to knock down, or knock out, expression of one or more genes in an immune cell expressing the CAR, and so forth. In some cases the siRNA or shRNA or miRNA targets a gene associated with the endogenous T cell receptor (including component genes of TCRalpha, TCRbeta, or both, such as to prevent graft versus host disease in allogeneic T cell products. Specific examples of siRNA or shRNA targets include perforin, granzyme A, granzyme B, granzyme C, granzyme D, Fas receptor, Fas ligand, TRAIL, MHC class I molecules, MHC Class II molecules, and/or beta-2 microglobulin. When the expression vector expresses both the CAR and a second region that encodes a gene product other than the CAR, the regulation of the two coding regions may or may not occur through the same regulatory region. One or both of the encoded products may or may not be labeled.
[0068] In a particular embodiment, the components of the CAR in the polynucleotide that encodes it are in a particular order so that the expressed CAR protein has the corresponding domains in a particular order. For example, in particular embodiments the transmembrane domain is configured between the ectodomain (for example, the scFv domain) and the endodomain, and all components are operably linked. In specific embodiments, the order of the domains in the encoded CAR protein is N-terminus-antibody-transmembrane domain-endodomain-C terminus, although in certain cases the order of the domains in the encoded CAR protein is N-terminal-endodomain-transmembrane domain-antibody-C terminus. Of course, other domains may be inserted within this configuration, with care being taken to place it on the appropriate side of the transmembrane domain to be located inside the cell or on the surface of the cell. Those domains that need to be intracellular need to be on the flank of the transmembrane domain in the protein that the endodomain is located, for example. Those domains that need to be extracellular need to be on the flank of the transmembrane domain in the protein that the antibody is located.
[0069] In certain embodiments, a CAR that directs an immune cell or stem cell to one or more HBV antigens comprises (1) an extracellular antigen-binding domain that binds to the HBV antigen, and (2) an intracellular domain that comprises a primary signaling moiety, e.g., a CD3? chain, that provides a primary T cell activation signal, and optionally one or more costimulatory moieties, e.g., a CD28 polypeptide and/or a 4-1BB (CD137) polypeptide. In particular cases, the CAR is specific for one or more HBV antigens, and in certain embodiments, the present disclosure provides chimeric immune cells (such as T cells) specific for the HBV antigen by joining an extracellular antigen-binding domain derived from a HBV antigen-specific antibody to cytoplasmic signaling domain(s) derived from the T-cell receptor ?-chain, with the endodomain(s) of certain costimulatory molecules (CD28 and OX40, for examples). This CAR is expressed in human cells and the targeting of HBV-positive cells or tissue is encompassed in the disclosure. In particular embodiments, a CAR specific for one or more HBV antigens refers to a CAR having at least one single chain antibody that recognizes an HBV antigen. In specific cases a CAR comprises 1) an ectodomain with affinity toward a HBV protein, 2) a linker region, and 3) an endodomain with one or more activation motifs (and may comprise multiple different endodomains in various combinations). In specific embodiments, the ectodomain comprises a peptide, a single chain antibody, a single chain variable fragment, or a camelid antibody. In some embodiments, there may be two or more ectodomains that target HBV antigens within a single CAR molecule. In certain aspects, the endodomain comprises one or more of a zeta signaling domain, a CD16 gamma chain, a CD28 signaling region, a 4-1BB signaling region, and/or an OX40 endodomain, although in other cases some of these elements are lacking. See, e.g., Yagyu et al., Mol. Ther. 23(9):1475-1485 (2015).
[0070] In particular embodiments, an expression vector comprises an inducible safety switch for cell death, such as a protein (e.g., Fas, caspase 8, or caspase 9, or variants thereof for example) that is dimerizable, and activated upon dimerization, using, e.g., a small molecule compound such as FK506 (tacrolimus) or a variant thereof, a divalent receptor, an antibody, or the like. In particular embodiments, an expression vector comprises an inducible safety switch encompassing a fusion protein with one component binding a small molecule inducer and the second component comprises part or all of Fas, caspase 8, or caspase 9 in order to trigger apoptosis.
[0071] Peptides can also be used as the agent targeting a CAR disclosed herein to HBV, e.g., to HBsAg. In certain embodiments, the CARs provided herein comprise one of the peptides listed below as an HBV targeting agent:
TABLE-US-00001 PeptideA5(targetsPreS1,ReferencePMID: 24966187): SGSGLKKKWST (SEQIDNO:1) PeptideETGAKPH(targetsHBsAg,ReferencePMID: 16087122): CETGAKPHC (SEQIDNO:2) PeptideP7(targetsPreS1,ReferencePMID: 21856287): KHMHWHPPALNT (SEQIDNO:3) PeptidepC(targetsPreS1,ReferencePMID: 17192308): SGSGWTNWWST (SEQIDNO:4) Peptidep2(targetsPreS1,ReferencePMID: 17192308): NNWWYWWDTLVN (SEQIDNO:5) Peptidep5(targetsPreS1,ReferencePMID: 17192308): GLWRFWFGDFLT (SEQIDNO:6) Peptidep18(targetsPreS1,ReferencePMID: 17192308): WTDMFTAWWSTP (SEQIDNO:7) Peptide4B10(targetsPreS1,ReferencePMID: 27384014): LRNIRLRNIRLRNIRLRNIR (SEQIDNO:8) PeptideSRLLYGW(targetsPreS1,ReferencePMID: 15996026): CSRLLYGWC (SEQIDNO:9)
[0072] In some embodiments, two or more of such peptides will form a bispecific CAR, wherein a peptide and scFv against different HBsAg epitopes or proteins are joined in tandem to result in bivalent binding. Particular embodiments utilize a PreS1 binding peptide in conjunction with an antibody that binds to the small HBsAg protein.
[0073] Specific CAR molecules may be as follows: a) a chimeric antigen receptor having the sequence to target Hepatitis B virus: 19.79.5 scFv-G4m-CD28-CD3 zeta; and b) a chimeric antigen receptor lacking cytolytic effects having the sequence: 19.79.5 scFv-G4m-CD28-41BB, where G4m refers to an example of a mutated version of the IgG4 Fc region lacking Fc receptor binding. However, other CAR molecules having different scFv antibodies, different linkers, and different endodomains and combinations thereof are contemplated herein.
Sequences of exemplary molecules used in particular embodiments are as follows (where 19.79.5 scFv is referred to as XTL19):
TABLE-US-00002 XTL19-IgG4m-CD28-Zeta(thus,aCAR comprisingtheXTL19scFv,amutatedIgG4Fc region,aCD28costimulatorydomain,anda zetachain) (SEQIDNO:10) MDWIWRILFLVGAATGAHSQVQLVESGGGVVQPGGSLRLSCAPSGFVFRS YGMHWVRQTPGKGLEWVSLIWHDGSNRFYADSVKGRFTISRDNSKNTLYL QMNSLRAEDTAMYFCARERLIAAPAAFDLWGQGTLVTVSSGGGGSGGGGS GGGGSSYVLTQPPSVSVAPGKTARISCGGNNIGTKNVHWYQQKPGQAPVL VVYADSDRPSGIPERFSGSNSGNTATLTISRVEVGDEADYYCQVWDSVSY HVVFGGGTTLTVLGSGGGGSESKYGPPCPSCPAPPVAGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFQST YRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVY TLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSPGKKD PKFWVLVVVGGVLACYSLLVTVAFIIRVKFSRSADAPAYQQGQNQLYNEL NLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEI GMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR XTL19-IgG4m-CD28-OX40(thus,aCAR comprisingtheXTL19scFv,amutatedIgG4Fc region,aCD28costimulatorydomain,andan OX40costimulatorydomain) (SEQIDNO:11) MDWIWRILFLVGAATGAHSQVQLVESGGGVVQPGGSLRLSCAPSGFVFRS YGMHWVRQTPGKGLEWVSLIWHDGSNRFYADSVKGRFTISRDNSKNTLYL QMNSLRAEDTAMYFCARERLIAAPAAFDLWGQGTLVTVSSGGGGSGGGGS GGGGSSYVLTQPPSVSVAPGKTARISCGGNNIGTKNVHWYQQKPGQAPVL VVYADSDRPSGIPERFSGSNSGNTATLTISRVEVGDEADYYCQVWDSVSY HVVFGGGTTLTVLGSGGGGSESKYGPPCPSCPAPPVAGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFQST YRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVY TLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSPGKKD PKFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPG PTRKHYQPYAPPRDFAAYRSRDQRLPPDAHKPPGGGSFRTPIQEEQADA HSTLAKI XTL17-IgG4m-CD28-Zeta(thus,aCAR comprisingtheXTL17scFv(17.1.41scFv),a mutatedIgG4hinge,aCD28costimulatory domain,andazetachain) (SEQIDNO:12) MDWIWRILFLVGAATGAHSQVQLVESGGGVVRPGRSLRLSCAASGFAFSD YSINWVRQAPGKGLEWVAIISYDGRITYYRDSVKGRFTISRDDSKNTLYL QMNSLRTEDTAVYYCARQYYDFWSGSSVGRNYDGMDVWGLGTTVTVSSGG GGSGGGGSGGGGSDIVMTQSPLSLSVTPGEPASISCRSSQSLLHRSGNNY LDWYLQKPGHSPQLLIYVGSNRASGVPDRFSGSGSGTEYTLRISTVEAED VGVYYCMQALQTPRTFGQGTKLEIKRSGGGGSESKYGPPCPSCPAPPVAG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNA KTKPREEQFQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTI SKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHY TQKSLSLSPGKKDPKFWVLVVVGGVLACYSLLVTVAFIIRVKFSRSADAP AYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNE LQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPP R OST577-IgG4m-CD28-Zeta(thus,aCAR comprisingtheOST577scFv,amutatedIgG4 hinge,aCD28costimulatorydomain,anda zetachain) (SEQIDNO:13) MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCAASGFTFSR YGMHWVRQAPGKGLEWVAVISYDGSNKWYADSVKGRFTISRDNSKNTLFL QMHSLRAADTGVYYCAKDQLYFGSQSPGHYWVQGTLVTVSSGGGGSGGGG SGGGGSQSQLTQPPSVSVAPGQTARITCGGDNIGSKSVNWFQQKPGQAPV LVVYDDNERPSGISERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSS DHVVFGGGTKLTVLSGGGGSESKYGPPCPSCPAPPVAGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFQST YRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVY TLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSPGKKD PKFWVLVVVGGVLACYSLLVTVAFIIRVKFSRSADAPAYQQGQNQLYNEL NLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEI GMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR AnexampleofashRNAsequenceagainstperforin isasfollows(whereboldrepresentstargeted sequencestomRNAfordegradationanditalics istheloopregionofRNAmolecule): (SEQIDNO:14) GACCCACCAGGACCAGTACCTACACAAAGTACTGGTCCTGGTGGGTC (fromPMID:18393317) HumanmicroRNA150sequence(decreases cytotoxicityineffectorcells): (SEQIDNO:15) CUCCCCAUGGCCCUGUCUCCCAACCCUUGUACCAGUGCUGGGCUCAGACC CUGGUACAGGCCUGGGGGACAGGGACCUGGGGAC HumanmicroRNA27sequence: (SEQIDNO:16) CUGAGGAGCAGGGCUUAGCUGCUUGUGAGCAGGGUCCACACCAAGUCGUG UUCACAGUGGCUAAGUUCCGCCCCCCAG
[0074] Alternative hinge domain for a chimeric antigen receptor with Domain 3 of human CD4 (114 aa's) in bold inserted for the CH2 domain of IgG1 Fc region (113 aa's), and GSG linker on N-terminus of domain follows. In specific cases, the hinge is located between the single chain variable fragment and the transmembrane domain, and replicates the same size as a fully IgG Fc domain based hinge.
TABLE-US-00003 (SEQIDNO:17) EPKSCDKTHTCPPCPGSGFQKASSIVYKKEGEQVEFSFPLAFTVE KLTGSGELWWQAERASSSKSWITFDLKNKEVSVKRVTQDP KLQMGKKLPLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVM GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGKK
[0075] An example of IgG4m sequence is as follows, including a BamHI site at the beginning for cloning, with the subsequent sequence being a codon-optimized sequence for human IgG4 Fc domain with hinge, while also containing mutations to abrogate receptor binding:
TABLE-US-00004 (SEQIDNO:18) GGATCCGAGAGTAAATACGGGCCGCCATGTCCTTCCTGCCCAGCCCCGCC CGTGGCTGGCCCCTCCGTTTTCCTATTCCCTCCCAAGCCGAAGGATACCT TGATGATcTCACGCACGCCAGAGGTTACTTGCGTCGTCGTTGATGTTTCA CAGGAAGATCCTGAGGTCCAATTTAACTGGTATGTAGATGGAGTCGAGGT GCATAACGCAAAGACGAAACCgCGgGAAGAGCAGTTCCAATCAACTTACA GGGTGGTGAGTGTCCTGACAGTGTTACACCAGGACTGGCTCAACGGGAAG GAGTACAAGTGCAAAGTAAGTAACAAGGGACTGCCCAGCTCTATCGAGAA AACAATTTCCAAGGCCAAGGGTCAGCCaCGAGAACCACAAGTcTACACAC TCCCCCCCTCGCAGGAAGAAATGACCAAGAATCAGGTAAGCCTGACATGT CTTGTCAAAGGCTTCTATCCAAGCGACATCGCGGTGGAGTGGGAGTCCAA TGGACAGCCCGAAAACAAcTATAAAACCACCCCTCCAGTGCTGGACAGCG ACGGCTCCTTTTTTCTTTATagcAGACTGACCGTGGACAAATCTCGGTGG CAGGAAGGTAATGTGTTTTCTTGTAGCGTGATGCATGAGGCTCTG CACAACCACTACACGCAGAAGAGCCTCTCCCTGTCT CCGGGTAAA IgG4maminoacidsequence: (SEQIDNO:19) GSESKYGPPCPSCPAPPVAGPSVFL FPPKPKDTLMISRTPEVTCVVVDVS QEDPEVQFNWYVDGVEVHNAKTKPR EEQFQSTYRVVSVLTVLHQDWLNGK EYKCKVSNKGLPSSIEKTISKAKGQ PREPQVYTLPPSQEEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSRLTVDKSRW QEGNVFSCSVMHEALHNHYTQKSLS LSPGK
[0076] Additional single chain variable fragments that can be employed in chimeric antigen receptors are listed below:
[0077] scFv A5 (against HBsAg, Reference PMID: 14597165)
[0078] VHH-S4 (against HBsAg, Reference PMID: 19085971)
[0079] VHH-S5 (against HBsAg, Reference PMID: 19085971)
[0080] HzKR127 (against PreS1, Reference PMID: 18176536)
[0081] KR359 (against PreS1, Reference PMID: 10772975)
[0082] 2B6 (against PreS1, Reference PMID: 26888694)
[0083] 2D9 (against PreS1, Reference PMID: 26888694)
[0084] 2E7 (against PreS1, Reference PMID: 26888694)
[0085] 2G3 (against PreS1, Reference PMID: 26888694)
[0086] ADRI-2F3 (against HBsAg, Reference PMID: 25923526)
[0087] E6F6 (against HBsAg, Reference PMID: 26423112)
[0088] HB-C7A (against HBsAg in chimps, Reference PMID: 18479762)
[0089] scFv 1C9 (against HBV core protein, PMID: 10385671
III. Examples of Cells Expressing the CAR Compositions
[0090] In specific cases a cell is transduced with a CAR of the disclosure. As used herein, the terms cell, cell line, and cell culture may be used interchangeably. All of these terms also include their progeny, which is any and all subsequent generations. It is understood that all progeny may not be identical due to deliberate or inadvertent mutations. In the context of expressing a heterologous nucleic acid sequence, host cell refers to a eukaryotic cell that is capable of replicating a vector and/or expressing a heterologous gene encoded by a vector. A host cell can, and has been, used as a recipient for vectors. A host cell may be transfected or transformed, which refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell. A transformed cell includes the primary subject cell and its progeny. As used herein, the terms engineered and recombinant cells or host cells are intended to refer to a cell into which an exogenous nucleic acid sequence, such as, for example, a vector, has been introduced. Therefore, recombinant cells are distinguishable from naturally occurring cells, which do not contain a recombinantly introduced nucleic acid. In embodiments of the invention, a host cell is a T cell, including a cytotoxic T-cell (also known as TC, Cytotoxic T Lymphocyte, CTL, T-Killer cell, cytolytic T cell, CD8+ T-cells, CD4+ T-cells, or killer T-cells); NK cells and NKT cells are also encompassed in the disclosure.
[0091] In one aspect, provided herein is a cell that has been genetically engineered to express one or more CARs. In certain embodiments, the genetically engineered cell is, e.g., a T lymphocyte (T-cell), a natural killer (NK) T-cell, or an NK cell. In certain other embodiments, the genetically engineered cell is a non-immune cell, such as a stem cell, e.g., a mesenchymal stem cell (MSC), a neuronal stem cell, a hematopoietic stem cell, an induced pluripotent stem cell (iPS cell), or an embryonic stem cell, for example. In specific embodiments, the cell also comprises an engineered CAR or any other genetic modification that may enhance its function.
[0092] In certain embodiments, it is contemplated that RNAs or proteinaceous sequences may be co-expressed with other selected RNAs or proteinaceous sequences in the same cell, such as the same immune or stem cell. Co-expression may be achieved by co-transfecting the cell with two or more distinct recombinant vectors. Alternatively, a single recombinant vector may be constructed to include multiple distinct coding regions for RNAs, which could then be expressed in cells transfected with the single vector.
[0093] Some vectors may employ control sequences that allow it to be replicated and/or expressed in both prokaryotic and eukaryotic cells. One of skill in the art would further understand the conditions under which to incubate all of the above described host cells to maintain them and to permit replication of a vector. Also understood and known are techniques and conditions that would allow large-scale production of vectors, as well as production of the nucleic acids encoded by vectors and their cognate polypeptides, proteins, or peptides.
[0094] The cells can be autologous cells syngeneic cells, or allogeneic cells. The host cell can be any prokaryote or eukaryotic cell, but in specific embodiments it is a eukaryotic cell. In specific embodiments, the host cell is a bacterium, an insect, fungal, plant or animal cell. It is particularly envisaged that the recited host may be a mammalian cell, more preferably a human cell or human cell line. Particularly preferred host cells comprise immune cells (including myeloid and lymphoid lineages) and hematopoietic stem cells, which give rise to all lineages of immune cells.
[0095] One embodiment relates to a process for the production of a composition of the disclosure, the process comprising culturing a host cell defined herein above under conditions allowing the expression of the CAR construct, and the cell or a plurality of cells is provided to the individual. The conditions for the culturing of cells harboring an expression construct that allows the expression of the CAR molecules are known in the art, as are procedures for the purification/recovery of the constructs when desired. The described nucleic acid molecule or vector that is introduced in the host cell may either integrated into the genome of the host or it may be maintained extrachromosomally.
[0096] In one embodiment, the host cell is a genetically engineered T-cell (e.g., cytotoxic T lymphocyte) comprising a CAR and in some embodiments the cell further comprises an engineered TCR, chimeric cytokine receptor, and so forth. Naturally occurring T-cell receptors comprise two subunits, an ?-subunit and a ?-subunit, each of which is a unique protein produced by recombination event in each T-cell's genome. Libraries of TCRs may be screened for their selectivity to particular target antigens. An engineered TCR refers to a TCR that has a high-avidity and reactivity toward target antigen that is selected, cloned, and/or subsequently introduced into a population of T-cells used for adoptive immunotherapy. In contrast to engineered TCRs, CARs are engineered to bind target antigens in an MEW independent manner.
[0097] In certain embodiments, the HBV-specific CAR-expressing cells encompass a plurality of cells, including a plurality of T cells, such as one example that is depleted of CD45RA cells, or has a knockout or shRNA reduction against one or more particular molecules, such as TCR molecules, making it suitable for allogeneic use. In at least some cases, the cells comprise a knockout or shRNA against beta macroglobulin or MEW class I molecules. Any knockout may be generated using a CRISPR/Cas9, TALEN, homing endonucleases, zing finger nucleases, or other site directed DNA nucleases in the art.
[0098] In cases wherein the cells are allogeneic, they may be derived from an induced pluripotent stem cell (iPS) or embryonic stem cell (ES) cell, or other stem cell.
[0099] In some cases, the immune cells comprise multiple CARs each of which target multiple epitopes of the same pathogen, including the same pathogenic protein, or they may target different pathogenic proteins.
[0100] In specific embodiments, cells used in the methods are contacted with or delivered along with anti-PD1, anti-PDL1, or anti-CTLA4 antibody-based inhibitors, also known as checkpoint inhibitors. The PD1/PDL1 and CTLA4 targets are merely representative of this class of drugs, and are not meant to be exclusive. Examples of these checkpoint inhibitors that could be utilized include pembrolizumab, nivolumab, atezolizumab, and ipilimumab.
[0101] It is further envisaged that a pharmaceutical composition of the disclosure comprises a host cell transformed or transfected with a vector defined herein. The host cell may be produced by introducing at least one of the above described vectors or at least one of the above described nucleic acid molecules into the host cell. The presence of the at least one vector or at least one nucleic acid molecule in the host may mediate the expression of a gene encoding the above described be specific CAR constructs.
[0102] The pharmaceutical composition of the disclosure may also comprise a proteinaceous compound capable of providing an activation signal for immune effector cells useful for cell proliferation or cell stimulation. In the light of the present disclosure, the proteinaceous compounds providing an activation signal for immune effector cells may be, e.g. a further activation signal for T-cells (e.g., a further costimulatory molecule: molecules of the B7-family, OX40 L, 4-1BBL), or a further cytokine: interleukin (e.g., IL-2, IL-7, or IL-15), or an NKG-2D engaging compound. The proteinaceous compound may also provide an activation signal for immune effector cell which is a non-T-cell. Examples for immune effector cells which are not T-cells comprise, inter alia, NK cells, or NKT-cells.
[0103] T-cells can also be further genetically modified to enhance their function, particularly concerning persistence inside the individual being treated. Examples include, but are not limited to, the transgenic expression of cytokines (e.g. IL2, IL7, IL15), expression of cytokine receptors (e.g., IL7R alpha, IL2R alpha) silencing of negative regulators (for example SHP-1, FAS), expression of chemokine receptors (e.g., CXCR2, CCR2b), dominant negative receptors (e.g. dominant negative TGF?RII), and/or expression of so-called signal converters that convert a negative into a positive signal (e.g. IL4/IL2 chimeric cytokine receptor, IL4/IL7 chimeric cytokine receptor, or TGF?RII/TLR chimeric receptor).
[0104] In many situations one may wish to be able to kill the genetically engineered T-cells, where one wishes to terminate the treatment, the cells become neoplastic, in research where the absence of the cells after their presence is of interest, or other purpose. For this purpose one can provide for the expression of certain gene products in which one can kill the engineered cells under controlled conditions, such as inducible suicide genes. Such suicide genes are known in the art, e.g., the iCaspase9 system in which a modified form of caspase 9 is dimerizable with a small molecule, e.g., AP1903.
IV. Examples of Methods of Making and Using the CAR Compositions and Cells Expressing the CARs
[0105] In various embodiments CAR constructs, nucleic acid sequences, vectors, host cells, as contemplated herein and/or pharmaceutical compositions comprising the same are used for the prevention, treatment or amelioration of at least one symptom of a HBV-associated disease or condition.
[0106] In particular embodiments, provided herein is a method of treating an individual who has an HBV infection, comprising the step of providing a therapeutically effective amount of a plurality of any of the HBsAg-specific CAR-expressing cells of the disclosure to the individual. In certain embodiments, the method of treating comprises ameliorating one or more symptoms of the HBV infection, e.g., jaundice. In certain embodiments, the therapeutically effective amount is an amount that results in amelioration of one or more symptom of the HBV infection. In certain other embodiments, the therapeutically effective amount is an amount that results in a reduction in HBV viral titer, for example, in a serum sample or tissue biopsy, e.g, liver biopsy, from the individual. In other specific embodiments, the individual is a mammal, e.g., a human.
[0107] As used herein treatment or treating, includes any beneficial or desirable effect on the symptoms or pathology of a disease or pathological condition, and may include even minimal reductions in one or more measurable markers of the disease or condition being treated, e.g., HBV infection and related medical condition(s). Treatment can involve optionally either the reduction or amelioration of one or more symptoms of the disease or condition, or the delaying of the progression of at least one symptom of the disease or condition. Treatment does not necessarily indicate complete eradication or cure of the disease or condition, or associated symptoms thereof.
[0108] As used herein, prevent, and similar words such as prevented, preventing etc., indicate an approach for preventing, inhibiting, or reducing the likelihood of the occurrence or recurrence of, a disease or condition, e.g., cancer. It also refers to delaying the onset or recurrence of a disease or condition or delaying the occurrence or recurrence of the symptoms of a disease or condition. As used herein, prevention and similar words also includes reducing the intensity, effect, symptoms and/or burden of a disease or condition prior to onset or recurrence of the disease or condition.
[0109] In particular embodiments of the present disclosure, cells modified to express one or more CAR constructs, at least one of which target one or more Hepatitis B antigens (optionally wherein the one or more agents is not C8 scFv or 5a19 scFv), are provided in a therapeutically effective amount to an individual in need thereof. The individual may be seropositive for HBV, diagnosed with HBV, exposed to HBV, or at risk for HBV, for example. In some cases at least, the method encompasses production of HBV CAR-expressing cells, such as by transduction of immune cells (T cells, NK cells, NKT cells, and the like) with a polynucleotide that expresses the HBV CAR, including an expression vector that encodes the HBV CAR. The administration of the HBV CAR-expressing cells may be via any suitable route to the individual, including locally or systemically. In specific embodiments the HBV CAR-expressing cells are delivered intravenously, orally, rectally, topically, intramuscularly, by infusion, enterically, nasally, by inhalation, sublingually, bucally, transdermally, subcutaneously, and so forth. When the cells are delivered to an individual, they may be delivered in a pharmaceutically acceptable carrier or excipient. In certain embodiments, subsequent to administration, said nucleic acid molecules or vectors may be stably integrated into the genome of the subject.
[0110] In certain embodiments of the disclosure, cells expressing a CAR that targets at least one HBV antigen are provided. HBV CAR-expressing cells may be of any kind, including prokaryotic cells that may be used to generate the HBV CAR by recombinant means or eukaryotic cells, such as immune cells, including T cells, NK cells, and NKT cells, for example.
[0111] In particular embodiments, polynucleotides that comprise sequence that encodes part or all of an HBV CAR are included. The polynucleotides may be linear or circular and may be DNA or RNA. The polynucleotides may be comprised on a vector of any kind, including a viral vector or non-viral vector, and in such cases the coding region that expresses the HBV CAR may be regulated by one or more regulatory sequences. In certain cases, a polynucleotide that encodes a nucleic acid (miRNA, shRNA, or siRNA) that target a gene to be reduced in expression (such as perforin, granzyme A, B, C, D, Fas, TNFalpha, and/or TRAIL) may or may not be the same polynucleotide that encodes the HBV CAR. Thus, in certain embodiments one expression vector encodes the HBV CAR and a second expression vector encodes a nucleic acid that target a gene to be reduced in expression, whereas in other embodiments the HBV CAR and the nucleic acid that targets a gene to be reduced in expression are on the same vector.
[0112] In specific embodiments, viral vectors may be used that are specific for certain cells or tissues and persist in said cells. Suitable pharmaceutical carriers and excipients are well known in the art. The compositions prepared according to the disclosure can be used for the prevention or treatment or delaying of HBV.
[0113] Particular doses for therapy may be determined using routine methods in the art. However, in specific embodiments, the T cells are delivered to an individual in need thereof once, although in some cases it is multiple times, including 2, 3, 4, 5, 6, or more times. When multiple doses are given, the span of time between doses may be of any suitable time, but in specific embodiments, it is weeks or months between the doses. The time between doses may vary in a single regimen. In particular embodiments, the time between doses is 2, 3, 4, 5, 6, 7, 8, 9, 10, or more weeks. In specific cases, it is between 4-8 or 6-8 weeks, for example. In specific embodiments, one regimen includes the following dose regimen:
[0114] Particular doses for CAR modified cells include 10.sup.5 cells/m.sup.2, 10.sup.6 cells/m.sup.2, 10.sup.7 cells/m.sup.2, 10.sup.8 cells/m.sup.2, 10.sup.9 cells/m.sup.2, or 10.sup.10 cells/m.sup.2 and ranges there between. Doses on the higher end of the range are necessary when cells have limited persistence or are irradiated prior to infusion.
[0115] In particular cases the individual is provided with therapeutic T-cells engineered to comprise a CAR specific for one or more HBV antigens. With multiple administrations, the cells may or may not be provided to the individual in different delivery routes. The cells may be delivered by injection into the liver or intravenously or orally, for example. Routine delivery routes for such compositions are known in the art.
[0116] Expression vectors that encode the HBV-specific CARs can be introduced as one or more DNA molecules or constructs, where there may be at least one marker that will allow for selection of host cells that contain the construct(s). The constructs can be prepared in conventional ways, where the genes and regulatory regions may be isolated, as appropriate, ligated, cloned in an appropriate cloning host, analyzed by restriction or sequencing, or other convenient means. For example, using PCR, individual fragments including all or portions of a functional unit may be isolated, where one or more mutations may be introduced using primer repair, ligation, in vitro mutagenesis, etc., as appropriate. The construct(s) once completed and demonstrated to have the appropriate sequences may then be introduced into the cells by any convenient means. The constructs may be integrated and packaged into non-replicating, defective viral genomes like Adenovirus, Adeno-associated virus (AAV), or Herpes simplex virus (HSV) or others, including retroviral vectors, for infection or transduction into cells. The constructs may include viral sequences for transfection, if desired. Alternatively, the construct may be introduced by fusion, electroporation, biolistics, transfection, lipofection, or the like. The host cells may be grown and expanded in culture before introduction of the construct(s), followed by the appropriate treatment for introduction of the construct(s) and integration of the construct(s). The cells are then expanded and screened by virtue of a marker present in the construct. Various markers that may be used successfully include hprt, neomycin resistance, thymidine kinase, hygromycin resistance, etc. Other markers included proteins expressed on the cell surface, including CD19, CD34, epidermal growth factor receptor, or nerve growth factor receptor, etc.
[0117] In some instances, one may have a target site for homologous recombination, where it is desired that a construct be integrated at a particular locus. For example, can knockout an endogenous gene and replace it (at the same locus or elsewhere) with the gene encoded for by the construct using materials and methods as are known in the art for homologous recombination. For homologous recombination, one may use either .OMEGA. or O-vectors. CRISPR/Cas9, zinc finger nucleases, TALE nucleases, meganucleases, and other site directed nucleases may be used to target and cleave a specific site in the genome to promote homologous recombination.
[0118] The constructs may be introduced as a single DNA molecule encoding at least the HBV-specific CAR and optionally another gene, or different DNA molecules having one or more genes. The constructs may be introduced simultaneously or consecutively, each with the same or different markers.
[0119] Vectors containing useful elements such as bacterial or yeast origins of replication, selectable and/or amplifiable markers, promoter/enhancer elements for expression in prokaryotes or eukaryotes, etc. that may be used to prepare stocks of construct DNAs and for carrying out transfections are well known in the art, and many are commercially available.
[0120] The exemplary T cells that have been engineered to include the HBV-specific CAR construct(s) are then grown in culture under selective conditions and cells that are selected as having the construct may then be expanded and further analyzed, using, for example; the polymerase chain reaction for determining the presence of the construct in the host cells. Once the engineered host cells have been identified, they may then be used as planned, e.g. expanded in culture or introduced into a host organism.
[0121] Depending upon the nature of the cells, the cells may be introduced into a host organism, e.g. a mammal, in a wide variety of ways. The cells may be introduced at the site of the tumor, in specific embodiments, although in alternative embodiments the cells home to the cancer or are modified to home to the infected tissue. The number of cells that are employed will depend upon a number of circumstances, the purpose for the introduction, the lifetime of the cells, the protocol to be used, for example, the number of administrations, the ability of the cells to multiply, the stability of the recombinant construct, and the like. The cells may be applied as a dispersion, generally being injected at or near the site of interest. The cells may be in a physiologically-acceptable medium.
[0122] The DNA introduction need not result in integration in every case. In some situations, transient maintenance of the DNA introduced may be sufficient. In this way, one could have a short term effect, where cells could be introduced into the host and then turned on after a predetermined time, for example, after the cells have been able to home to a particular site.
[0123] The cells may be administered as desired. Depending upon the response desired, the manner of administration, the life of the cells, the number of cells present, various protocols may be employed. The number of administrations will depend upon the factors described above at least in part.
[0124] It should be appreciated that the system is subject to many variables, such as the cellular response to the ligand, the efficiency of expression and, as appropriate, the level of secretion, the activity of the expression product, the particular need of the patient, which may vary with time and circumstances, the rate of loss of the cellular activity as a result of loss of cells or expression activity of individual cells, and the like. Therefore, it is expected that for each individual patient, even if there were universal cells, which could be administered to the population at large, each patient would be monitored for the proper dosage for the individual, and such practices of monitoring a patient are routine in the art.
[0125] In another aspect, provided herein is a method of treating an individual having a HBV antigen-positive tumor cell, comprising administering to the individual a therapeutically effective amount of cells expressing at least HBV antigen-specific CAR. In a related aspect, provided herein is a method of treating an individual having an infected cell or tumor cell positive for HBsAg (of liver origin, for example), comprising administering to the individual a therapeutically effective amount of cells expressing at least HBV antigen-specific CAR. In a specific embodiment, said administering results in a measurable decrease in the HBV-positive cells in the individual. In various embodiments, the effectiveness of the therapy may be measured by alpha-feto protein levels in the serum (which is secreted by liver tumors), and the size of the tumor in computed tomography imaging, for example.
[0126] Embodiments relate to a kit comprising cells as defined herein, CAR constructs as defined herein, a nucleic acid sequence as defined herein, and/or a vector as defined herein. It is also contemplated that the kit of this disclosure comprises a pharmaceutical composition as described herein above, either alone or in combination with further medicaments to be administered to an individual in need of medical treatment or intervention.
[0127] The cells that are delivered as treatment may be autologous or allogeneic to the individual, and the cell product may be a primary cell isolate from individuals. The cell product may comprise an immune cell, such a T cell, NK cell, or an NKT cell. In other embodiments, the cells may be hematopoietic stem cells, which give rise to all immune progenitors, and can be transduced in vitro or in vivo intra-bone marrow or via intravenous injection. In specific embodiments, the cell products are immune cell lines that are capable of continuous growth. Examples of cell lines of NK lineage include NK-92, NKL, and NK-YS cell lines. Examples of cell lines of T cell lineage include TALL-104 or C-Cure 707 cell line. A cell product may be an allogeneic NK-T cell with restricted TCR to CD1d.
[0128] In particular examples, one can harvest allogeneic T cells from healthy, random donors and transduce the cells with one or a mixture of 2 or 3 CARs harboring different scFv sequences for global coverage of HBV serotypes. In specific embodiments, the cells harbor a construct that comprises an shRNA for cytopathic reduction as desired, such as against the perforin or granzyme B proteins, which would abrogate canonical T cell mediated cytotoxicity. The cells are delivered (for example by infusion) to a patient with chronic HBV. The CAR T cells will home to the liver, and may persist for days 11-28 days before dying off from exhaustion. If the disease is not improved upon in one infusion cycle, another autologous or allogeneic product (for example, by infusion). The second delivery may occur within 14-180 days after the first, to avoid too much inflammation at one time in the liver. Subsequent deliveries following the first and second deliveries may occur. In specific embodiments, there are 7-14 day cycles where the cells are delivered until their levels drop, immediately followed by another delivery and persistence, etc., and the cycles may be repeated until desired to be stopped, for example upon improvement of at least one symptom (absence of ALT flares), hepatitis B e-antigen (HBeAg) seroconversion, anti-HBsAg seroconversion or upon serum HBsAg clearance of the infection. In specific embodiments, within 1 to 10 courses of therapy, HBV is cleared from the liver. Unlike other HBV strategies, this does not depend on an anergic and defective host immune response to suddenly re-awaken. In specific cases, the individuals are provided one or more treatments to prevent viral spread during treatment, such as reverse transcriptase inhibitors and/or recombinant interferon-alpha derivatives.
[0129] Allogeneic cell therapy strategies for HBV treatment has two purposes. In the first, there is predictable pharmacokinetics and quality of the cell product, which is useful in targeting the liver, which must not be harmed in an acute way. Methods and compositions of the present disclosure ensures a level of safety with allogeneic products being potentially rejected by HLA-incompatability limiting therapeutic lifespan and alleviating any potential adverse events, serving as built-in safety feature. In the second, the disclosure in one embodiment allows for scalable manufacturing and packaging of an allogeneic cell product into suitable containers for worldwide, versus current autologous patient-specific manufacturing for tumor schemes.
[0130] For individuals with HBV who have some level of an immunocompromised state, a T cell product that has the TCR genes knocked out is useful to avoid graft-versus-host disease (GVHD). Methods using CRISPR/Cas9, zinc finger nucleases, TALE nucleases, homing endonucleases, or meganucleases may be employed in such a case. Another strategy employs homologous recombination strategies in order to remove expression. In addition or alternatively, the T cells could be irradiated prior to infusion, which would decrease their lifetime to around 2 days, although in some cases this is less ideal.
[0131] In some embodiments the methods of the disclosure provide a particular advantage of strategy for individuals who cannot sustain significant bystander organ damage. An example would be cirrhotic HBV patients, who likely have contra-indications for other HBV therapeutic strategy (particularly ones activating the immune system). Another example would be immunocompromised individuals with an allograft infection, or with chronic kidney disease. In these individuals, treatment is required in order to save the organ, but the treatment cannot be so destructive as to cause more harm during therapy.
[0132] One strategy of methods and compositions of the disclosure includes the benefits in the remarkable sensitivity of CAR T cells to low antigen production (for example, 10,000 antigens versus 100,000 for an antibody). In certain aspects this is useful in treating hepatitis B virus e antigen (HBeAg)-negative individuals with lower replication levels of virus in addition to individuals with occult HBV, wherein the serum is negative for HBsAg but HBV DNA can still be detected.
[0133] In some embodiments, there is a method of treating an infected cell non-cytopathically, thereby lessening direct harm to tissues while maximizing cytokine secretion. In certain cases, the method comprises the step of utilizing a CAR that lacks signaling endodomains for perforin/granzyme secretion, such as the zeta chain and CD16 gamma chain, while retaining various other costimulatory domains important in cytokine secretion. In particular cases cells harboring the CARs are modified to reduce expression of perforin, granzyme-A, granzyme-B, granzyme-C, granzyme-D, Fas, Fas receptor, TNF-alpha, and/or TRAIL (for example, or by genetic knockout (using CRISPR/Cas9, TALE nuclease, or zinc finger nuclease system, for example) or by homologous recombination or shRNA-targeting the desired gene product or microRNAs). In specific embodiments, micoRNA's that target perforin and granzyme mRNA transcripts are utilized to depress their levels of expression (for example, human microRNA-150 or human microRNA-27a*).
[0134] In particular embodiments, there are methods of treating humans with HBV infection by providing an effective amount of allogeneic cell product that is irradiated before infusion into the individual in order to prevent further cell expansion of the cell product in the individual, and in some cases one or more deliveries of the cell product are provided to the individuals. In certain cases the individual is immunocompromised.
[0135] In some embodiments there is a method of targeting HBV-infected cells or HBV, wherein the targeted antigen is an extracellular antigen located on the surface of the HBV-infected cell or the surface of the pathogen. In some cases a peptide expressed on an MEW class I molecule is targeted using a single chain antibody mimicking T cell receptor (TCR) function.
[0136] In some embodiments there is a method of treating an HBV infection, wherein the liver infected is targeted with a T cell attenuated for toxicity with a CAR toward an antigen expressed in that organ, producing temporary inflammation and cytokine production in the organ to purge the HBV infection.
[0137] In certain embodiments, there is a method of treatment of administration of antibodies against an HBV antigen prior to treatment with HBV CAR-expressing cells, in order to reduce HBV antigen levels prior to CAR-T cell infusion, and help promote T cell homing to the liver site and therapeutic response. One or more administrations of the antibodies may be employed. In other embodiments, antibodies may be administered after the infusion of CAR-T cells, in order to promote increased anti-HBV efficacy and therapeutic response.
[0138] In one embodiment, there is a method of treatment comprising administering reverse transcriptase inhibitors (examples: lamivudine, adefovir dipivoxil, telbivudine, tenofovir alafenamide, tenofovir, and entecavir) prior to and during CAR therapy, in order to prevent the recovery and rebound of viral genome levels. One or more administrations of the inhibitors may be utilized. Reverse transcriptase inhibitor therapy may also be continued after elimination of CAR-T cells, in order to prevent later viral rebound and maintain the effects from therapy.
[0139] In some embodiments, the HBV-specific CAR T cells are utilized in conjunction with one or more other therapies FDA-approved for HBV infection. Future FDA approved medications for HBV treatment may also be considered in combination with CAR-T therapy. The therapy may or may not be one or more reverse transcriptase inhibitors. In specific embodiments, the additional therapy is lamivudine, adefovir, dipivoxiltelbivudine, entecavir, interferon alfa-2b, pegylated interferon, emtricitabine, tenofovir, tenofovir alafenamide, or a combination thereof.
EXAMPLES
[0140] The examples provided herewith are included to demonstrate particular embodiments of the disclosure. It should be appreciated by those of skill in the art that the techniques disclosed in the examples that follow represent techniques discovered by the inventor to function well in the practice of the inventions, and thus can be considered to constitute preferred modes for its practice. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the disclosure.
Example 1
Chimeric Antigen Receptor Directed T Cells can Mediate Antiviral Effects Against Hepatitis B Virus in a Humanized Liver Model of Infection
[0141] Chronic hepatitis B virus (HBV) can only be suppressed by current drugs today in most patients, and a need for a permanent cure for this patient population remains. In patients who clear acute HBV infection, an effective T cell response infiltrates the liver, but patients with chronic HBV have deficient antiviral T cells. This problem was addressed by engineering T cells with a chimeric antigen receptor (CAR), having specificity toward HBV surface antigen (HBsAg), which is noted to accumulate on the surface of infected hepatocytes.
[0142] Previous studies showed that HBsAg-targeted CAR T cells were efficacious in vitro at killing HBV+ cell lines and in clearing HBV covalently closed circular DNA (cccDNA) in primary human hepatocytes in cell culture. These HBV CAR T cells were also tested in a transgenic HBV mouse model, and exhibited a modest reduction in viral loads that was ultimately transient in vivo. However, CAR T cell levels rebounded and failed to persist. In particular, the cells appeared to be gone by week 3. The maximum decline in virus was at day 12 (cells were also observed in the liver at that date), with levels rebounding after that. (In the present work, the inventors continued seeing declines much longer than that and stabilization in response after therapy.) Because the clearance of HBV cannot be tested in the transgenic model, given that HBV is integrated into the host genome, CAR-T cell therapy was tested in a clinically relevant setting with authentic virus.
[0143] In the present study, humanized liver chimeric mice were employed, which are infectious for HBV and possess cccDNA genomes, affording direct translational significance to human patients. In this model, only human hepatocytes are infected with HBV. In order to facilitate clinical development, a new human single chain variable fragment (scFv) against HBsAg that would not be expected to provoke an immune response in patients was sought. Upon screening previously described antibody scFvs, an scFv was identified (19.79.5 scFv (referred to herein as XTL-19)) that in the CAR molecule context could potently activate T cells in vitro, resulting in complete killing of an HBV+ cell line at 1 week, while sparing an HBV? negative HepG2 control. Notably, a second CAR (utilizing 17.1.41 scFv, referred to herein as XTL-17) molecule had less activation effect indicating scFvs against HBV may be empirically tested by standard means in order to prove efficacy. Furthermore, the HBV CAR T cells released high levels of INF-gamma, IL-2, and TNF-alpha in response to both soluble and cell-associated HBsAg. These HBV CAR T cells were tested in the HBV-infected humanized liver mouse model, which displayed initial HBV levels ranging from 10{circumflex over ()}7-10{circumflex over ()}9 copies/mL and 10-50,000 HBsAg ng/mL. A single dose of CART cells (20 million CART cells delivered intraperitoneally) into infected mice decreased serum HBsAg concentration by up to 2 logs, and decreased serum HBV DNA levels up to 3 logs, over one month post infusion (
Example 2
Chimeric Antigen Receptor Therapy with Reduced Cytotoxicity for Infectious Diseases
[0144] The present disclosure provides a general strategy of cell-based immunotherapy to treat various viral indications, particularly in infections targeting crucial organs where toxicity may be an issue and cell death may not be desired, but rather cytokine secretion and activation host intracellular innate immune pathways and of more specific CTL and NK cell effectors is desired. This particularly has useful general applications of cell-based immunotherapy for treating individuals with compromised immune systems for viral infections.
[0145] Present embodiments include targeting of Hepatitis B virus, where the inventors have shown that administered HBV-specific CAR T cells are effective against HBV in a clinically-relevant mouse model. Demonstrated herein are optimizations over the prior art for a chimeric antigen receptor (CAR) design for this purpose. Also encompassed herein are additional modifications to attenuate toxicity. In embodiments herein, the body purges virus non-cytopathically, and in other embodiments helper T cell function is utilized in the body.
[0146] The present example provides studies in the development of a new chimeric antigen receptor against HBV specifically that is useful in targeting HBV diseases.
[0147] Two HBV-specific CARs were constructed (
[0148] An initial in vivo pilot showed no efficacy with the IgG1 hinge upon intravenous dosing, and without being bound by theory the cells may have been trapped and eliminated in the lungs, similar to previous reports in the literature. Therefore, the inventors then replaced the IgG1 hinge of the XTL-19 CAR with a mutated IgG4 Fc region (based on published mutations in Hudecek et al. (2015)) to allow for persistence in vivo via absence of Fc receptor binding; this new CAR construct was designated XTL19-IgG4m. XTL19-IgG4m was validated by demonstration of in vitro expansion of XTL19-IgG4m CAR-expressing T cells upon co-culture with HepG2.2.15 cells, consistent with expansion of T cells expressing the parent XTL-19 CAR (
[0149] The following shows one example of a humanized pilot for CAR T cell therapy using CARs that have been modified to avoid Fc receptor binding:
[0150] Humanized mice as described in Example 1 were obtained from the same hepatocyte donor (chimeric human liver mice are generated by transplanting hepatocytes from cadavers into the mice). On Day 30, 200 ?L of pooled serum from mouse injected i.p. with Genotype D hepatitis B virus was administered to the humanized mice, and viral incubation was allowed to proceed. On Day 0, the first blood draw was obtained from the mice. At Day 37, 10 million CAR transduced (XTL19-G4m-CD28-Zeta) or 10 million normal T cells, from the same donor, were administered to the mice, with blood draws at Day 4, Day 7, and every 7 days after that (
[0151] In CAR T cells, HBsAg is a secreted viral protein that is produced in high levels by the virus and serves as a marker for viral replication and persistence (
[0152] The elimination of HBsAg levels in XTL19-G4m-CAR-treated mice was observed, which suggests elimination of HBV-infected cells and therefore HBV, while the HBsAg continued increasing uninhibited in mice administered unmodified T cells. CAR T cells appear to be mediating a cytotoxic effect and can home to the liver and find and eliminate infected cells amongst a majority uninfected liver. In addition, the in vivo data matches efficacy observed in cell culture. The results provide the first demonstration of in vivo improvement of HBV in its natural setting (human cells). One can also utilize cytokines alone to see if they can mediate clearance of viruses without any cytolytic mechanisms in the host cells, beyond their bystander activities toward other immune cells. That is, cytokines can be useful mediators in the clearance of HBV virus, and in specific embodiments engineering of the CAR-T cell to maximize secretion of cytokines to clear virus safely that does not also damage the liver is useful. The cytokines can serve to activate other immune cells, which in particular aspects reinvigorate a dormant host immune response against HBV.
Example 3
HBSAG-Redirected T Cells have Potent Antiviral Activity in HBV-Infected Human Liver Chimeric Mice
[0153] Because HBV cannot presently be cured, it was considered whether CAR therapy could result in permanent reductions in HBV levels. This was examined by testing HBsAg-redirected CAR-T cells to treat HBV-infected humanized mice.
[0154] A CAR was developed against HBsAg using two human antibodies, XTL-17 and XTL-19 that are specific toward a variety of HBsAg serotypes. CARs were prepared with single chain variable fragments (scFvs) from these antibodies with a human IgG1 Fc domain as the hinge domain and CD28 and CD3 zeta endodomains. The activation of CAR-T cells was verified when incubated with HepG2.2.15 cells positive for HBV. XTL-19 CAR-T cells released IFN-?, TNF-?, and IL-2 at 24 hours, expanded in number, and after a week of co-culture, HepG2.2.15 were completely eliminated (
[0155] Given that persistence was limited in a previous CAR-T study, it was considered that this might be because of the IgG1 hinge binding to mouse FcR-bearing cells, causing CAR-T elimination. It was considered that a modified hinge region would not interact with Fc receptors, allowing for increased CAR-T cell persistence. A hinge region with a deleted CH2 domain, essential for Fc receptor binding, exhibited no proliferation in vitro when incubated with HepG2.2.15 cells suggesting that a longer hinge geometry is useful for reaching the HBsAg epitopes adequately on the hepatocyte surface in order to trigger clustering and activation (
[0156] Given that persistence was limited in a previous CAR-T study, it was considered that this might be because of the IgG1 hinge binding to mouse FcR-bearing cells, causing CAR-T elimination. The hinge region was modified such that it would not interact with Fc receptors, allowing for increased CAR-T cell persistence. T cells expressing a CAR comprising a hinge region with a deleted CH2 domain, essential for Fc receptor binding, exhibited no proliferation in vitro when incubated with HepG2.2.15 cells suggesting that a longer hinge geometry is useful for reaching the HBsAg epitopes adequately on the hepatocyte surface in order to trigger clustering and activation (
[0157] The activity of CAR T cells in vivo was verified. The inventors sought an initial test in an episomal HBV model system and utilized hydrodynamic tail vein injection of plasmids containing the HBV genome and a reporter luciferase driven the HBV core promoter. Any T cell activity against hepatocytes should cause decreases in luminescence signal. However, there was no detectable difference in luminescence between XTL-19 and control 139 CAR-T cells (
[0158] A larger cohort of mice was tested with high baseline levels of infection. Obtaining 7 humanized mice with high human hepatocyte repopulation, the inventors injected 10.sup.6 genomes of HBV into the intraperitoneal cavity allowing infection to spread over 1-2 months and high titers to be reached (
[0159] After a second CAR-T infusion, the inventors harvested two mice at day 10 post CAR-T infusion in the treatment and control groups (
[0160] Thus, CAR-T cells redirected to HBsAg are effective in clearing HBV in authentic human liver tissue, as evidenced by their ability to decrease HBsAg levels. Complete elimination is likely limited by lack of CAR-T cell persistence, similar to cancer studies, leading to viral rebound. In specific embodiments, combination treatment with reverse transcriptase (RT) inhibitors is useful in preventing this.
[0161] Culture of CAR-T cells (2 million) with supernatant and HBV+ or HBV? cells (1 million cells) reveals XTL-19-IgG4m CAR-expressing T cells are only activated by HBV antigen. The supernatant comprises both virions containing DNA that are infectious to new cells as well as many empty, smaller subviral particles that contain an antigen array that can be targeted for CAR T cell recognition and activation, so that they can serve to activate T cells. The shorter hinge or linker with CH3 does not have enough length to activate the CAR-T, in this particular example, and the 139 scFv against an irrelevant antigen is not activated at all. CD25 and CD69 are signatures of T cells that are activated, showing in this case that the activation of the CAR-T cells only occurs in the presence of antigen, lending more evidence that this is a specific process to HBsAg recognition by the CAR-T cells.
[0162]
[0163]
[0164]
Example 4
HBSAG-Redirected T Cells Exhibit Antiviral Activity in HBV-Infected Human Liver Chimeric Mice
[0165] Hepatitis B virus (HBV) is a global pandemic chronically infecting 300 million people across the world today (Shepard, et al., 2006). In these chronic patients, HBV causes a lifelong infection that can lead to liver cirrhosis or cancer in 25% of patients (Perz, et al., 2006). HBV therapies currently remain limited to reverse transcriptase inhibitors (RTIs) and interferon (IFN)-?. RTIs only suppress HBV-DNA levels without significantly affecting the transcriptional template, covalently closed circular DNA (cccDNA) (Liaw, et al., 2009) while IFN-? causes significant side effects with little long-term therapeutic benefit (Ning, et al., 2014). Thus, new anti-HBV therapies are urgently needed in order to cure the virus.
[0166] During the HBV-specific immune response in acutely resolving patients, infiltrating T-cells rapidly purge the liver of HBV (Wieland, et al., 2004; Thimme, et al., 2003). In chronic HBV patients, however, HBV-specific T-cells are present in only low frequency and/or are anergic (Boni, et al., 2007). CD8-positive T-cells have been shown to be crucial in resolution of acute HBV infection (Thimme, et al., 2003). They are able to clear HBV in both cytolytic and noncytolytic effector functions (Hoh, et al., 2015). The cytokines, IFN-? and TNF-?, released by T-cells are important in driving noncytolytic suppression of virus (Guidotti, et al., 1996; Phillips, et al., 2010). Both IFN-? and TNF-? can induce degradation of intracellular cccDNA (Xia, et al., 2016) explaining part of this mechanism.
[0167] The adoptive transfer of T-cells genetically engineered to target hepatitis B surface antigen (HBsAg) with chimeric antigen receptors (HBsAg-CAR T-cells) is an attractive strategy to reconstitute HBV-specific T-cell immunity. Indeed, HBsAg-CAR T-cells have been shown to eliminate cccDNA from HBV-infected primary hepatocytes in vitro (Bohne, et al., 2008), and had transient anti-HBV activity in a transgenic HBV mouse model (Krebs, et al., 2013). Despite these promising results, it remains an open question whether HBsAg-CAR T-cells can induce a reduction of HBV levels in an animal model with authentic infection harboring episomal HBV cccDNA. The present examples addresses this question by evaluating human HBsAg-CAR T-cells in HBV-infected human liver chimeric mice (Bissig, et al., 2010).
[0168] Generation of a Novel CAR Targeting HBsAg
[0169] Two HBsAg-CARs were generated with a CD28.? signaling domain and a single chain variable fragment (scFv) derived from the human monoclonal antibody (mAb) 19.79.5, which recognizes HBsAg from different serotypes (Eren, et al., 2000), and has undergone successful Phase 1 testing (Galun, et al., 2002). Because the length of the spacer region of CARs is useful for their function (Hudecek, et al., 2015), long and intermediate spacers were compared. The IgG4 Fc domain with mutated Fc receptor binding sites (HBs-G4m-CAR) served a long (Hudecek, et al., 2015) and the CH3 domain of IgG1 as an intermediate spacer (HBs-CH3-CAR;
[0170] HBs-G4m-CAR T-Cells Recognize HBV-Positive Cells In Vitro
[0171] To determine which HBs-CAR recognized HBV-positive cells, 24-hour co-culture assays were performed with HepG2 (HBV negative) and HepG2.2.15 (HBV positive) cell lines, washing the cells first before adding CAR-T cells. Only HBs-G4m-CAR T-cells produced significant amounts of IFN-? in the presence of HepG2.2.15 in contrast to HBs-CH3-CAR and Ctrl-G4m-CAR T-cells (
[0172] HBs-G4m-CAR T-Cells Recognize HBsAg Particles In Vitro
[0173] To determine if HBs-G4m-CAR T-cells recognize HBsAg particles, 24-hour co-culture assays were performed with media supernatants derived from HepG2 and HepG2.2.15 cell lines, the latter containing 80 ng/mL HBsAg. Only HBs-G4m-CAR T-cells secreted significant amounts IFN-? in the presence of HepG2.2.15-conditioned media in contrast to HBs-CH3-CAR or Ctrl-G4m-CAR T-cells (
[0174] HBs-G4m-CAR T-Cells have Anti-HBV Activity in HBV-Infected Human Liver Chimeric Mice
[0175] HBs-G4m-CAR T-cell therapy was tested in human liver chimeric FRG mice (Bissig, et al., 2007; Azuma, 2007), which can replicate HBV (
[0176] To examine liver sections for the presence of T-cells and HBV directly after T-cell infusion, mice received a second dose of 2?10.sup.7 HBs-G4m-CAR or Ctrl-G4m-CAR T-cells, and were euthanized 10 days post injection. There was a 70.4% decrease in HBV-core staining among human albumin-positive hepatocytes in HBs-G4m-CAR T-cell-treated mice in comparison to control mice (
Significance of Certain Embodiments
[0177] In this study, the inventors demonstrate that HBs-G4m-CAR T-cells are effective in reducing HBV-DNA and HBsAg levels in HBV-infected human liver chimeric mice (Bissig, et al., 2010), which possess cccDNA transcriptional templates. After CAR T-cell therapy, a portion of human hepatocytes was also found to have histologically absent HBV core expression. However, complete elimination of HBV was not observed, which is most likely due to the limited persistence of human CAR T-cells in immunodeficient mouse models (Park, et al., 2007), possibly facilitated in immunodeficient mice on the FRG background by lack of murine SIRP? engagement (Legrand, et al., 2011), as opposed to NOD background models (Takenaka, et al., 2007). Despite this limitation, HBs-G4m-CAR T cells had superior anti-HBV activity than HBV entry inhibitors (Nakabori, et al., 2016) that did not reduce the number of HBV-infected hepatocytes in a humanized mouse model of established HBV infection. This finding also extends the work of the previous HBV-CAR publication in transgenic mice, which was unable to assess if HBV could be cleared from hepatocytes, because every cell had integrated virus allowing HBV core expression to quickly return (Krebs, et al., 2013).
[0178] HBs-G4m-CAR T-cells recognized HBsAg-positive HepG2.2.15 cells as judged by cytokine production, but had no cytolytic activity in a 5-hour cytotoxicity assay. Incubating HBs-G4m-CAR T-cells for up to 5 days with HepG2.2.15 cells also did not demonstrate any cytolytic activity of HBs-G4m-CAR T-cells. By comparison, a previous study had demonstrated that T cells, genetically modified with a different HBsAg-CAR, killed HBsAg-positive target cells at 72 hours (Bohne, et al., 2008) indicating both CARs may be inefficient at killing. While both CARs are HBsAg specific, different scFvs were used as antigen-binding domains. In specific embodiments, and without being bound by theory, differences in scFv binding sites between both CARs could explain these differences, since epitope location in part governs CAR T-cell activity (Hombach, et al., 2007). Competition by soluble HBsAg particles is unlikely since the HBV-positive HepG2.2.15 cells were washed immediately prior to cytotoxicity assays, and the CARs of both studies were able to recognize soluble HBsAg particles. Importantly, HBsAg levels in the humanized model are around 10-fold higher than in HBV transgenic mice, which may have prevented in the system the transient transaminase elevation seen in the previous work (Krebs, et al., 2013). In particular, the intrinsic, unique, and unexpected characteristics of lack of efficient cytotoxicity discovered in XTL19 scFv-CAR design may have also played a role, with unique epitope binding and signaling properties, compared to the previously published HBV-CAR molecule, which had more cytotoxicity.
[0179] In particular embodiments, having HBsAg-CAR T cells that do not kill hepatocytes efficiently is a significant advantage, best exemplified by the observation that adoptive transfer of PBMCs of HBV-seropositive donors, which contain HBV-specific T cells that recognize HBV-derived peptides in the context of MHC class I, induce acute liver failure in an HBV-infected humanized mouse model (Uchida, et al., 2015). Intriguingly, the inventors did find that the mouse with the lowest initial HBsAg levels did have the best results in HBsAg and DNA knockdown (?1.65 log and ?3.67 log, respectively), indicating some inhibitory role of HBsAg may be at play, or that the disease burden may be too great for CAR T-cells, in certain embodiments.
[0180] Because HBsAg-CAR T-cell therapy employs a different mechanism to eradicate HBV than currently approved therapies, one can consider combinatorial approaches. For example, combining CAR T-cells with RTIs may prevent rebound of viral DNA levels post CAR T-cell therapy that was observed herein. Furthermore, hepatitis B immunoglobulin (HBIG) administration prior to CAR T-cell infusion may be useful to reduce serum HBsAg levels, in some embodiments. This should restrict CAR T-cell activation and proliferation to sites of HBV-infected hepatocytes that produce HBsAg particles as opposed to HBsAg particle deposition sites, increasing not only efficacy but also reducing the risk of systemic CAR T-cell activation, which could result in cytokine release syndrome (Brudno, et al., 2016). Furthermore, pretreatment with HBIG would mask HBsAg particles, which have accumulated outside the liver, reducing on-target, off-tissue toxicity. Lastly, in some embodiments systemic toxicity could be prevented by directly injecting CAR T-cells into the hepatic artery, bypassing systemic circulation.
[0181] In conclusion, HBs-G4m-CAR T cells are effective in reducing HBV levels in plasma and tissue in HBV-infected human liver chimeric mice.
[0182] Examples of Methods
[0183] All methods were performed in accordance with national guidelines and regulations.
[0184] Generation of Retroviral Vectors Encoding CARs
[0185] To generate pSFG-HBs-G4m-28-zeta, a scFv encoding the amino acid sequence VH and VL domains of the XTL-19 antibody (mAb 19.79.5) (Eren, et al., 2000) termed HBs was synthesized (IDTDNA, Coralville, Iowa), and cloned into an SFG retroviral vector using 5 NcoI and 3 BamHI, replacing the antigen binding domain from a second generation CAR vector, IL13R?2-hIgG1-CD28-zeta CAR (Krebs, et al., 2014). Next, the hIgG1 hinge was replaced with a mini-gene (synthesized by IDTDNA, Coralville, Iowa) encoding the CH2-CH3 domain from human IgG4 with mutated Fc receptor binding sites (Hudecek, et al., 2015) (G4m) to generate pSFG-HBs-G4m-28-zeta. To generate pSFG-Ctrl-G4m-28-zeta, the HBs-specific scFv in pSFG-HBs-G4m-28-zeta was replaced by PCR cloning with an scFv specific for EGFRvIII (Morgan, et al., 2012). pSFG-HBs-CH3-28-zeta was generated by cloning the HBs-specific scFv into the 5 NcoI and 3 BamHI sites of a pSFG vector with a CAR.IgG1 CH3.28-zeta expression cassette (gift of Dr. Maksim Mamonkin, Baylor College of Medicine, Houston, Tex.). Cloning was verified by sequencing (Lone Star Labs, Houston Tex.). RD114-pseudotyped retroviral particles were generated by transient transfection of 293T cells as previously described (Ahmed, et al., 2010).
[0186] Generation of CAR-T Cells
[0187] To generate CAR-T cells, PBMCs were isolated by Lymphoprep (Greiner Bio-One, Monroe, N.C.) gradient centrifugation and then stimulated on treated non-tissue culture 24-well plates, which were pre-coated with OKT3 (CRL-8001, ATCC) and CD28 (BD Bioscience, Mountain View, Calif.) antibodies. Recombinant human interleukin-7 and interleukin-15 (IL-7, 10 ng/mL; IL-15, 5 ng/mL; PeproTech, Rocky Hill, N.J.) were added to cultures on day 2. On day 3, OKT3/CD28 stimulated T-cells (2.5?10.sup.5 cells/well) were transduced on RetroNectin? (Clontech, Mountainview, Calif.) coated plates in the presence of IL-7 and IL-15. On day 5 or 6, T-cells were transferred into tissue culture plates and subsequently expanded with IL-7 and IL-15. CAR expression was determined 4 to 5 days post transduction by FACS analysis using a human IgG (H+L) antibody (Jackson Immunoresearch, West Grove, Pa.), and appropriate isotype control.
[0188] Cell Culture Assays
[0189] HepG2.2.15 cells (gift of Dr. Betty Slagle, Baylor College of Medicine, Houston, Tex.) and HepG2 cells (ATCC, Manassas, Va.) were cultured in Dulbecco's minimal essential media (DMEM) supplemented with 10% fetal bovine serum and 1% antibiotic-antimycotic (Gibco ThermoFisher, Waltham, Mass.). For co-culture assays, 1 million HepG2 or HepG2.2.15 cells were plated; 24-hours later cells were washed and 2 million T-cells were added in one well of a 24-well plate in duplicate without exogenous cytokines. After 24 hours, supernatant was removed in order to assess cytokine release. For cytokine ELISAs, concentrations of INF-? were assessed using manufacturer's protocol (R&D Systems, Minneapolis, Minn.). For IL-2 and TNF-?, cytokine levels were determined using a multiplex assay (Millipore, St. Charles, Mo.). For cytotoxicity assays, standard chromium release protocols were followed as previously described (Krebs, et al., 2014) utilizing the same 2:1 ratio of T-cell to target cell, wherein target cells were plated on the same day as T-cell addition preventing any HBsAg particle accumulation.
[0190] For cytokine assays based on co-culture with HBV particles, the HepG2.2.15 supernatant was collected (measured to be 80 ng/mL using HBsAg ELISA protocol below). Culture media contained 50% HepG2.2.15 supernatant with 1 million CAR-T cells. At 24 hours, supernatant was collected for use in cytokine ELISA assays and electron microscopy particle counts. T-cells were also collected at this time point for analysis by flow cytometry using established protocols (Krebs, et al., 2014) and staining cells with anti-CD25-PE (BD Biosciences, San Jose, Calif.) and anti-CD69-APC (BD Biosciences, San Jose, Calif.). Flow cytometric data were acquired by Gallios (Beckman Coulter, Brea, Calif.) and analyzed using FlowJo ver.10 (FlowJo, Ashland, Oreg.).
[0191] Electron Microscopy
[0192] HBsAg particles and HBV virions were visualized by electron microscopy in conjunction with the Integrated Microscopy Core at Baylor College of Medicine. For negative staining for electron microscopy, cell culture supernatants were directly adsorbed to 2 formvar and carbon coated 200 mesh EM grid (EMS #FCF200-CU), washed once with ddH.sub.2O to remove salts and negatively stained with 1% ammonium molydbate. The samples were imaged using a JEOL JEM-1230 transmission electron microscope (Peabody, Mass.) at 80 kV. Images were taken from multiple areas of both specimen grids at random locations, using a Gatan Ultrascan 1000 CCD camera and Gatan Digital Micrograph imaging software (Pleasanton, Calif.). Examination of the micrographs was performed using Digital Micrograph and the FIJI implementation of the NIH ImageJ software.
[0193] Animal Experiments
[0194] Fah.sup.?/? Rag2.sup.?/? Il2-rg.sup.?/? (FRG) mice were repopulated with human cadaveric hepatocytes, as described previously (Bissig, et al., 2010; Bissig, et al., 2007). For the current experiment, all human liver chimeric mice were repopulated with hepatocytes from the same hepatocyte donor and lot in order to minimize differences. Furthermore, at the initiation of cell injection, mice were kept on 100% NTBC (2-(2-nitro-4-trifluoromethylbenzoyl)-1,3-cyclohexanedione) in order to stabilize the levels of human hepatocytes, and prevent ongoing destruction of murine hepatocytes and proliferation of human hepatocytes, that otherwise might contribute to either increasing HBV levels, or the loss of cccDNA after hepatocyte mitosis.
[0195] One million genome equivalents of HBV genotype D (serotype yaw) were inoculated intraperitoneal into humanized FRG mice as previously described (Bissig, et al., 2010). The infection was allowed to spread over 1-2 months until mice reached high levels of HBV infection, monitored by qPCR and HBsAg ELISA. HBsAg-CAR or Ctrl-CAR T-cells were injected intraperitoneal into humanized mice. Mice were monitored with retro-orbital bleeds collected into EDTA containing tubes, and plasma collected after centrifugation for 30 minutes at 2.3G. Collected plasma was frozen until further use for HBV-DNA, HBsAg, and human albumin analysis.
[0196] Plasma Analysis
[0197] Plasma HBsAg levels was quantified using commercially available ELISA reagents (International Immuno Diagnostics, Foster City, Calif.) and HBsAg standards (Alpha Diagnostic International, San Antonio, Tex.). Plasma HBV DNA levels were determined by quantitative PCR as previously described (Billioud, et al., 2016). Human plasma albumin levels were assessed by ELISA (Bethyl laboratories, Montgomery, Tex.) and was performed according to manufacturer's protocol.
[0198] Immunohistochemistry
[0199] Liver frozen tissue slides were fixed for 10 minutes with 4% PFA. Co-staining against HBV and human markers was performed overnight at 4? C. in PBS-T buffer (PBS 1? containing 0.5% BSA and 0.2% of triton-100) using the following primary antibodies: rabbit anti-hepatitis B virus core antigen (Dako/Agilent, Santa Clara, Calif.), mixed either with goat anti-human Albumin (Bethyl laboratories, Montgomery, Tex.) or with mouse anti-human Nuclei antibody (Millipore, St. Charles, Mo.). After washing the primary antibodies with PBS 1?, slides were incubated for 1 hour at room temperature with Alexa-Fluor secondary antibodies (Molecular Probes, Eugene, Oreg.). Vectashield plus DAPI (Vector Labs, Burlingame, Calif.) was used for slides mounting.
[0200] Serial sections of paraffin-embedded liver were first de-waxed, rehydrated, and blocked with hydrogen peroxide. For T-cell staining, antigen retrieval at 90? C. with citrate buffer (Dako/Agilent) was performed followed by blocking with M.O.M Ig blocking solution (Vector Labs). Mouse anti-human CD3 primary antibody (Leica Biosystems, Buffalo Grove, Ill.) was then applied. For HBV staining, slides were first blocked with goat serum (Vector Labs), followed by incubation with rabbit anti-HBV core antigen primary antibody (Dako/Agilent). Corresponding biotinylated secondary antibodies from M.O.M and Rabbit Vectastain ABC kits were next added (Vector Labs). Staining was developed using DAB peroxidase substrate kit (Vector Labs) following manufacturer's recommendations. Hematoxylin was used for counterstaining and Vectamount AQ (Vector Labs) media was used to mount the slides.
[0201] Images were visualized and quantified with NIH ImageJ software in order to assess HBV core to human albumin or human nuclear positive cell ratios among the human liver chimer mouse sections. This was done by manual, individual counting of every positive cell in a given field for two different markers (either HBV core and human albumin or human nuclear) denoted with different tags in ImageJ. Random sections of livers for a total of 4 fields containing human hepatocytes were selected to remove bias.
[0202] Statistics
[0203] Statistical analysis was performed using GraphPad Prism 7 software (GraphPad Software, Inc., La Jolla, Calif.). Data measurements are presented as mean+/?standard error of mean (SEM). Mean differences were tested using appropriate tests including unpaired, parametric, one-tailed t-tests. Significance level used was p<0.05, unless otherwise specified.
[0204] Study Approval
[0205] Human peripheral blood mononuclear cells (PBMCs) from healthy donors were obtained under a Baylor College of Medicine IRB approved protocol, after informed consent was obtained in accordance to the Declaration of Helsinki. All animal experiments followed a protocol approved by the Baylor College of Medicine Institutional Animal Care and Use Committee.
[0206] Although embodiments of the present invention and its advantages have been described in detail, it should be understood that various changes, substitutions and alterations can be made herein without departing from the spirit and scope of the inventions as defined by the appended claims. Moreover, the scope of the present application is not intended to be limited to the particular embodiments of the process, machine, manufacture, composition of matter, means, methods and steps described in the specification. As one of ordinary skill in the art will readily appreciate from the disclosure of the present invention, processes, machines, manufacture, compositions of matter, means, methods, or steps, presently existing or later to be developed that perform substantially the same function or achieve substantially the same result as the corresponding embodiments described herein may be utilized according to the present inventions. Accordingly, the appended claims are intended to include within their scope such processes, machines, manufacture, compositions of matter, means, methods, or steps.
REFERENCES
[0207] Ahmed, N. et al. HER2-specific T cells target primary glioblastoma stem cells and induce regression of autologous experimental tumors. Clin Cancer Res 16, 474-485 (2010). [0208] Azuma, H. et al. Robust expansion of human hepatocytes in Fah?/?/Rag2?/?/Il2rg?/? mice. Nat. Biotechnol. 25, 903-910 (2007). [0209] Billerbeck, E. et al. Humanized mice efficiently engrafted with fetal hepatoblasts and syngeneic immune cells develop human monocytes and NK cells. Journal of Hepatology 65, 334-343 (2016). [0210] Billioud, G. et al. In vivo reduction of hepatitis B virus antigenemia and viremia by antisense oligonucleotides. Journal of Hepatology 64, 781-789 (2016). [0211] Bissig, K.-D. et al. Human liver chimeric mice provide a model for hepatitis B and C virus infection and treatment. J. Clin. Invest. 120, 924-930 (2010). [0212] Bissig, K.-D., Le, T. T., Woods, N.-B. & Verma, I. M. Repopulation of adult and neonatal mice with human hepatocytes: a chimeric animal model. Proc. Natl. Acad. Sci. U.S.A. 104, 20507-20511 (2007). [0213] Bohne, F. et al. T Cells Redirected Against Hepatitis B Virus Surface Proteins Eliminate Infected Hepatocytes. Gastroenterology 134, 239-247 (2008). [0214] Boni, C. et al. Characterization of hepatitis B virus (HBV)-specific T-cell dysfunction in chronic HBV infection. Journal of Virology 81, 4215-4225 (2007). [0215] Brudno, J. N. & Kochenderfer, J. N. Toxicities of chimeric antigen receptor T cells: recognition and management. Blood 127, 3321-3330 (2016). [0216] Eren, R. et al. Preclinical Evaluation of Two Human Anti-Hepatitis B Virus (HBV) Monoclonal Antibodies in the HBV-Trimera Mouse Model and in HBV Chronic Carrier Chimpanzees. Hepatology 32, 588-596 (2000). [0217] Galun, E. et al. Clinical evaluation (phase I) of a combination of two human monoclonal antibodies to HBV: safety and antiviral properties. Hepatology 35, 673-679 (2002). [0218] Guidotti, L. G. et al. Intracellular inactivation of the hepatitis B virus by cytotoxic T lymphocytes. Immunity 4, 25-36 (1996). [0219] Guidotti, L. G. et al. Viral clearance without destruction of infected cells during acute HBV infection. Science 284, 825-829 (1999). [0220] Hoh, A. et al. Hepatitis B Virus-Infected HepG2hNTCP Cells Serve as a Novel Immunological Tool To Analyze the Antiviral Efficacy of CD8+ T Cells In vitro. Journal of Virology 89, 7433-7438 (2015). [0221] Hombach, A. A. et al. T cell activation by antibody-like immunoreceptors: the position of the binding epitope within the target molecule determines the efficiency of activation of redirected T cells. J. Immunol. 178, 4650-4657 (2007). [0222] Hudecek, M. et al. The nonsignaling extracellular spacer domain of chimeric antigen receptors is decisive for in vivo antitumor activity. Cancer Immunol Res 3, 125-135 (2015). [0223] Krebs, K. et al. T cells expressing a chimeric antigen receptor that binds hepatitis B virus envelope proteins control virus replication in mice. Gastroenterology 145, 456-465 (2013). [0224] Krebs, S. et al. T cells redirected to interleukin-13R?2 with interleukin-13 muteinchimeric antigen receptors have anti-glioma activity but also recognize interleukin-13R?1. Cytotherapy 16, 1121-1131 (2014). [0225] Legrand, N. et al. Functional CD47/signal regulatory protein alpha (SIRP(alpha)) interaction is required for optimal human T- and natural killer-(NK) cell homeostasis in vivo. Proc. Natl. Acad. Sci. U.S.A. 108, 13224-13229 (2011). [0226] Liaw, Y.-F. HBeAg seroconversion as an important end point in the treatment of chronic hepatitis B. Hepatol Int 3, 425-433 (2009). [0227] Morgan, R. A. et al. Recognition of glioma stem cells by genetically modified T cells targeting EGFRvIII and development of adoptive cell therapy for glioma. Human Gene Therapy 23, 1043-1053 (2012). [0228] Nakabori, T. et al. Sodium taurocholate cotransporting polypeptide inhibition efficiently blocks hepatitis B virus spread in mice with a humanized liver. Scientific Reports 6, 27782 (2016). [0229] Ning, Q. et al. Switching from entecavir to PegIFN alfa-2a in patients with HBeAg-positive chronic hepatitis B: a randomised open-label trial (OSST trial). Journal of Hepatology 61, 777-784 (2014). [0230] Park, J. R. et al. Adoptive transfer of chimeric antigen receptor re-directed cytolytic T lymphocyte clones in patients with neuroblastoma. Mol Ther 15, 825-833 (2007). [0231] Perz, J. F., Armstrong, G. L., Farrington, L. A., Hutin, Y. J. F. & Bell, B. P. The contributions of hepatitis B virus and hepatitis C virus infections to cirrhosis and primary liver cancer worldwide. Journal of Hepatology 45, 529-538 (2006). [0232] Phillips, S. et al. CD8(+) T cell control of hepatitis B virus replication: direct comparison between cytolytic and noncytolytic functions. J. Immunol. 184, 287-295 (2010). [0233] Shepard, C. W., Simard, E. P., Finelli, L., Fiore, A. E. & Bell, B. P. Hepatitis B virus infection: epidemiology and vaccination. Epidemiol Rev 28, 112-125 (2006). [0234] Takenaka, K. et al. Polymorphism in Sirpa modulates engraftment of human hematopoietic stem cells. Nat. Immunol. 8, 1313-1323 (2007). [0235] Thimme, R. et al. CD8(+) T cells mediate viral clearance and disease pathogenesis during acute hepatitis B virus infection. Journal of Virology 77, 68-76 (2003). [0236] Uchida, T. et al. Human Cytotoxic T Lymphocyte-Mediated Acute Liver Failure and Rescue by Immunoglobulin in Human Hepatocyte Transplant TK-NOG Mice. Journal of Virology 89, 10087-10096 (2015). [0237] Washburn, M. L. et al. A humanized mouse model to study hepatitis C virus infection, immune response, and liver disease. Gastroenterology 140, 1334-1344 (2011). [0238] Wieland, S. F., Spangenberg, H. C., Thimme, R., Purcell, R. H. & Chisari, F. V. Expansion and contraction of the hepatitis B virus transcriptional template in infected chimpanzees. Proc Natl Acad Sci USA 101, 2129-2134 (2004). [0239] Xia, Y. et al. Interferon-? and Tumor Necrosis Factor-? Produced by T Cells Reduce the HBV Persistence Form, cccDNA, Without Cytolysis. Gastroenterology 150, 194-205 (2016).