PARTHENOCARPIC WATERMELON PLANTS
20190300900 ยท 2019-10-03
Inventors
- Alberto Sirizzotti (Sant'Agata Bolognese, IT)
- Richard Bernard Berentsen (Zutphen, NL)
- Hendrik Willem Vriezen (Haelen, NL)
Cpc classification
C12N15/8213
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention is directed to seedless fruit producing watermelon plants. The present invention also comprises methods for production of said plants and methods for producing seedless watermelon fruits.
Claims
1. A plant or plant part comprising at least one copy of a mutant allele of a gene name WOP1, said gene encoding a protein of SEQ ID NO: 32 or a protein comprising at least 95% sequence identity to SEQ ID NO: 32, said mutant allele conferring facultative parthenocarpy when the mutant allele is in homozygous form.
2. The plant or plant part according to claim 1, wherein said mutant allele results in reduced expression or no expression of the WOP1 gene or wherein the mutant allele encodes a protein having a decreased function or a loss-of-function compared to the wild type protein.
3. The plant or plant part according to claim 1, wherein said protein comprising one or more amino acids replaced, inserted or deleted compared to the wild type protein.
4. The plant or plant part according to claim 1, wherein said protein comprises the myb-like DNA binding domain SHAQKYF-class of SEQ ID NO: 35.
5. The plant or plant part according to claim 1, wherein said protein comprises the myb-like DNA binding domain SHAQKYF-class of SEQ ID NO: 35 and wherein one or more amino acids are replaced, inserted or deleted in said domain.
6. The plant or plant part according to claim 5, wherein at least one amino acid of amino acids 47 to 54 of SEQ ID NO: 35 is replaced by another amino acid.
7. The plant or plant part according to claim 1, wherein the plant is a watermelon, a cucumber or a melon plant.
8. The plant or plant part according to claim 1, wherein said plant or plant part is diploid and is homozygous for the mutant allele.
9. The plant or plant part according to claim 1, wherein the plant is a watermelon plant and wherein the watermelon plant is diploid, triploid or tetraploid.
10. The plant or plant part according to claim 9, wherein the diploid plant or plant part comprises two copies, the triploid plant or plant part comprises three copies and the tetraploid plant or plant part comprises four copies of the mutant allele.
11. A seed from which a plant or plant part according to claim 1 can be grown.
12. A fruit produced by a plant according to claim 1, optionally wherein the fruit is seedless and is produced in the absence of pollination.
13. The plant or plant part according to claim 1, wherein said plant or plant part further comprises a gene conferring male sterility or a gene conferring stenospermocarpy.
14. The plant part according to claim 1, wherein the plant part is a cell, a flower, a leaf, a stem, a cutting, an ovule, pollen, a root, a rootstock, a scion, a fruit, a protoplast, an embryo, or an anther.
15. A vegetatively propagated plant propagated from a plant part according to claim 14.
16. A method of producing seedless watermelon fruits, comprising growing a triploid watermelon plant comprising three copies of mutant allele according to claim 1, and harvesting the fruits produced by said plants.
17. The method according to claim 16, whereby the fruits develop without pollination of the female flowers.
18. The plant or plant part according to claim 6, wherein amino acid 47 is not a Serine.
Description
[0123]
[0124]
[0125]
DETAILED DESCRIPTION
[0126] A first embodiment of the present invention concerns cultivated watermelon plants, Citrullus lanatus, comprising at least one copy of a mutant allele of a gene conferring parthenocarpy when the mutant allele is in homozygous form, especially facultative parthenocarpy. Thus in one aspect cultivated watermelon plants are provided, comprising at least one copy of a mutant allele of a single recessive gene called WOP1.
[0127] The WOP1 gene is an endogenous gene of cultivated watermelon, which when mutated and in homozygous form results in parthenocarpy, especially facultative parthenocarpy.
[0128] A segregating population made by crossing the mutant parthenocarp watermelon plant identified by the inventors with an elite watermelon line enabled mapping of the WOP1 gene to a region on chromosome 4 between 8.3 Mb (SNP1a) or 11.9 Mb (SNP1) and 21.8 Mb (SNP24) of the chromosome, in particular the WOP1 gene was mapped to the region of chromosome 4 starting at nucleotide 14.402.485 (SNP3) and ending at nucleotide 18.942.612 (SNP23) of chromosome 4, see Table 1 below and
[0129] Further analysis led to the identification of SNP16a comprising a polymorphism in a protein coding sequence. In the mutant parthenocapric watermelon plant SNP16a comprised an Adenine at nucleotide 428 of SEQ ID NO: 30, while the wild type plant comprised a Guanine at nucleotide 428. This resulted in a single amino acid change of the encoded protein, as codon AGC (encoding a Serine) was changed to codon AAC (encoding an Asparagine). Thus, the wild type protein, depicted in SEQ ID NO: 32, comprises a Serine at amino acid 143, and the mutant protein, depicted in SEQ ID NO: 31, comprises an Aspargine at amino acid 143. There were no introns in the sequence, so the genomic DNA and coding DNA (cDNA, and corresponding mRNA) are identical.
TABLE-US-00001 TABLE 1 SNP SNP nucleotide in nucleotide in plant plant Physical comprising comprising position (in mutant wop1 wild type base pairs) on allele (as WOP1 allele chromosome 4 found in (as found in according to NCIMB42533 NCIMB42533 SNP ICUGI.org plants plants marker version 1 of comprising lacking Sequence comprising the SNP (with SNP name the genome wop1) wop1) indicated between brackets in bold) SNP1a 8.385.759 A G ATTGGTTTGTGACTCGGATTCAGAG GAATTGTTATTGGAAGAGAAGCTA TCATTTATGCATGAAACGAGGCAT GC[A/G]TTCGGAAGGACTGCCCTGC TCTTAAGTGGAGGTGCTTCACTTGG AGCTTTTCATACAGGAGTTGTCAAA ACTCTG (SEQ ID NO: 29) SNP1 11.906.147 A G TAGCTTTCAATTAGAATTTCTTATG AAAATTGTTTACGTATCAATTATCA TTGTCATTTTGCTAGTTTTACCTTT [A/G]AAGTTTAATTGATACAATTGTA AATCTCACCATGTTTTTCAAACGAA ATCTAAAAGAGTATAAATTGATAC AATT (SEQ ID NO: 1) SNP2 13.357.557 T C AGAAGARGGCGAAGTTGAGGAAAG AGCTCAGAGCCCTAAGAAGAGGAG CAGAGGAAATTGCTAAGGACGCAT TGT[C/T]CAACAAAAAGGTGTGCAG GGTAGTGCAACCTGAAGAAGAAAT ACAAACGCATAGACTTCCTGATCCT CAAGTAGA (SEQ ID NO: 2) SNP3 14.402.485 C T TAAAATGGTTGTTCAAGGAAGGTT ATTGAAAGATGATAATTTGATTTTC AAGTCAAACGATAATAGGAGACGC AT[C/T]AAAGAATCAAAAGGGATTT TTGAGTGAAAATTATTATTTAAAAT GTTTCCTAATTGGTTATAAGGATGT TTTTCC (SEQ ID NO: 3) SNP4 14.971.673 C T CCGAGAGCGAGATTCTGAGCGAGA GCGAGAGAGCGAGAGTCTGAGCGA GAGAGTGAGATTCTGGCGAGGGAC TTC[C/T]CGGAAAGTAGAATCCGTC AAGGCGAGCGGCGACTGAGAGAGA GACAACGGGAAACAAAGGTAAAG AGAGAGTGTG (SEQ ID NO: 4) SNP5 15.141.259 A G AAGCAGCAGGCATTTTAGTTAATTA AACGAAAACTTACGGGAATTAGGA TTCATTAACTTAAATTAACTAAAGT T[A/G]ATTTTAAAAAATAGTGGAAT TGGTTTAACTTAAGTTTAATTAACT AATTAAAAATATAAAACTTAATCA GCTTTG (SEQ ID NO: 5) SNP6 15.159.947 C T AAAATTTACCTTTAGAGTTTGGACT CGCTGCCACTGGAAATCGACTCACT CACTAGCACTGATCTGAGACTTTTA [C/T]AAAAATGGAGAAAGACTTTTA CATGAGTTGGTAACACATACGGTG ACCAACTCCAACAAACAATCATCG CCTTAC (SEQ ID NO: 6) SNP7 15.182.361 T C CACCTCTTAGATGCAGGGTTGATAG TTTTTGGACTCGTAGTGCACTAGTT AGACGCCTAATTTTCTTCATAAAGG [C/T]TCTCAACTTTTCTTAATTTGAG TTCTAAAGTGATTTTCAGTGAGTAA AGAAGTGATTCCCCGAGTCTTATTT ATA (SEQ ID NO: 7) SNP8 15.229.617 G A AAATGAAGTTAAACCGAAAAAAGT GTGCTTTCGGAGTAGCTTCAGGCAA GTTTCTAGGCTTCATGGTCAATCAT A[A/G]AGGAATTAAAGCAAATCTA GACAAGATACGAGCTGTCCTGGAG ATGGAGTCTCCTAAGACACTAAAG CAACTTCA (SEQ ID NO: 8) SNP9 15.341.020 C T AAGGGTGATTGTACAAGAGAAGGA TTTGTAGCTAAGAATGGACATAAG GAAAGAGAGAGGACGCATGATAGT ATG[C/T]GATTAAGGCAGACGCATG GTATTATATGGTAAGCTGAAACGT ATAGTAGTATGCGTTTAAGACTTAA ACACCTAG (SEQ ID NO: 9) SNP10 15.425.952 A G ATGTTTGATTGAAACCAAAAACCA GAAGAATTCGAAGCTCAACCCAAT CCCAAGAAAGAGGAGTTGGAAGTG GTG[A/G]AAACGGGAGAAGAAGAA GAAGAACAACAACAACAACAAGAT GCTGAATCTTACTGTTCGAAGTTTA CTGGGTAGA (SEQ ID NO: 10) SNP11 15.573.767 G A GTTTGGTGAATATCTGAAACATACA AAATGGATTTAATTGTGTAGATAA ATTCATTGTTTAGAAACTTTCAAAT T[A/G]AATTGAAATTTCAAATTAAA ATGATGTTTCATGTACAAATTTAAC ATGTATGAAAGTTAAATTTGTAGTT TCTTC (SEQ ID NO: 11) SNP12 15.638.032 A G TTTTGTTATCTACTTTCTAAAAGTG TTCTAAAAAACCAATCAATGGTTTG GAAACTAGTTTTCAAAAATTTATTT TTGTTTTTAA[A/G]AATTTGACGAA AAATTCAAAAGTTTCTTTAAGAAA GGTTGAAGCTATAGTAAAGAATTT NTGAGG (SEQ ID NO: 12) SNP13 15.961.924 G T CAAAAGTTGCATGATATAGTAATA GCCAAACACATAATGTAATGTTAA GTATCCGAAGGTCGTAGTAATTCTC TT[G/T]ACTTACATTAACAGCAACA ATGGAAGGAAAAAAAAACCCAAAT AAGTACCCAAAAATTAAAGAATAC TTTCTATG (SEQ ID NO: 13) SNP14 15.984.532 A G TTGTAGAAATTAAACCCACAAATG ATAGAAATCGAACTCTCACATTTGT ACGATTATTACAATTTGTACAATTA T[A/G]TTAGTCTGAGAGTTCAATTTT AACATTTGTATAAGTTTGAAGTCTC AATTTTTAAAATTAAAAGTTTAAGG GGAT (SEQ ID NO: 14) SNP15 16.021.388 G A TGGAGTCACCCTTCGTCGGCCATAT TCTCGCATTTCCCCGTCACTCAGTT GCAGCGCTCCAGCCTTCACGGTGC G[A/G]CCTTAATCGCAGTTCACAGC ATTGTGGCATCGTCATAGTTGTCGC GCCGCAGCATCTTGGTCGTCGCGCC CCAGC (SEQ ID NO: 15) SNP16 16.540.678 A G ACTTTTCTAAAAAACAACCATTACT TATGCAATATGATTGATTCCTAATT TCTTGAAACCAAGTTAATAAGCAT A[A/G]CATTAAGATTAGTCATGATC AACTTTTTCTAATAACCTAGCTATT TAATTAATAGAGATTCAATGCTATA GATCC (SEQ ID NO: 16) SNP16a 16.610.755 A G ATGAGGGAAGAACACTCGAATTGG TTCTCTAGGTGGGAAGAGGAGCTT CCATCTCCAGATGAATTGATGCCTC TTTCTCAAACCCTAATAACCCCCGA TCTAGCTTTGGCCTTTGATATTCAG AATCCCAGCAATAGCAGTCCGCCG TTGCCTTGTCCATCTCCGCCGCTTT CGAATCCTCTGCCTGGCTCTGGCAA CGGAATTGCGCAGCCCAACTCGGC GGATTTCGGCGATTCTGCCGATTTG GGCTCCGGCGCCGCCAGCGACGAG CCGGCTCGGACCCTCAAGCGACCA CGCCTTGTTTGGACGCCTCAGCTCC ACAAGCGATTCGTCGATGCTGTTGC TCATTTAGGGATAAAAAATGCCGT CCCCAAGACCATAATGCAGCTCAT GAGTGTCGATGGCTTGACCCGAGA GAACGTAGCTA[A/G]CCATTTGCAG AAGTACCGCCTCTATCTCAAGCGG ATGCAGGGGTTGTCCTCCGGCGGC GGCGGTGGTGGTGGTGGCTTGGTT GCTTCCTCCGATCCCGCCACTGACC ATTTGTTTGCCAGCTCCCCAGTTCC ACCCCATTTGCTTCACTCTGCTCGC ACCAGTTCAGACCATTTCTTGCCCT TTGTTCCCATGGCCACTCTGCAGCA GCACCACCATCACCAGCAGCAGAT GGCCGCTGCTGCTGCTGTCGCCGTC CATCCGCAGCTCCAGCCGCCTTATC ATCGGCAGGTCGGGCATTTCGGGT CACCGCCGAATGGCCAGTTTGAGC ATCCATTTTTAGCTAGACAGTCCCA GCCTATCCATAGAATGGGAGCACC AGTGCCTAATTCAGTTCCTAATTAC ATAGAGGATTTGGAATCAGCCAAT GCCAGTGGAGGAAGAAAAGTTCTC ACCTTATTTCCTACTGGGGATGATT GA (SEQ ID NO: 30) SNP17 16.908.561 G A ATGTAATTAGAGTAAGTATCCATAT GAAATATGATCCAATCGATATTTGA AATAATTAACAAACTTGCTACTAA A[A/G]AAAACTTTAGCTTTTAAACC TACACAAATTTAATATATGAAATAC ACTTTTGATCTGGTTGAATTCCAAT TCTAA (SEQ ID NO: 17) SNP18 17.231.215 C A TTTACTCAAATTTTAAAAAACTTGT TTTGTTTTTAGAACGGTGAAAATTA CCATAATTTAAAAATTGGAAGGAA C[A/C]AATATAAATTTTTAAGGAAA AAAAAACAAAAAAATTAAAACAAA ATCGTTGCAAAAAGACCTTTAATTA TATTGA (SEQ ID NO: 18) SNP19 17.429.279 G A TCTACCAATCTTACTCTATTAATTC TCCCAATTTTTATTAGAAAAATTCT AAGAAAATTCTTATTCCCATAAGCG [A/G]TTCCCACAAACCAGATCTTTG CGCGAGTCATAGCGAGGAAGATCT CTTGGAAAAGAAAGACTACAAGGA GAAGAC (SEQ ID NO: 19) SNP20 17.675.772 T C AACATTTTACTATAAATTTTGGAAA CACATTCACATATTATATTTCTTTA CATAAAAATTATTGTTGTTATTTAA [C/T]CAATTTCAATAAAAATTAACTT TGAGAGACTAAATTTAAGATTTATT AAAAATACATAAATTAAAATTGGA CAAT (SEQ ID NO: 20) SNP21 17.819.497 G T AACATCCTAAAACTATGAGTTTAGC CACGGATAGACATCAAATACATAC ATTCATATGAGTTCTCAAGCATAAA A[G/T]TAAAAGAGAAAGAGAAACT TAGGAAGAAAGACTCTCGAATTGC TTCCCCGCGTTGAATTCCTTCGATC TCCACTT (SEQ ID NO: 21) SNP22 18.708.457 G C CTTTTCAGGTGGCTACTCCTAAACA TTTCTTTACAGGTGGGTGCTTCTAG CATGACAGTTTTACGTAGTATTTGG CAGA[C/G]TTACTGGCTCGATAAGC ATGGGGATGCCATGGAGAGCGTTG TTGATCAGCTTGCACGAAGTCTATC AGAGA (SEQ ID NO: 22) SNP23 18.942.612 G T ATATGTCATTAATAAATTGCTAACT AGACTAAAAATTTAGATGTCTAAA CACATATGTTGCTTAGGTGTGCCAA ATAATC[G/T]GATTGATATATATGG AAATTTACGATCATAGAATAATTAT TTTAGGGCCATTTTTTTAATTGACG TTTAA (SEQ ID NO: 23) SNP24 21.897.585 C A TCAGATGAGTGACGTTCAATTTGTC TATTTTATTGTACAATCAATGATCA CAACAAAGCTATTTATATTTTCAAT [A/C]ATTCTATTTTTGTTGTATAGTA ATTTTGTTATATAGTAATTTCGTTA TCCTAAACTATTTTCATTCTTCTAA GTA (SEQ ID NO: 24)
[0130] When referring to specific SNPs, reference is either made to the specific nucleotide number of the SNP and/or to the entire sequence comprising the SNP. For example, SNP1 refers herein either to nucleotide 76 of SEQ ID NO: 1, or nucleotide 76 of a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 1, and/or, SNP1 refers to SEQ ID NO: 1, or a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 1. To indicate both possibilities brackets are used as follows: SNP1 refers herein to (nucleotide 76 of) SEQ ID NO: 1, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 1.
[0131] Thus, SNP1a refers herein to (nucleotide 76 of) SEQ ID NO: 29, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 29; SNP1 refers herein (to nucleotide 76) of SEQ ID NO: 1, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 1; SNP2 refers (to nucleotide 76 of) SEQ ID NO: 2, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:2; SNP3 refers (to nucleotide 76 of) SEQ ID NO: 3, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:3; SNP4 refers to (nucleotide 76 of) SEQ ID NO: 4, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:4; SNP5 refers to (nucleotide 76 of) SEQ ID NO: 5, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:5; SNP6 refers to (nucleotide 76 of) SEQ ID NO: 6, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:6; SNP7 refers to (nucleotide 76 of) SEQ ID NO: 7, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:7; SNP8 refers to (nucleotide 76 of) SEQ ID NO: 8, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:8; SNP9 refers to (nucleotide 76 of) SEQ ID NO: 9, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:9; SNP10 refers to (nucleotide 76 of) SEQ ID NO: 10, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:10; SNP11 refers to (nucleotide 76 of) SEQ ID NO: 11, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:11; SNP12 refers to (nucleotide 86 of) SEQ ID NO: 12, or (nucleotide 86 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:12; SNP13 refers to (nucleotide 76 of) SEQ ID NO: 13, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:13; SNP14 refers to (nucleotide 76 of) SEQ ID NO: 14, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:14; SNP15 refers to (nucleotide 76 of) SEQ ID NO: 15, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:15; SNP16 refers to (nucleotide 76 of) SEQ ID NO: 16, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:16; SNP16a refers to (nucleotide 428 of) SEQ ID NO: 30, or (nucleotide 428 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:30; SNP17 refers to (nucleotide 76 of) SEQ ID NO: 17, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:17; SNP18 refers to (nucleotide 76 of) SEQ ID NO: 18, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:18; SNP19 refers to (nucleotide 76 of) SEQ ID NO: 19, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:19; SNP20 refers to (nucleotide 76 of) SEQ ID NO: 20, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:20; SNP21 refers to (nucleotide 76 of) SEQ ID NO: 21, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:21; SNP22 refers to (nucleotide 80 of) SEQ ID NO: 22, or (nucleotide 80 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:22; SNP23 refers to (nucleotide 81 of) SEQ ID NO: 23, or (nucleotide 81 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:23; SNP24 refers to (nucleotide 76 of) SEQ ID NO: 24, or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:24. Sequence identity is preferably determined by pairwise alignment of sequences of the same length.
[0132] In one aspect the WOP1 gene and the copy of the mutant allele is located in the region between 8.3 Mb (SNP1a) or 11.9 Mb (SNP1) and 21.8 Mb (SNP24), preferably between 14.4 Mb (SNP3) and 18.9 Mb (SNP23) of chromosome 4. In another aspect the WOP1 gene and the copy of the mutant allele is located in the region between 16.5 Mb (SNP16) and 16.9 Mb (SNP17). In another aspect the WOP1 gene and the copy of the mutant wop1 allele is linked to SNP16a or to SEQ ID NO: 30 or a sequence comprising at least 95% sequence identity to SEQ ID NO: 30, preferably to a Adenine at nucleotide 428 of SEQ ID NO: 30.
[0133] As nucleotide 11.906.147 of chromosome 4 is SNP1 and nucleotide 21.897.585 is SNP24 herein, the copy of the mutant allele is, in one aspect, located between (nucleotide 76 of) SEQ ID NO:1 or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or more sequence identity to SEQ ID No:1 and (nucleotide 76 of) SEQ ID No: 24 or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or more sequence identity to SEQ ID No:24.
[0134] As nucleotide 8.385.759 of chromosome 4 is SNP1a and nucleotide 21.897.585 is SNP24 herein, the copy of the mutant allele is, in one aspect, located between (nucleotide 76 of) SEQ ID NO:29 or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or more sequence identity to SEQ ID No:29 and (nucleotide 76 of) SEQ ID NO 24 or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or more sequence identity to SEQ ID No:24.
[0135] In another aspect the WOP1 gene and the copy of the mutant allele is located in the region between 14.4 Mb (SNP3) and 18.9 Mb (SNP23).
[0136] As nucleotide 14.402.485 is SNP3 herein and nucleotide 18.942.612 is SNP23 herein, the copy of the mutant allele is, in another aspect, located between (nucleotide 76 of) SEQ ID NO:3 or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or more sequence identity to SEQ ID No:3 and (nucleotide 81 of) SEQ ID No: 23 or (nucleotide 81 of) a sequence comprising at least 95%, 96%, 97%, 98% or more sequence identity to SEQ ID No:23.
[0137] In another aspect the WOP1 gene and the copy of the mutant allele is located in the region between 16.5 Mb (SNP16) and 16.9 Mb (SNP17).
[0138] As nucleotide 16.540.678 is SNP16 herein and nucleotide 16.908.561 is SNP17 herein, the copy of the mutant allele is, in another aspect, located between (nucleotide 76 of) SEQ ID NO:16 or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or more sequence identity to SEQ ID No:16 and (nucleotide 76 of) SEQ ID No: 17 or (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or more sequence identity to SEQ ID No:17.
[0139] In a further embodiment, the mutant allele is located in the region between any two SNP markers selected from the group consisting of SNP1a to SNP24; or between any two SNP markers selected from the group consisting of SNP1 to SNP24; or between any two SNP markers selected from the group consisting of SNP3 to SNP23. So for example, in one aspect the mutant wop1 allele is found between SNP1 (or SNP1a) and SNP3, between SNP2 and SNP4, between SNP3 and SNP5, between SNP4 and SNP6, etc. up to between SNP22 and SNP24. In one aspect the mutant wop1 allele is found between SNP3 and SNP5, or between SNP4 and SNP6, or between SNP5 and SNP7, or between SNP6 and SNP8, etc. up to between SNP21 and SNP23. In a preferred aspect the mutant wop1 allele is found between SNP16 and SNP17.
[0140] Fine-mapping and/or sequencing can be done do determine between which pair of SNP markers the mutant allele is located and/or to identify the gene itself. For example, comparison of the genomic sequence of chromosome 4 in the region between SNP1 (or SNP1a) and SNP24 (or between SNP3 and SNP23) between a plant homozygous for the wild type WOP1 gene and a plant homozygous for the mutant wop1 gene allows identification of the gene itself. In one aspect the WOP1 gene is the gene encoding the protein of SEQ ID NO: 32, herein referred to as the WOP1 protein. One mutant wop1 allele according to the invention is the mutant allele comprising the nucleotide sequence of SEQ ID NO: 30, encoding the mutant WOP1 protein of SEQ ID NO: 31, but other mutant wop1 alleles are also encompassed herein, as described elsewhere herein.
[0141] In one aspect the mutant wop1 allele is linked to (preferably closely linked to) at least one molecular marker, preferably a SNP marker (or sequence comprising the SNP marker, or a sequence comprising at least 90%, 95%, 96%, 97%, 98% or 99% sequence identity to the sequence comprising the SNP marker) selected from the group consisting of SNP1a, SNP1, SNP2, SNP3, SNP4, SNP5, SNP6, SNP7, SNP8, SNP9, SNP10, SNP11, SNP12, SNP13, SNP14, SNP15, SNP16, SNP16a, SNP17, SNP18, SNP19, SNP20, SNP21, SNP22, SNP23 and SNP24. In one aspect the wop1 allele is linked to, preferably closely linked to, at least one marker selected from the group consisting of SNP3, SNP4, SNP5, SNP6, SNP7, SNP8, SNP9, SNP10, SNP11, SNP12, SNP 13, SNP14, SNP15, SNP16, SNP16a, SNP17, SNP18, SNP19, SNP20, SNP21, SNP22 and SNP23. In a further aspect the mutant wop1 allele is linked to SNP16, SNP16a and/or SNP17, preferably to at least SNP16a, e.g. to an Adenine at nucleotide 428 of SEQ ID NO: 30.
[0142] The mutant allele of the WOP1 gene is in one aspect the mutant allele as found in seeds deposited under accession number NCIMB42533 or progeny thereof. The mutant allele comprises a mutation in the genomic DNA (identical to the cDNA and mRNA, whereby in the mRNA Thymine is replaced by Uracil) of SEQ ID NO: 30, resulting in the expression of a mutant WOP1 protein (SEQ ID NO: 31). The mutant WOP1 protein comprises a single amino acid replacement of Serine 143 (replaced by Asparagine). This amino acid replacement is in the conserved domain referred to as myb-like DNA binding domain SHAQKYF class. In fact the amino acid substitution is in the C-terminal of that conserved domain, in the SHAQKYF domain. The myb-like DNA binding domain SHAQKYF class is highly relevant for the three dimensional structure of the protein and comprises several alpha helices. The amino acid substitution in this conserved domain leads to a reduced function of the protein, possibly even a loss-of-function, compared to the wild type WOP1 protein of SEQ ID NO: 32.
[0143] The mutant WOP1 allele as found in the deposited seeds is one aspect of the invention. However, also different mutant alleles of the WOP1 gene, causing facultative parthenocarpy when in homozygous form, are embodiments of the invention. Such different mutant wop1 alleles can be generated by the skilled person without undue burden. The skilled person can, for example, generate other mutants in the WOP1 gene and determine whether they equally result in facultative parthenocarpy when in homozygous form in a diploid watermelon plant.
[0144] As mentioned the WOP1 gene in watermelon was identified to be a gene encoding a protein of SEQ ID NO: 32, which is a small protein comprising the conserved myb-like DNA binding SHAQKYF class domain from amino acid 97 to amino acid 150 of SEQ ID NO: 32. The conserved domain is also depicted in SEQ ID NO: 35. An amino acid substitution in the SHAQKYF domain, which is part of this larger conserved domain at (and including) amino acid 143 to (and including) amino acid 150, was found in the facultative parthenocarpic mutant and is responsible for the phenotype when the mutant allele is in homozygous form. The mutant protein of SEQ ID NO: 31, comprising the S143N mutation (Serine 143 to Asparagine substitution), thus has a reduced function or loss-of-function compared to the wild type protein of SEQ ID NO: 32, causing facultative parthenocarpy in watermelon. Also orthologs in cucumber and melon of the WOP1 gene were identified, enabling parthenocarpic cucumber and melon plants to be made without undue burden.
[0145] Having identified the nucleotide sequence of the gene, the skilled person can generate watermelon plants comprising mutants in the WOP1 gene by various methods, e.g. mutagenesis, TILLING or CRISPR-Cas or other methods known in the art. Especially with targeted gene modification technologies such as Crispr-Cas, TALENS and others, targeted mutations can be made by the person skilled in the art. He can then confirm the phenotype of a plant homozygous for the mutant wop1 allele, i.e. being facultative parthenocarpic, optionally in comparison to the phenotype of plants accession number NCIMB42533 or progeny thereof. Therefore the skilled person is not limited to the specific WOP1 mutant generated by the inventors and of which the mutant allele is present in the deposited seeds, but the skilled person can equally generate other mutations in the wop1 allele of watermelon, and also of cucumber and melon, and thereby generate other mutants which lead to facultative parthenocarpy when in homozygous form. Various mutations can be generated and tested for the resulting phenotype, for example the regulatory elements can be mutated to reduce expression (knock-down) or eliminate expression (knock-out) of the allele and thus reduce or eliminate the amount of WOP1 protein present in the cell or plant. Alternatively, mutations which lead to reduced function or loss-of-function of the WOP1 protein can be generated, i.e. mutations (such as missense mutations or frame shift mutations) which lead to one or more amino acids being substituted, inserted or deleted, or whereby the protein is truncated through the introduction of a stop-codon in the coding sequence (non-sense mutations). As the WOP1 protein comprises a large conserved domain, the myb-like DNA binding SHAQKYF class domain, encompassing a smaller conserved domain, the SHAQKYF domain, it is in one aspect encompassed that one or more amino acids are replaced, deleted or inserted in either of these domains, as such mutations will likely reduced the protein function or result in a loss of function. Whether the mutation results in the expected phenotype (facultative parthenocarpy) can then be tested by generating plants homozygous for the mutation through selfing and growing the plant line with and without pollination of the flowers to see if fruits develop in a facultative parthenocarpic way.
[0146] Alternatively, the skilled person can carry out a method for production of a facultative parthenocarpic cultivated watermelon plant comprising the steps of:
a) introducing mutations in a population of watermelon plants, especially cultivated watermelon plants or providing a population of mutated plants or progeny thereof;
b) selecting a plant producing seedless fruits without pollination of the female flowers and producing a seeded fruit after pollination of the female flowers;
c) optionally determining if the plant selected under b) comprises a mutant allele of a WOP1 gene; and
d) optionally growing the plants obtained under c).
[0147] Steps b) and c) can also be switched, so that step b) is selecting a plant comprising a mutant allele of a WOP1 gene and step c) is determining if the plant (or a progeny thereof produced by selfing) producing seedless fruits without pollination of the female flowers and producing a seeded fruit after pollination of the female flowers.
[0148] Step a) can be carried out by e.g. mutagenizing seeds of one or more lines or varieties of watermelon, for example by treatment with mutagenizing agents such as chemical mutagens, e.g. EMS (ethyl methane sulphonate), or irradiation with UV radiation, X-rays or gamma rays or the like. The population may for example be a TILLING population. Preferably the mutagnized plant population is selfed at least once (e.g. to produce an M2 generation, or M3, M4, etc.) prior to carrying out step b). In step b) relating to phenotyping, plants are preferably grown in an insect proof environment to avoid the presence of pollinators. Regular visual inspection of female flowers, fruit setting of those flowers without pollination and visual inspection of the mature fruits (e.g. presence of viable seeds or seedless) can be carried out to identify mutants which producing seedless fruits without pollination of the female flowers. Such plants, or selfing progeny thereof, can be tested for the presence of the mutant WOP1 gene by pollinating the female flowers to see if the fruits are seeded after pollination, genotyping the plants for mutations in the WOP1 gene and encoded protein, or expression of the WOP1 gene, or genotyping the plant for one or more or all of SNP1 (or SNP1a) to SNP24, allelism tests by e.g. crossing the plants with plants comprising wop1 derived from seeds deposited under NCIMB42533, sequencing and other methods known to the skilled person. There are, thus, various methods, or combinations of methods, for verifying if a phenotypically selected plant comprises a mutant allele of a WOP1 gene on chromosome 4. If step b) is the selection of plants comprising a mutant allele of the WOP1 gene, the skilled person can also use various methods for detecting the DNA, mRNA or protein of the WOP1 gene in order to identify a plant comprising a mutant wop1 allele. The genomic coding DNA of the wild type WOP1 gene, encoding a functional WOP1 protein (SEQ ID NO: 32) is the DNA of SEQ ID NO: 30, except that the Adenine at nucleotide 428 is a Guanine. The promoter is upstream of this sequence and can e.g. be retrieved by sequencing or from the watermelon genome database.
[0149] In one aspect the mutant allele of the WOP1 gene is a mutant allele resulting in reduced expression or no expression of the WOP1 gene or is a mutant allele resulting in one or more amino acids of the encoded WOP1 protein being replaced, inserted or deleted, compared to the wild type WOP1 protein.
[0150] In one aspect the mutant allele of the WOP1 gene is obtainable from seeds deposited under accession number NCIMB42533 or progeny thereof, e.g. by crossing a plant comprising one or two copies of the mutant wop1 allele with another cultivated watermelon plant. To select or identify a plant comprising one or two copies of the mutant wop1 allele as found in NCIMB42533, the SNP genotype of one or more or all of the SNP markers selected from SNP1 (or SNP1a) to SNP24 (or SNP3 to 23) can be determined. Especially in one aspect the genotype of SNP16a can be determined and used to select progeny plants comprising an Adenine at nucleotide 428 of SEQ ID NO: 30 and thus comprising the mutant wop1 allele. The diploid plant heterozygous for wop1 (i.e. wop1/WOP1) will be heterozygous for the SNP markers, e.g. will have the genotype AG for SNP1 (i.e. the plant comprises one chromosome 4 having an Adenine, A, at nucleotide 76 of SEQ ID NO: 1 or at nucleotide 76 of a sequence comprising at least 95%, 96%, 97%, 98% or more sequence identity to SEQ ID NO:1 and a second chromosome 4 having a Guanine, G, at nucleotide 76 of SEQ ID NO: 1 or at nucleotide 76 of a sequence comprising at least 95%, 96%, 97%, 98% or more sequence identity to SEQ ID NO:1), while a plant homozygous for wop1 (i.e. wop1/wop1) will have the genotype AA for SNP1 (i.e. the plant comprises two chromosomes 4 which both have an Adenine, A, at nucleotide 76 of SEQ ID NO: 1 or at nucleotide 76 of a sequence comprising at least 95%, 96%, 97%, 98% or more sequence identity to SEQ ID NO:1). Or the diploid plant heterozygous for wop1 (i.e. wop1/WOP1) will be heterozygous for the SNP16a, i.e. will have the genotype AG for SNP16a (i.e. the plant comprises one chromosome 4 having an Adenine, A, at nucleotide 428 of SEQ ID NO: 30 or at nucleotide 428 of a sequence comprising at least 95%, 96%, 97%, 98% or more sequence identity to SEQ ID NO:30 and a second chromosome 4 having a Guanine, G, at nucleotide 428 of SEQ ID NO: 30 or at nucleotide 428 of a sequence comprising at least 95%, 96%, 97%, 98% or more sequence identity to SEQ ID NO:30), while a plant homozygous for wop1 (i.e. wop1/wop1) will have the genotype AA for SNP16a (i.e. the plant comprises two chromosomes 4 which both have an Adenine, A, at nucleotide 428 of SEQ ID NO:30 or at nucleotide 428 of a sequence comprising at least 95%, 96%, 97%, 98% or more sequence identity to SEQ ID NO:30). The same holds true for the other markers disclosed in Table 1. Likewise the SNP genotype of triploids homozygous for wop1 will be AAA for SNP1 and/or for SNP16a, and distinguishable from the other genotypes AAG, AGG and GGG. The same holds true for tetraploids or other polyploids. So the SNP genotype of a tetraploid homozygous for wop1 will be AAAA and distinguishable from the other genotypes AAAG, AAGG, AGGG and GGGG. In one aspect SNP16a is linked to the mutant wop1 allele and plants can be selected comprising an Adenine for SNP16a.
Plants and Plant Parts According to the Invention
[0151] In one embodiment a cultivated watermelon plant is provided, or a part thereof (such as a cell, a tissue, organ, fruit, etc.), comprising at least one copy of a mutant allele of a gene name WOP1, said mutant allele conferring facultative parthenocarpy when the mutant allele is in homozygous form. As mentioned above the WOP1 gene is located on chromosome 4 of the cultivated watermelon genome. The whole genome of watermelon has been sequenced, see Guo et al. 2013, Nature Genetics, page 51-60 and the sequence database is available for all chromosomes. In Table 1 above the SNP markers SNP1 (and SNP1a) to SNP24 are shown, including their physical position on chromosome 4. Thus, in one aspect the gene is located in a region starting at base pair 11.906.147 (SNP1) and ending at base pair 21.897.585 (SNP24) of chromosome 4. In another aspect the gene is located in a region starting at base pair 8.385.759 (SNP1a) and ending at base pair 21.897.585 (SNP24) of chromosome 4. In a further aspect the gene is located in a region starting at base pair 16.540.678 (SNP16) and ending at base pair 16.908.561 (SNP17).
[0152] In other words, a cultivated watermelon plant is provided, or a part thereof, comprising at least one copy of a mutant allele of a gene name WOP1, said mutant allele conferring facultative parthenocarpy when the mutant allele is in homozygous form, wherein said gene is located in a region starting at (nucleotide 76 of) SEQ ID NO: 1 (SNP1), or at (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 1 (SNP1), and ending at (nucleotide 76 of) SEQ ID NO: 24 (SNP24) or at (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 24 (SNP24). In another aspect the gene is located in a region starting at (nucleotide 76 of) SEQ ID NO: 29 (SNP1a), or at (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 29 (SNP1a), and ending at (nucleotide 76 of) SEQ ID NO: 24 (SNP24) or at (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 24 (SNP24). In further aspect the gene is located in a region starting at (nucleotide 76 of) SEQ ID NO: 16 (SNP16), or at (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 16 (SNP16), and ending at (nucleotide 76 of) SEQ ID NO: 17 (SNP17) or at (nucleotide 76 of) a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 17 (SNP17).
[0153] In one aspect the mutant allele is a mutant allele of the gene which encodes the WOP1 protein of SEQ ID NO: 32 or a protein comprising at least 95%, 96%, 97% or 98% sequence identity to SEQ ID NO: 32 (wild type functional protein), whereby the mutant allele has a reduced expression or no expression, or whereby the mutant allele encodes a mutant WOP1 protein comprising one or more amino acids replaced, inserted or deleted compared to the wild type protein. In one embodiment the one or more amino acid replacements, insertions or deletions comprise or consist of the replacement, insertion or deletion of one or more amino acids in one or both of the conserved domains. The mutant protein has a reduced-function or loss-of-function compared to the wild type protein (and thus compared to a wild type plant comprising the wild type WOP1 gene), preferably the plant cell or plant comprising the mutant allele in homozygous form is facultative parthenocarpic.
[0154] When referring herein to a SNP nucleotide or SNP genotype at a specific nucleotide position, e.g. at nucleotide 76 of SEQ ID NO: 1, or at nucleotide 76 of a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to the SEQ ID NO, this means that the SNP nucleotide or SNP genotype is present in a variant sequence at a nucleotide corresponding to the same nucleotide (e.g. corresponding to nucleotide 76 of SEQ ID NO: 1) in the variant sequence, i.e. in a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to the mentioned SEQ ID NO. It may for example be that the variant sequence is one or a few nucleotides shorter, but when one pairwise aligns the variant sequence with the mentioned SEQ ID NO, one can see which nucleotide of the variant sequence corresponds to the same nucleotide. In the variant sequence this may for example be nucleotide number 75 or 77 of that variant sequence which corresponds to nucleotide 76 of the mentioned sequence.
[0155] In one aspect a cultivated watermelon plant is provided, or a part thereof, comprising at least one copy of a mutant allele of a gene name WOP1, said mutant allele conferring facultative parthenocarpy when the mutant allele is in homozygous form, wherein said gene is located between SEQ ID NO: 1 (comprising SNP1), or a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 1, and SEQ ID NO: 24 (comprising SNP24) or a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 24. In another aspect said gene is located between SEQ ID NO: 29 (comprising SNP1a), or a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 29, and SEQ ID NO: 24 (comprising SNP24) or a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 24.
[0156] In a different aspect, the gene is located in a region starting at base pair 14.402.485 (SNP3) and ending at base pair 18.942.612 (SNP23) of chromosome 4.
[0157] In other words, a cultivated watermelon plant is provided, or a part thereof, comprising at least one copy of a mutant allele of a gene name WOP1, said mutant allele conferring facultative parthenocarpy when the mutant allele is in homozygous form, wherein said gene is located in a region starting at nucleotide 76 of SEQ ID NO: 3 (SNP3), or at nucleotide 76 of a sequence comprising at least 95%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 3 (SNP3), and ending at nucleotide 81 of SEQ ID NO: 23 (SNP23) or at nucleotide 81 of a sequence comprising at least 95%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 23 (SNP23).
[0158] In a further aspect a cultivated watermelon plant is provided, or a part thereof, comprising at least one copy of a mutant allele of a gene name WOP1, said mutant allele conferring facultative parthenocarpy when the mutant allele is in homozygous form, wherein said gene is located between SEQ ID NO: 3 (comprising SNP3), or a sequence comprising at least 95% 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 3, and SEQ ID NO: 23 (comprising SNP23) or a sequence comprising at least 95%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 23.
[0159] In a further aspect a cultivated watermelon plant is provided, or a part thereof, comprising at least one copy of a mutant allele of a gene name WOP1, said mutant allele conferring facultative parthenocarpy when the mutant allele is in homozygous form, wherein said gene is located between SEQ ID NO: 16 (comprising SNP16), or a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 16, and SEQ ID NO: 17 (comprising SNP17) or a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 17. In another aspect the WOP1 gene is the gene encoding a protein of SEQ ID NO: 32 or a protein comprising at least 95%, 96%, 97% or 98% sequence identity to SEQ ID NO: 32.
[0160] The mutant allele is a mutation in an endogenous gene of cultivated watermelon. The existence of a gene conferring facultative parthenocarpy and the location of the gene to the defined region on chromosome 4 enables the skilled person to generate other de novo mutants in the gene, i.e. in other cultivated watermelon lines or varieties. Other lines and varieties have some variation in their genome, which is why the SNP genotype may be different in different genetic backgrounds and which is why SEQ ID NO: 1 to SEQ ID NO: 24 (and SEQ ID NO: 29) may not be 100% identical in other genetic backgrounds to the sequences provided herein, but may comprise at least 95%, 96%, 97%, 98% or 99% sequence identity to the sequences provided as SEQ ID NO:1 to SEQ ID NO: 24 (and SEQ ID NO: 29). Nonetheless, the skilled person can, without undue burden, generate plants according to the invention, e.g. by carrying out a method for identification of mutants in a mutant population, based e.g. on the phenotype, as described elsewhere herein and further analysing the genetic inheritance, mapping the mutation, or sequencing the chromosome 4 region, allelism testing, etc. to verify that the phenotype is caused by a mutation in the WOP1 gene located on chromosome 4 between SNP1 (or SNP1a) and SNP24, preferably between SNP3 and SNP23, more preferably between SNP16 and SNP17.
[0161] As mentioned above, as the WOP1 gene has been identified to be the gene encoding a protein of SEQ ID NO: 32 (wild type protein) in normal, non-parthenocarpic watermelon plants, other mutants than the one generated by the inventors (encoding the mutant protein of SEQ ID NO: 31) can be generated de novo. As natural variation may exist in the wild type functional WOP1 proteins, the wild type WOP1 protein need not be 100% identical to the protein of SEQ ID NO: 32, but may have less sequence identity, e.g. 95%, 96%, 97% or 98% when aligned pairwise over the entire length. In one aspect the conserved myb-like DNA binding SHAQKYF-class domain is however 100% identical to that of SEQ ID NO: 32, i.e. has the sequence of SEQ ID NO: 35, in such wild type variant proteins, so that WOP1 genes are encompassed comprising mutants in genes encoding WOP1 proteins which proteins comprise at least 95% sequence identity to SEQ ID NO: 32 when aligned over the entire length, and such proteins comprise the conserved myb-like DNA binding SHAQKYF-class domain of SEQ ID NO: 35.
[0162] In a further aspect the plant according to the invention is a cultivated watermelon plant or a part thereof, comprising at least one copy of a mutant allele of a gene name WOP1, said mutant allele conferring facultative parthenocarpy when the mutant allele is in homozygous form, wherein said gene is linked a nucleotide sequence selected from the group consisting of SEQ ID NO: 1 or a sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 1; SEQ ID NO: 2 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 2; SEQ ID NO: 3 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 3; SEQ ID NO: 4 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 4; SEQ ID NO: 5 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 5; SEQ ID NO: 6 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 6; SEQ ID NO: 7 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 7; SEQ ID NO: 8 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 8; SEQ ID NO: 9 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 9; SEQ ID NO: 10 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 10; SEQ ID NO: 11 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 11; SEQ ID NO: 12 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 12; SEQ ID NO: 13 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 13; SEQ ID NO: 14 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 14; SEQ ID NO: 15 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 15; SEQ ID NO: 16 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 16; SEQ ID NO: 30 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 30; SEQ ID NO: 17 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 17; SEQ ID NO: 18 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 18; SEQ ID NO: 19 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 19; SEQ ID NO: 20 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 20; SEQ ID NO: 21 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 21; SEQ ID NO: 22 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 22; SEQ ID NO: 23 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 23; SEQ ID NO: 24 or a nucleotide sequence comprising at least 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 24. In one aspect the mutant wop1 allele is linked to any one of the above sequences, or to the SNP present in those sequences, at a physical distance of 2.5 Mb or less, such as 2.0 Mb or less, 1.5 Mb or less, 1.0 Mb or less, 0.8 Mb or less, 0.5 Mb or less, 0.4 Mb or less, 0.3 Mb or less, 0.2 Mb or less, 0.1 Mb or less, 74 kb, 50 kb, 20 kb, 10 kb, 5 kb, 2 kb, 1 kb or less. In another aspect the mutant wop1 allele is linked to any one of the above sequences, or to the SNP present in those sequences, at a physical distance of 0.5 Mb or less, 0.4 Mb or less, 0.3 Mb or less, 0.2 Mb or less, 0.1 Mb or less, 74 kb, 50 kb, 20 kb, 10 kb, 5 kb, 2 kb, 1 kb or less. The mutant allele is located in the region of chromosome 4 starting at SNP1 (or at SNP1a) and ending at SNP24, preferably starting at SNP3 and ending at SNP23, as described elsewhere. The linkage can be determined using mapping e.g. fine mapping. Linkage can also be expressed in centiMorgans (cM), so in one aspect the wop1 allele is linked to any one of the above markers within a genetic distance of 5 cM or less, e.g. 4 cM, 3 cM, 2 cM, 1 cM or less.
[0163] In yet a further aspect the plant according to the invention is a cultivated watermelon plant or a part thereof, comprising at least one copy of a mutant allele of a gene name WOP1, said mutant allele conferring facultative parthenocarpy when the mutant allele is in homozygous form, wherein said gene is located between a pair of SNP markers, or between a pair of sequences comprising the markers, selected from the group consisting of SNP1a (or SEQ ID NO: 29) and SNP3 (or SEQ ID NO: 3); SNP1 (or SEQ ID NO: 1) and SNP3 (or SEQ ID NO:3); SNP2 (or SEQ ID NO: 2) and SNP4 (or SEQ ID NO: 4); SNP3 (or SEQ ID NO: 3) and SNP5 (or SEQ ID NO: 5); SNP4 (or SEQ ID NO: 4) and SNP6 (or SEQ ID NO: 6); SNP5 (or SEQ ID NO: 5) and SNP7 (or SEQ ID NO: 7); SNP6 (or SEQ ID NO: 6) and SNP8 (or SEQ ID NO: 8); SNP7 (or SEQ ID NO: 7) and SNP9 (or SEQ ID NO: 9); SNP8 (or SEQ ID NO: 8) and SNP10 (or SEQ ID NO: 10); SNP9 (or SEQ ID NO: 9) and SNP11 (or SEQ ID NO: 11); SNP10 (or SEQ ID NO: 10) and SNP12 (or SEQ ID NO: 12); SNP11 (or SEQ ID NO: 11) and SNP13 (or SEQ ID NO: 13); SNP12 (or SEQ ID NO: 12) and SNP14 (or SEQ ID NO: 14); SNP13 (or SEQ ID NO: 13) and SNP15 (or SEQ ID NO: 15); SNP14 (or SEQ ID NO: 14) and SNP16 (or SEQ ID NO: 16); SNP15 (or SEQ ID NO: 15) and SNP17 (or SEQ ID NO: 17); SNP16 (or SEQ ID NO: 16) and SNP18 (or SEQ ID NO: 18); SNP17 (or SEQ ID NO: 17) and SNP19 (or SEQ ID NO: 19); SNP18 (or SEQ ID NO: 18) and SNP20 (or SEQ ID NO: 20); SNP19 (or SEQ ID NO: 19) and SNP21 (or SEQ ID NO: 21); SNP20 (or SEQ ID NO: 20) and SNP22 (or SEQ ID NO: 22); SNP21 (or SEQ ID NO: 21) and SNP23 (or SEQ ID NO: 23); SNP22 (or SEQ ID NO: 22) and SNP24 (or SEQ ID NO: 24). As mentioned previously, when referring to SNP markers, this includes the SNP markers in variant genomic sequences, such as a sequence comprising at least 95% sequence identity to the SEQ ID NO comprising the SNP and, likewise, when referring to sequences this also includes variant genomic sequences, such as a sequence comprising at least 95% sequence identity to the SEQ ID NO.
[0164] In yet a further aspect the plant according to the invention is a cultivated watermelon plant or a part thereof, comprising at least one copy of a mutant allele of a gene name WOP1, said mutant allele conferring facultative parthenocarpy when the mutant allele is in homozygous form, wherein said gene is located between a pair of SNP markers, or between a pair of sequences comprising the markers, selected from the group consisting of SNP16 (or SEQ ID NO: 16) and SNP17 (or SEQ ID NO: 17).
[0165] In one aspect the mutant wop1 allele is the allele as present in, and as obtainable from, plants grown from seeds deposited under accession number NCIMB42533, or progeny thereof, e.g. F1, F2, F3 or further selfing progeny or BC1, BC2, BC3, etc., or DH progeny, or tetraploid or triploids (or other polyploids) made using the allele present in NCIMB42533. In plants and plant parts grown from seeds deposited under NCIMB42533, or progeny thereof, the wop1 allele is in one aspect detectable by SNP genotyping using one or more or all of SNP1 (or SNP1a) to SNP24, preferably one or more or all of SNP3 to SNP23, or a subset of these SNPs linked to wop1. In one aspect the subset of SNP markers linked to the mutant wop1 allele is one, or more or all of SNP1a, SNP1, SNP2, SNP12, SNP16, SNP16a, SNP19, SNP22 and SNP23. In one aspect especially SNP16a is linked to the mutant gene, as it is in fact present in the protein coding sequence of the mutant wop1 allele. As mentioned further above, the SNP nucleotide of SNP1 (or SNP1a) to SNP24 linked to the mutant wop1 allele as found in seeds deposited under NCIMB42533 is given in Table 1, in column 3, and the SNP nucleotide of SNP1 (or SNP1a) to SNP24 linked to the wild type WOP1 allele as found in seeds deposited under NCIMB42533 is given in Table 1, column 4. When genotyping plants or plant parts derived from NCIMB42533, the SNP genotype for one or more or all of SNP1 (or SNP 1a) to SNP24, or for one or more or all of SNP3 to SNP23, or for one or more or all of a subset thereof, e.g. one or more or all of SNP1a, SNP1, SNP2, SNP12, SNP16, SNP16a, SNP19, SNP22 and SNP23, the genotype detected confirms whether the mutant wop1 allele and/or the wild type WOP1 allele is present, and how many copies are present of each. Especially genotyping for SNP16a is sufficient, as this SNP is in the coding sequence of the allele.
[0166] Thus, in one aspect the plant or plant part according to the invention comprises at least one (but optionally 2 in a homozygous diploid, 3 in a triploid or 4 in a tetraploid or even more in other polyploids) A nucleotide for SNP1a, and/or at least one A nucleotide for SNP1, and/or at least one T nucleotide for SNP2, and/or at least one C nucleotide for SNP3, and/or at least one C nucleotide for SNP4, and/or at least one A nucleotide for SNP5, and/or at least one C nucleotide for SNP6, and/or at least one T nucleotide for SNP7, and/or at least one G nucleotide for SNP8, and/or at least one C nucleotide for SNP9, and/or at least one A nucleotide for SNP10, and/or at least one G nucleotide for SNP11, and/or at least one A nucleotide for SNP12, and/or at least one G nucleotide for SNP13, and/or at least one A nucleotide for SNP14, and/or at least one G nucleotide for SNP15, and/or at least one A nucleotide for SNP16, and/or at least one A nucleotide for SNP16a, and/or at least one G nucleotide for SNP17, and/or at least one C nucleotide for SNP18, and/or at least one G nucleotide for SNP19, and/or at least one T nucleotide for SNP20, and/or at least one G nucleotide for SNP21, and/or at least one G nucleotide for SNP22, and/or at least one G nucleotide for SNP23, and/or at least one C nucleotide for SNP24. In one specific aspect the plant or plant part according to the invention comprises at least one (but optionally 2 in a homozygous diploid, 3 in a triploid or 4 in a tetraploid or even more in other polyploids) A nucleotide for SNP16a.
[0167] In a further aspect the plant or plant part according to the invention comprises at least one (but optionally 2 in a homozygous diploid, 3 in a triploid or 4 in a tetraploid or even more in other polyploids) C nucleotide for SNP3, and/or at least one C nucleotide for SNP4, and/or at least one A nucleotide for SNP5, and/or at least one C nucleotide for SNP6, and/or at least one T nucleotide for SNP7, and/or at least one G nucleotide for SNP8, and/or at least one C nucleotide for SNP9, and/or at least one A nucleotide for SNP10, and/or at least one G nucleotide for SNP11, and/or at least one A nucleotide for SNP12, and/or at least one G nucleotide for SNP13, and/or at least one A nucleotide for SNP14, and/or at least one G nucleotide for SNP15, and/or at least one A nucleotide for SNP16, and/or at least one A nucleotide for SNP16a, and/or at least one G nucleotide for SNP17, and/or at least one C nucleotide for SNP18, and/or at least one G nucleotide for SNP19, and/or at least one T nucleotide for SNP20, and/or at least one G nucleotide for SNP21, and/or at least one G nucleotide for SNP22, and/or at least one G nucleotide for SNP23.
[0168] In yet a further aspect the plant or plant part according to the invention comprises at least one (but optionally 2 in a homozygous diploid, 3 in a triploid or 4 in a tetraploid or even more in other polyploids) A nucleotide for SNP1a, and/or at least one A nucleotide for SNP1, and/or at least one T nucleotide for SNP2, and/or at least one A nucleotide for SNP12, and/or at least one A nucleotide for SNP16, and/or at least one A nucleotide for SNP16a, and/or at least one G nucleotide for SNP19, and/or at least one G nucleotide for SNP22, and/or at least one G nucleotide for SNP23.
[0169] In yet a further aspect the plant or plant part according to the invention comprises at least one (but optionally 2 in a homozygous diploid, 3 in a triploid or 4 in a tetraploid or even more in other polyploids) A nucleotide for SNP16a, which is the mutation in the coding sequence of the mutant wop1 allele present in the deposited seeds.
[0170] The SNP markers described herein may be detected according to standard method. For example SNP markers can easily be detected using a KASP-assay (see world wide web at kpbioscience.co.uk) or other SNP genotyping assays. For developing a KASP-assay, for example 70 base pairs upstream and 70 base pairs downstream of the SNP can be selected and two allele-specific forward primers and one allele specific reverse primer can be designed. See e.g. Allen et al. 2011, Plant Biotechnology J. 9, 1086-1099, especially p097-1098 for KASP-assay method.
[0171] Thus, in one aspect, the SNP markers and the presence/absence of the SNP nucleotide associated with the wop1 allele is determined using a KASP assay, but equally other genotyping assays can be used. For example, a TaqMan SNP genotyping assay, a High Resolution Melting (HRM) assay, SNP-genotyping arrays (e.g. Fluidigm, Illumina, etc.) or DNA sequencing may equally be used.
[0172] Genotyping of diploid plants or plant parts (cells, leaves, DNA, etc.) can distinguish SNP genotypes, e.g. plants or parts comprising AA for SNP1 can be distinguished from plants or parts comprising AG for SNP1 in their genome. Genotyping of tetraploid plants or plant parts (cells, leaves, DNA, etc.) can be done in the same way as for diploids, using for example a KASP-assay to distinguish SNP genotypes, e.g. plants or parts comprising AAAA for SNP1 can be distinguished from plants or parts comprising other genotypes for SNP1, e.g. AGGG, AAGG, etc. in their genome. The same applies for triploids. Thus, genotyping of triploid plants or plant parts (cells, leaves, DNA, etc.) can be done in the same way, using for example a KASP-assay to distinguish SNP genotypes, e.g. plants or parts comprising AAA for SNP1 can be distinguished from plants or parts comprising AAG, AGG, GGG for SNP1 in their genome. The same also applies for other polyploids.
[0173] The skilled person can also derive the mutant wop1 gene from seeds deposited under NCIMB42533 without deriving any of the SNP nucleotides/genotypes indicated in Table 1, column 3 from the deposited seeds. This can for example be done by finding other markers close to the wop1 allele and using such markers to select for the presence of the wop1 allele. In that way the mutant allele can be crossed into any different genetic background without transferring all the SNP markers of the deposited seeds, i.e. without transferring the chromosome 4 region around the wop1 allele, e.g. only SNP16a may be transferred to progeny. Similarly, phenotypic selection can be used to cross the mutant wop1 allele into any different genetic background than the genetic background of NCIMB42533.
[0174] Thus in one aspect a cultivated watermelon plant or plant part is provided comprising at least one copy of the wop1 allele in its genome, said allele conferring facultative parthenocarpy when it is in homozygous form, wherein said allele is obtainable (derivable; the allele is the allele as present in) seeds deposited under accession number NCIMB42533, e.g. by crossing plants grown from the seeds comprising the wop1 allele (preferably in homozygous form) with another watermelon plant, such as a breeding line or variety, e.g. comprising only the wild type WOP1 allele. The F1 will then comprise wop1 in heterozygous form and can be e.g. selfed and/or backcrossed to the breeding line or variety, to introduce the wop1 allele on chromosome 4 of that breeding line or variety. Alternatively, the same mutant allele as present in the deposited seed can be generated and/or selected for by the skilled person, e.g. in a different watermelon background, optionally even in a variant of the WOP1 gene. Thus the mutant allele may comprise a replacement of the serine of amino acid 143 in a protein which comprises at least 95%, 96%, 97% or 98% sequence identity to SEQ ID NO: 32. Optionally this protein comprises the conserved domain of SEQ ID NO: 35.
[0175] As mentioned, also other mutants in the WOP1 gene can be generated, which also confer facultative parthenocarpy when in homozygous form.
[0176] Thus in one aspect the invention encompasses a plant or plant part comprising at least one copy of a mutant allele of a gene name WOP1, wherein said gene is the gene encoding a protein of SEQ ID NO: 32, or a protein comprising at least 95%, 96%, 97% or 98% sequence identity to SEQ ID NO: 32, said mutant allele conferring facultative parthenocarpy when the mutant allele is in homozygous form. In one aspect the invention encompasses a plant or plant part comprising at least one copy of a mutant allele of a gene name WOP1 encoding a protein of SEQ ID NO: 32, or a protein comprising at least 95%, 96%, 97% or 98% sequence identity to SEQ ID NO: 32 and whereby said protein comprises the conserved domain of SEQ ID NO: 35, said mutant allele conferring facultative parthenocarpy when the mutant allele is in homozygous form.
[0177] A mutant allele of a WOP1 protein-encoding gene causes a plant to produce seedless fruits in the absence of pollination and seeded fruits in the presence of pollination, when the plant is homozygous for the mutant allele. Concerning the embodiments of the invention, the mutation in the mutant allele of a WOP1 protein-encoding gene can be any mutation, including deletions, truncations, insertions, point mutations, nonsense mutations, missense or non-synonymous mutations, splice-site mutations, frame shift mutations and/or mutations in regulatory sequences. In one aspect the mutation in the mutant allele of a WOP1 protein-encoding gene is a point mutation. The mutation can occur in a DNA sequence comprising the coding sequence of a WOP1 protein-encoding gene or in a RNA sequence encoding a WOP1 protein or it can occur in the amino acid of a WOP1 protein. Concerning a DNA sequence of a WOP1 protein-encoding gene the mutation can occur in the coding sequence or it can occur in non-coding sequences like 5- and 3-untranslated regions, promoters, enhancers etc. of a WOP1 protein-encoding gene. In respect to RNA encoding a WOP1 protein the mutation can occur in the pre-mRNA or the mRNA. In one aspect the mutant allele results in the protein having a loss-of-function or decrease of function due to one or more amino acids being replaced, inserted and/or deleted, for example resulting in one or more amino acids being replaced, inserted or deleted in the conserved myb-like DNA binding SHAQKYF-class domain or in the SHAQKYF domain. For example, truncation of the protein to cause deletion of either or both of these domains, or a part of either of these domains, will result in a loss of function or decrease of function of the protein. Thus, stop codon mutations e.g. in the N-terminal part (amino acid 1 to 96 of SEQ ID NO: 32 or a sequence comprising at least 95% sequence identity to SEQ ID NO: 32) or in one of the conserved domains result in truncated proteins having a reduced function or loss of function. Likewise amino acid insertions, deletions or replacements in the N-terminal part or one of the conserved domains can result in a protein having a reduced function or loss of function. Examples of amino acid replacements in the N-terminal part of the protein are E4 (amino acid 4 of SEQ ID NO: 32, Glutamic acid, e.g. to Leucine), S6 (amino acid 6 of SEQ ID NO: 32, Serine, e.g. to Leucine), E14 (amino acid 14 of SEQ ID NO: 32, Glutamic acid, e.g. to Leucine), P32 ((amino acid 32 of SEQ ID NO: 32, Proline, e.g. to Leucine), A35 (amino acid 35 of SEQ ID NO: 32, Alanine, e.g. to Valine), S54 (amino acid 54 of SEQ ID NO: 32, Serine, e.g. to phenylalanine), P56 (amino acid 56 of SEQ ID NO: 32, Proline, e.g. to Leucine), L57 (amino acid 57 of SEQ ID NO: 32, Leucine, e.g. to Histidine). Examples of amino acid replacements in the conserved domain are P104 (amino acid 104 of SEQ ID NO: 32, Proline, e.g. to Leucine) and 5143 (amino acid 143 of SEQ ID NO: 32, Serine, e.g. to. Asparagine).
[0178] A further embodiment of the invention therefore concerns plant cells or plants according to the invention comprising a mutant allele of a WOP1 protein-encoding gene characterized in that the mutant allele comprises or effects one or more of the mutations selected from the group consisting of
a) a deletion, truncation, insertion, point mutation, nonsense mutation, missense or non-synonymous mutation, splice-site mutation, frame shift mutation in the genomic sequence;
b) a mutation in one or more regulatory sequences;
c) a deletion, truncation, insertion, point mutation, nonsense mutation, missense or non-synonymous mutation, splice-site mutation, frame shift mutation in the coding sequence;
d) a deletion, truncation, insertion, point mutation, nonsense mutation, missense or non-synonymous mutation, splice-site mutation, frame shift mutation in the pre-mRNA or mRNA; and/or
e) a deletion, truncation, insertion or replacement of one or more amino acids in the WOP1 protein.
[0179] In one aspect the mutant allele results in reduced expression or no expression of the WOP1 gene or the mutant allele encodes a protein having a decreased function or a loss-of-function.
[0180] Reduced expression or no expression means that there is a mutation in a regulatory region of the WOP1 gene, such as the promoter, whereby reduced mRNA transcript or no mRNA transcript of the WOP1 allele is being made, compared to plants and plant parts comprising a wild type WOP1 allele. The decrease in the expression can, for example, be determined by measuring the quantity of mRNA transcripts encoding WOP1 protein, e.g. using Northern blot analysis or RT-PCR. Here, a reduction preferably means a reduction in the amount of RNA transcripts by at least 50%, in particular by at least 70%, optionally by at least 85% or by at least 95%, or even by 100% (no expression) compared to the plant or plant part comprising a wild type WOP1 gene. Expression can be analysed e.g. in young leaf tissue or ovary tissue, see e.g. Examples.
[0181] In one aspect the protein comprising one or more amino acids replaced, inserted or deleted compared to the wild type protein. Thus, for watermelon, one or more amino acids are inserted, deleted or replaced compared to the wild type WOP1 protein of SEQ ID NO: 32 or a wild type WOP1 protein comprising at least 95%%, 96%, 97% or 98% sequence identity to SEQ ID NO: 32; for cucumber, one or more amino acids are inserted, deleted or replaced compared to the wild type WOP1 protein of SEQ ID NO: 33 or a wild type WOP1 protein comprising at least 95%%, 96%, 97% or 98% sequence identity to SEQ ID NO: 33; for melon, one or more amino acids are inserted, deleted or replaced compared to the wild type WOP1 protein of SEQ ID NO: 34 or a wild type WOP1 protein comprising at least 95%%, 96%, 97% or 98% sequence identity to SEQ ID NO: 34; whereby the mutant protein has reduced function or loss of function compared to the wild type protein and thus results in facultative parthenocarpy when the mutant allele is present in homozygous form in a diploid plant.
[0182] In one aspect the WOP1 protein comprises the conserved myb-like DNA binding domain SHAQKYF-class of SEQ ID NO: 35. Thus in one aspect the mutant allele is a mutant allele of the gene WOP1, which gene encodes a protein of SEQ ID NO: 32 (watermelon) or of SEQ ID NO: 33 (cucumber) or of SEQ ID NO: 34 (melon), or a protein comprising at least 95%, 96%, 97% or 98% sequence identity to SEQ ID NO: 32, SEQ ID NO: 33 or SEQ ID NO: 34, and whereby the protein comprises the conserved domain of SEQ ID NO: 35.
[0183] The myb-like DNA binding domain SHAQKYF-class of SEQ ID NO: 35 is found in the watermelon WOP1 protein of SEQ ID NO: 32 at amino acid 97 to 150, and comprises the SHAQKYF domain at amino acid 143 to 150. Thus in one aspect the wild type WOP1 gene encodes a wild type protein comprising a myb-like DNA binding domain SHAQKYF-class which is 100% identical to amino acids 97 to 150 of SEQ ID NO: 32. The myb-like DNA binding domain SHAQKYF-class of SEQ ID NO: 35 is found in the cucumber WOP1 protein of SEQ ID NO: 33 at amino acid 97 to 150, and comprises the SHAQKYF domain at amino acid 143 to 150. Thus in one aspect the wild type WOP1 gene encodes a wild type protein comprising a myb-like DNA binding domain SHAQKYF-class which is 100% identical to amino acids 97 to 150 of SEQ ID NO: 33. The myb-like DNA binding domain SHAQKYF-class of SEQ ID NO: 35 is found in the melon WOP1 protein of SEQ ID NO: 34 at amino acid 97 to 150, and comprises the SHAQKYF domain at amino acid 143 to 150. Thus in one aspect the wild type WOP1 gene encodes a wild type protein comprising a myb-like DNA binding domain SHAQKYF-class which is 100% identical to amino acids 97 to 150 of SEQ ID NO: 34.
[0184] In one aspect the mutant allele comprises a mutation whereby one or more amino acids in said myb-like DNA binding domain SHAQKYF-class of SEQ ID NO: 35 (i.e. of amino acids 97 to 150 of SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 34) are replaced, inserted or deleted.
[0185] In a preferred aspect one or more amino acids of the SHAQKYF domain, i.e. amino acids 47 to 54 of SEQ ID NO: 35 (i.e. of amino acids 143 to 150 of SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 34), are replaced, inserted or deleted.
[0186] When amino acids from one amino acid to another amino acid are mentioned herein this includes the start/first and end/last amino acid mentioned.
[0187] In a specific aspect at least one amino acid of amino acids of SEQ ID NO: 35 is replaced by another amino acid, preferably amino acid 47 is not a Serine and/or amino acid 8 is not a Proline. In one aspect the Serine at amino acid 47 is replaced by an Asparagine and/or the Proline of amino acid 8 is replaced by a Leucine.
[0188] In a specific aspect at least one amino acid of amino acids 47 to 54 of SEQ ID NO: 35 is replaced by another amino acid, preferably amino acid 47 is not a Serine. In one aspect the Serine is replaced by an Asparagine.
[0189] In one aspect the invention encompasses a plant or plant part comprising at least one copy of a mutant allele of a gene name WOP1 encoding a protein of SEQ ID NO: 32 (in watermelon), SEQ ID NO: 33 (in cucumber) or SEQ ID NO: 34 (in melon), or a protein comprising at least 95%, 96%, 97% or 98% sequence identity to SEQ ID NO: 32, SEQ ID NO: 33 or SEQ ID NO: 34, respectively, said mutant allele conferring facultative parthenocarpy when the mutant allele is in homozygous form, whereby the protein comprises at least one amino acid substitution in the myb-like DNA binding domain SHAQKYF-class of SEQ ID NO: 35, for example the Serine at amino acid 143 of SEQ ID NO: 32, or at amino acid 143 of SEQ ID NO: 33 or of SEQ ID NO: 34, is replaced by a different amino acid, e.g. an Asparagine, and/or the Proline at amino acid 104 is replaced by a different amino acid, e.g. a Leucine.
[0190] The plants and plant parts comprising at least one copy of a mutant wop1 allele may be plants of the family Cucurbitaceae, especially cultivated species such as cucumber (Cucumis sativus), melon (Cucumis melo) and watermelon (Citrullus lanatus). Also plants and plant parts of the family Cucurbitaceae, especially cucumber, melon and watermelon, comprising two copies of a mutant wop1 allele are encompassed herein, whereby diploid plants comprising two copies of the mutant wop1 allele results in plants exhibiting the phenotype of facultative parthenocarpy.
[0191] In one aspect the mutant wop1 allele is heterozygous in a diploid plant cell or plant, e.g. in a diploid watermelon, cucumber or melon plant. In another aspect the mutant wop1 allele is homozygous in a diploid plant cell or plant.
[0192] The plant cells and plants are preferably cultivated plants, such as elite breeding lines or varieties, and not wild plants. Cucumber may be any type of cucumber, such as long cucumber, pickling cucumber, slicing cucumber, etc. Likewise melon may be any type of melon (Galia, Piel de Sapo, Cantaloupe, honeydew, etc.) and watermelon may be any type of watermelon.
[0193] Watermelon plants, and parts thereof, which comprises at least one copy of the mutant wop1 allele, may be diploid, tetraploid or triploid. In another aspect it may be another polyploid, e.g. a pentaploid, hexaploid, heptaploid, octaploid, etc. A tetraploid plant comprising four copies of wop1 can for example be used to make an octaploid, by doubling the chromosomes. Crossing such an octoploid with a diploid homozygous for wop1 will result in a pentaploid comprising five copies of wop1. In one aspect the polyploidy watermelon plant comprises at least one copy of the mutant wop1 allele, but it may also comprise more copies, e.g. in a preferred aspect it is homozygous for wop1 and lacks the wild type WOP1 allele. Thus all chromosomes 4 comprise the mutant wop1 allele.
[0194] A diploid plant may thus have the genotype wop1/WOP1 (heterozygous for the mutant allele) or wop1/wop1 (homozygous for the mutant allele). In one aspect the diploid plant comprising the wop1 allele in homozygous form is a double haploid plant (DH), e.g. a double haploid watermelon, cucumber or melon plant or plant cell or plant part.
[0195] A triploid watermelon plant may have the genotype wop1/WOP1/WOP1 or wop1/wop1/WOP1 or wop1/wop1/wop1. The triploid plant with genotype wop1/WOP1/WOP1 can be made by crossing a wild type female tetraploid (WOP1/WOP1/WOP1/WOP1) with a diploid male homozygous for the mutant allele (wop1/wop1). The triploid plant with genotype wop1/wop1/WOP1 can be made by crossing a female tetraploid (wop1/wop1/wop1/wop1) with a diploid male homozygous for the wild type allele (WOP1/WOP1).
[0196] A tetraploid watermelon plant may have the genotype wop1/WOP1/WOP1/WOP1 or wop1/wop1/WOP1/WOP1 or wop1/wop1/wop1/WOP1 or wop1/wop1/wop1/wop1. The genotypes wop1/wop1/WOP1/WOP1 can be made by doubling the chromosomes of a diploid wop1/WOP1. The genotypes wop1/wop1/wop1/wop1 can be made by doubling the chromosomes of a diploid wop1/wop1. The other two genotypes, wop1/WOP1/WOP1/WOP1 and wop1/wop1/wop1/WOP1 can for example be made by crossing two tetraploids of genotype wop1/wop1/WOP1/WOP1 and identifying the genotypes in the progeny.
[0197] In one aspect the watermelon plant is homozygous for wop1, in another aspect it is heterozygous for wop1. In one aspect it is an inbred line or a variety. In a further aspect it is an F1 hybrid.
[0198] Seeds from which any of the watermelon plants, cucumber plants or melon plants described can be grown are also encompassed herein, as are parts of such a plant, such as seedless fruits produced in the absence of pollination, flowers, cells, roots, rootstocks, scions, leaves, stems, vegetative propagations, cuttings, seed propagations (e.g. selfings) and also in vitro cell- or tissue cultures, as well as pollen, ovaries, etc. are encompassed herein.
Diploid Watermelon, Cucumber and Melon Plants Comprising a Mutant wop1 Allele
[0199] In one aspect the watermelon plant or cucumber or melon plant is a diploid line (e.g. an inbred line) or variety, comprising at least one mutant copy of wop1, preferably two mutant copies (i.e. is homozygous for wop1). When preventing pollination of the female flowers, the diploid plant homozygous for wop1 will produce fruits which are seedless. When pollination does occur, the fruits will be seeded.
[0200] To prevent pollination one can, for example, grow the plant in an insect free environment. However, one can also produce a diploid plant which are male sterile. Thus, in one aspect of the invention a diploid plant is provided which is homozygous for wop1, and which additionally is male sterile. Male sterility is the failure of plants to produce functional anthers, pollen, or male gametes. Several male sterility genes have been identified in watermelon, including the ms-1 gene. The ms-1 nuclear gene controls male sterility and, in plants with an ms-1 gene in homozygous form (ms-1 is recessive), the normal development of anthers is hindered while female flower development is normal. The gene eliminates pollen production. Markers for the ms-1 gene and plants comprising the gene are described in EP2959771 and the database PINTO mentions that variety Bonta or Bonta F1 of Seminis is a plant according to this patent. The ms-1 gene has also been described in Zhang et al. 1996 (HortScience 31(1): 123-126). The ms-1 gene is on chromosome 6 of watermelon and can therefore easily be combined with wop1 on chromosome 4. In melon also male sterility genes exist. In cucumber the mutant wop1 allele can be combined with gynociousness, i.e. production of female, pistillate flowers.
[0201] Therefore, in one aspect the diploid plant and plant part according to the invention is male sterile and/or comprises a male sterility gene. If the male sterility gene is a recessive gene, the plant and plant part preferably comprises the gene in homozygous form. In one aspect the watermelon plant comprises the ms-1 gene, preferably in homozygous form. Thus, in one aspect the diploid watermelon plant comprises on chromosome 4 the mutant wop1 gene in homozygous form (wop1/wop1) and further comprises a male sterility gene, e.g. ms-1, in homozygous form, e.g. if the male sterility gene is recessive (e.g. ms-1/ms-1) or optionally in heterozygous form if the male sterility is dominant One preferred plant is a diploid plant homozygous for wop1 and homozygous for ms-1.
[0202] A further way of ensuring that plants according to the invention, especially diploid watermelon plants, produce seedless fruits at all times (not only in the absence of pollination) is to combine the wop1 gene in homozygous form with a gene conferring stenospermocarpy, so that if pollination does occur the fruits will be seedless despite pollination. In one aspect the stenospermocarpy gene is the recessive gene called emb1. The wild type and mutant Emb1 gene has been described in co-pending application EP16171462.1. The Emb1 gene encodes a cyclin SDS like protein. When the mutant allele emb1 is in homozygous form, stenospermocarpy results. Stenospermocarpy means that induction of fruit set and development requires pollination but without the fruits producing mature or viable seeds. Mature or viable seeds are not developed in stenospermocarpic plants due to arrested seed development or degradation of ovules and/or embryos and/or endosperm or abortion of the ovules and/or embryos and/or endosperm before maturity is reached. Thus, when diploid plants homozygous for a mutant emb1 allele (emb1/emb1) are self-pollinated or pollinated by pollen from another plant, they produced seedless, diploid fruits.
[0203] Thus, in one aspect the diploid watermelon plant comprises on chromosome 4 the wop1 gene in homozygous form (wop1/wop1) and further comprises a stenospermocarpy gene, e.g. emb1, in homozygous form, e.g. if the stenospermocarpy gene is recessive (e.g. emb1/emb1) or optionally in heterozygous form if the stenospermocarpy gene is dominant. One preferred plant is a diploid plant homozygous for wop1 and homozygous for emb1.
[0204] One mutant allele of emb1 can be obtained from the watermelon seeds being heterozygous or homozygous for the mutant allele of the cyclin SDS like protein encoding gene (also referred to as Emb1 gene), deposited by Nunhems B.V. under NCIMB 42532. Of these seeds 25% contain the mutant allele (see mRNA of SEQ ID NO: 27) encoding a mutant protein of SEQ ID NO: 28. The wild type allele of the Emb1 gene can be obtained from the watermelon seeds being heterozygous or homozygous for the wild type cyclin SDS like protein encoding gene, deposited by Nunhems B.V. under NCIMB 42532. Of these seeds 25% contain the wild type allele of SEQ ID NO: 25 in homozygous form, encoding the wild type protein of SEQ ID NO: 26. Other mutant alleles of the Emb1 gene can be generated de novo, e.g. by mutagenesis or by other methods known to the skilled person. The genomic Emb1 nucleotide sequence shown under SEQ ID NO: 25 encodes a wild type cyclin SDS like protein of Citrullus lanatus having the amino acid sequence as shown under SEQ ID NO: 26. The mRNA sequence shown under SEQ ID NO: 27, and the mutant protein shown under SEQ ID NO: 28, is of the mutant emb1 allele found in seeds deposited under NCIMB42532.
[0205] A mutant allele of emb1 causes a plant to be male fertile but producing seedless fruits, when the plant is homozygous for the mutant allele. The mutation in the Emb1 gene can be any mutation, including deletions, truncations, insertions, point mutations, nonsense mutations, missense or non-synonymous mutations, splice-site mutations, frame shift mutations and/or mutations in regulatory sequences. Preferably the mutation is a point mutation and/or splice-site mutation. The mutation can occur in a DNA sequence comprising the coding sequence of a cyclin SDS like protein encoding gene (Emb1 gene) or in a RNA sequence encoding a cyclin SDS like protein or it can occur in the amino acid of a cyclin SDS like protein (or Emb1 protein). Concerning a DNA sequence of a cyclin SDS like protein encoding gene the mutation can occur in the coding sequence (cds, composed of the exons) or it can occur in non-coding sequences like 5- and 3-untranslated regions, introns, promoters, enhancers etc. of a cyclin SDS like protein encoding gene. In respect to RNA encoding a cyclin SDS like protein the mutation can occur in the pre-mRNA or the mRNA.
[0206] Diploid Citrullus lanatus seeds of plants segregating for a mutant allele of a cyclin SDS like protein encoding gene have been deposited by Nunhems B.V. under the Budapest Treaty under accession No. NCIMB 42532 at NCIMB Ltd., Ferguson Building, Craibstone Estate Bucksburn Aberdeen AB21 9YA, Scotland, UK on 27 Jan. 2016. For the seed deposit the allele of the cyclin SDS like protein encoding gene was designated emb1.
[0207] The deposited seeds were obtained from a self-pollinated back-cross of a plant homozygous for the emb1 mutant allele with plants homozygous for the emb1 wild type allele. Therefore 25% of the deposited seeds are homozygous for the emb1 mutant allele and produce seedless fruits, 50% are heterozygous for the mutant allele and 25% are homozygous for the wild type allele, encoding the wild type cyclin SDS like protein.
[0208] In one aspect the invention, therefore, relates to a diploid watermelon plant or plant part comprising at least one copy of the mutant wop1 allele, preferably two copies, and at least one copy of a mutant emb1 allele, preferably two copies of a mutant emb1 allele. In one aspect the mutant emb1 allele is the allele found in seeds deposited under NCIMB 42532. In one aspect the mutant wop1 allele is the allele found in seeds deposited under NCIMB42533 or a different mutant wop1 allele as described.
[0209] Seeds from which such a diploid plant can be grown are also encompassed herein, as are parts of such a plant, such as diploid seedless fruits, flowers, leaves, stems, vegetative propagations, cells, cuttings, seed propagations (e.g. selfings) and also in vitro cell- or tissue cultures, as well as pollen, ovaries, rootstocks, scions, etc. are encompassed herein. Thus, in one embodiment the diploid plant, or seeds from which the plant can be grown, or tissue or parts of the plant (pollen, anthers, ovules) comprises a mutant wop1 allele as described above, e.g. the mutant allele as found in seeds deposited under NCIMB42533 or a different mutant wop1 allele.
Tetraploid Watermelon Plants Comprising a Mutant wop1 Allele
[0210] Seedless triploid watermelon production involves using pollen from diploid male parent plants to fertilize flowers of tetraploid maternal parent plants. Pollination of the tetraploid flowers with diploid pollen leads to F1 seeds which are triploid (Kihara, 1951, Proceedings of American Society for Horticultural Science 58: 217-230; Eigsti 1971, Hort Science 6: 1-2). The triploid hybrid plants, grown from these F1 seeds, are self-infertile as they produce sterile pollen due to chromosome imbalance. The triploid hybrids, therefore, normally need to be pollinated by a diploid pollenizer to produce watermelon fruit.
[0211] However, according to the present invention a triploid plant comprising three copies of a mutant wop1 gene produce fruits without pollination and there is no need anymore for a pollenizer plant being present.
[0212] In one aspect of the invention therefore both tetraploid plants, comprising four copies of a recessive wop1 allele, for use as a female parent, and diploid plants comprising two copies of a recessive wop1 allele, for use as a male parent, are provided, as well as triploid F1 hybrids (comprising three copies of a mutant wop1 allele) produced by crossing the diploid male parent with the tetraploid female parent.
[0213] To make such a tetraploid plant, any of the diploid plants described above, which are preferably homozygous for wop1, may be used as starting material to generate tetraploid plants. Chromosome doubling techniques known to the skilled person may be used to generate a tetraploid plant from such diploid plants. For example Noh et al. (2012) Hort. Environ. Biotechnol. 53(6):521-529, evaluated different methods of generating tetraploid watermelons. In all methods an antimitotic agent is used, such as colchicine, dinitoalanine, or oryzalin, in order to induce chromosome doubling. Optionally tissue culture may be used to generate tetraploid plants from plant parts. To verify that plants are tetraploid chromosome number can be confirmed. Ploidy can be easily determined by chromosome counting or flow cytometry or other known methods (Sari et al. 1999, Scientia Horticulturae 82: 265-277, incorporated herein by reference).
[0214] Thus, in one aspect of the invention a tetraploid cultivated watermelon plant of the species Citrullus lanatus is provided, wherein said plant comprises four copies of a mutant wop1 allele (as described above), one on each of the four chromosomes 4. The wop1 allele is found in the region as described above, between one or more of the SNP markers as described further above and/or linked to one or more of the sequences SEQ ID NO: 1 (or SEQ ID NO: 29) to SEQ ID NO: 24 as described above.
[0215] All embodiments described for the mutant wop1 allele above apply equally to the tetraploid. So for example the tetraploid plant may comprise four copies of the wop1 allele as found in seeds deposited under NCIMB42533, or four copies of a different mutant wop1 allele as described further above.
[0216] Thus in one aspect the invention encompasses a tetraploid watermelon plant or plant part comprising one, two, three or four copies of a mutant allele of a gene name WOP1 encoding a protein of SEQ ID NO: 32, or a protein comprising at least 95%, 96%, 97% or 98% sequence identity to SEQ ID NO: 32 (said protein optionally comprising the conserved domain of SEQ ID NO: 35). The aspects regarding the mutant wop1 allele described above for diploid watermelon plants comprising one or two copies of a mutant wop1 allele apply to the tetraploid plants and plant parts. So, for example, in one aspect the mutant allele results in reduced expression or no expression of the WOP1 gene or the mutant allele encodes a protein having a decreased function or a loss-of-function.
[0217] In a specific aspect, the tetraploid watermelon plant or plant part comprises four copies of the allele encoding the mutant WOP1 protein of SEQ ID NO: 31.
[0218] In another specific aspect, the tetraploid watermelon plant or plant part comprises four copies of a different mutant wop1 allele, e.g. selected from the alleles described above.
[0219] Genotyping of tetraploid plants or plant parts (cells, leaves, DNA, etc.) can be done in the same way as for diploids, using for example a KASP-assay to distinguish SNP genotypes, e.g. plants or parts comprising AAAA for SNP1 can be distinguished from plants or parts comprising GAAA, GGAA, GGGA or GGGG for SNP1 in their genome. Plants and plant parts comprising AAAA for SNP16a, i.e. four copies of SEQ ID NO: 30 encoding the mutant WOP1 protein of SEQ ID NO: 31, can equally be distinguished from the other genotypes.
[0220] In one aspect of the invention a tetraploid watermelon comprising at least one or two or three copies of the mutant wop1 allele (as described above), but preferably comprising four copies of the mutant wop1 allele (as described above) is provided. Preferably the watermelon plant is a tetraploid inbred female line, suitable as a parent for F1 hybrid seed production.
[0221] The generation of the tetraploid female inbred line can be carried out by using a diploid plant, comprising one or preferably two copies of the wop1 allele in order to double the chromosomes and generate a tetraploid plant. E.g. a diploid inbred line homozygous for wop1 can be used to generate the tetraploid plant. For example plants grown from seeds deposited under NCIMB42533 comprising two copies of a mutant wop1 allele can be used.
[0222] A tetraploid plant comprising four copies of a mutant wop1 allele (i.e. being homozygous for wop1) will express the phenotype, i.e. be facultative parthenocarpic.
[0223] Seeds from which such a tetraploid plant can be grown are also encompassed herein, as are parts of such a plant, such as tetraploid seedless fruits produced in the absence of pollination, flowers, leaves, stems, cuttings, vegetative propagations, cells, seed propagations (e.g. selfings) and also in vitro cell- or tissue cultures, as well as pollen, ovaries, rootstocks, scions, etc. are encompassed herein. Thus, in one embodiment the tetraploid plant, or seeds from which the plant can be grown, or tissue or parts of the plant (pollen, anthers, ovules) comprises a mutant wop1 allele as described above, e.g. the mutant allele as found in seeds deposited under NCIMB42533 or another mutant wop1 allele.
[0224] A tetraploid can comprise different mutant wop1 alleles, e.g. two mutant wop1 alleles encoding a truncated WOP1 protein and two mutant wop1 allele encoding a WOP1 protein having an amino acid substitution, e.g. Serine 143 of SEQ ID NO: 32 being replaced by Asparagine (mutant S143N). Such plants can for example be made by first making a diploid comprising different mutant wop1 alleles and then doubling the chromosomes of such diploid. In one aspect the tetraploid does, however, comprise four copies of the same mutant wop1 allele, i.e. the tetraploid is made from a diploid which is homozygous for the wop1 allele.
Triploid Watermelon Plants Comprising a Mutant wop1 Allele
[0225] In a further aspect triploid watermelon seeds, plants and plant parts comprising one, two or three copies of a mutant wop1 allele are provided, i.e. wop1/WOP1/WOP1 or wop1/wop1/WOP1 or wop1/wop1/wop1, respectively. Such triploids can be made as described above, and as shown in the Table 2 below:
TABLE-US-00002 TABLE 2 Genotype of F1 triploid seed produced by polli- Female tetraploid Male diploid nating female tetraploid parent parent with pollen of male diploid A wop1/wop1/wop1/ wop1/wop1 wop1/wop1/wop1 wop1 B wop1/wop1/wop1/ WOP1/WOP1 wop1/wop1/WOP1 wop1 C WOP1/WOP1/WOP1/ wop1/wop1 WOP1/WOP1/wop1 WOP1
[0226] In one aspect a tetraploid plant comprising four copies of a mutant wop1 allele is used as female parent and is pollinated with pollen of diploid male parent comprising two copies of a mutant wop1 allele and the seeds from the cross are harvested. These seeds are triploid and they comprise three copies of a mutant wop1 allele of the invention (Table 2, row A). Plants grown from these seeds produce seedless watermelon fruits (triploid fruits) without the need for pollination to induce fruit set. The triploid hybrid plants, grown from these F1 triploid seeds, are self-infertile as they produce sterile pollen due to chromosome imbalance. These seeds can thus be grown in production fields without the need for pollenizer plants. This is the first time that seedless triploid watermelon fruits can be produced in the absence of pollen and pollenizer plants.
[0227] In one aspect the triploid under A above comprises three identical mutant wop1 alleles, i.e. the female and male parents comprise the same mutant allele. However, in another aspect the female parent and the male parent may comprise different mutant wop1 alleles. For example the female parent may comprise four mutant wop1 allele encoding a truncated WOP1 protein and the male parent may comprise two mutant wop1 allele encoding a WOP1 protein having an amino acid substitution, e.g. Serine 143 of SEQ ID NO: 32 being replaced by Asparagine (mutant S143N), or the other way around.
[0228] The triploid, seedless fruits are preferably marketable. Preferably they have an average brix of at least 6.0, 7.0, 8.0 or preferably at least 9.0, preferably at least 10.0, more preferably at least 11.0. Fruits may be of any size, shape, color and rind pattern. Preferably fruit flesh color at maturity is uniform. In one aspect fruit flesh is red or dark red.
[0229] The average fruit weight of a triploid hybrid comprising wop1 in three copies may be equal to or above 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 kg. In another embodiment average fruit weight of a triploid hybrid comprising wop1 in three copies may be equal to or less than 5 kg, e.g. 4, 3, 2, 1.5 or 1 kg or even less.
[0230] Seedless fruits may be of any shape (e.g. elongate, oval, blocky, spherical or round), fruit surface (furrow, smooth), flesh color (red, dark red, scarlet red, coral red, orange, salmon, pink, pinkish red, yellow, canary yellow or white), rind color (e.g. light green; dark green; green-striped with narrow, medium or wide stripes; grey types; with or without spotting; Golden yellow), rind thickness, rind toughness, rind pattern (e.g. striped, non-striped, netted), flesh structure/flesh firmness, lycopene and/or vitamin content, different sugar to acid ratios, fruit flavour, etc.
[0231] Thus, the mutant wop1 allele may be used to breed a range of seedless varieties, producing fruits of different shapes and sizes, etc. by traditional breeding. See Guner and Wehner 2004, Hort Science 39(6): 1175-1182, in particular pages 1180-1181 describing genes for fruit characteristics. Generally important breeding objectives are early maturity, high fruit yield, high internal fruit quality (good uniform color, high sugar, proper sugar: acid ratio, good flavor, high vitamin and lycopene content, firm flesh texture, non-fibrous flesh texture, freedom from defects such as hollow heart, rind necrosis, blossom-end rot or cross stitch and good rind characteristics and cracking-resistance).
[0232] Seeds from which such triploid F1 hybrid plants can be grown are one aspect of the invention.
[0233] Regarding triploid seeds and triploid plants comprising only one or two copies of a mutant wop1 allele of the invention (as shown in the Table 2 above, row B and C), the phenotype has not yet been tested, but these may also be suitable to produce seedless fruits without pollen and they may also be grown in a field without pollenizer plants. In any case, such triploid plants and seeds from which such plants can be grown are an aspect of the invention, as are parts thereof and triploid fruits produced by such plants. Preferably such triploid fruits are marketable. Preferably they have an average brix of at least 6.0, 7.0, 8.0 or preferably at least 9.0, preferably at least 10.0, more preferably at least 11.0. Fruits may be of any size, shape, color and rind pattern. Preferably fruit flesh color at maturity is uniform. In one aspect fruit flesh is red or dark red.
[0234] In one aspect the triploid plant of the invention is a vegetative propagation.
[0235] Also provided is a method for producing triploid hybrid watermelon seeds, wherein triploid plants grown from such seeds produce fruits in the absence of pollination, said method comprising:
(a) providing a facultative parthenocarpic diploid watermelon plant and a facultative parthenocarpic tetraploid plant (see e.g. Table 2 row A),
(b) allowing pollination of pistillate flowers of the tetraploid plant with pollen of the diploid plant, and
(c) harvesting seeds produced in the fruits of the tetraploid plant, and optionally
(d) drying the harvested seeds.
[0236] Optionally the dried and harvested F1 seeds are then packaged. They may also be treated prior to packaging. Thus packages or containers comprising or consisting of seeds obtained by the above method are an embodiment herein.
[0237] Also provided is a method for producing triploid hybrid watermelon seeds, said method comprising:
(a) providing a diploid watermelon plant lacking a mutant wop1 allele and a tetraploid plant comprising four copies of a mutant wop1 allele (see e.g. Table 2 row B), or providing a diploid watermelon plant homozygous for the mutant wop1 allele and a tetraploid plant lacking a mutant wop1 allele (e.g. Table 2 row C),
(b) allowing pollination of pistillate flowers of the tetraploid plant with pollen of the diploid plant, and
(c) harvesting seeds produced in the fruits of the tetraploid plant, and optionally
(d) drying the harvested seeds.
[0238] Optionally the dried and harvested F1 seeds are then packaged. They may also be treated prior to packaging. Thus packages or containers comprising or consisting of seeds obtained by the above method are an embodiment herein.
[0239] Seeds from which any the above triploid plants can be grown are also encompassed herein, as are parts of such a plant, such as triploid fruits, flowers, leaves, stems, cuttings, vegetative propagations, cells, seed propagations (e.g. selfings) and also in vitro cell- or tissue cultures, as well as pollen, ovaries, rootstocks, scions, etc. are encompassed herein. Thus, in one embodiment the triploid plant, or seeds from which the plant can be grown, or tissue or parts of the plant (pollen, anthers, ovules) comprises a mutant wop1 allele as described above, e.g. the mutant allele as found in seeds deposited under NCIMB42533 or another mutant wop1 allele as described above.
Vegetative Propagations and Cell or Tissue Cultures
[0240] The above diploid plants, tetraploid plants or triploid plants (or other polyploids) can also be reproduced vegetatively (clonally) and such vegetatively propagated plants, or vegetative propagations are an embodiment of the invention. They can easily be distinguished from other watermelon plants by the presence of a mutant wop1 allele and/or phenotypically. The presence of one or more mutant wop1 alleles can be determined as described elsewhere herein.
[0241] Vegetative propagations can be made by different methods. For example one or more scions of a plant of the invention may be grafted onto a different rootstock, e.g. a biotic or abiotic stress tolerant rootstock.
[0242] Other methods include in vitro cell or tissue culture methods and regeneration of vegetative propagations from such cultures. Such cell or tissue cultures comprise or consist of various cells or tissues of a plant of the invention. In one aspect such a cell or tissue culture comprises or consists of vegetative cells or vegetative tissues of a plant of the invention.
[0243] In another aspect a cell or tissue culture comprises or consists of reproductive cells or tissues, such as anthers or ovules of a plant of the invention. Such cultures can be treated with chromosome doubling agents to make e.g. double haploid plants, or they can alternatively be used to make haploid plants (e.g. to make diploids from a tetraploid or to make haploids from a diploid).
[0244] An in vitro cell or tissue culture may, thus, comprise or consist of cells or protoplasts or plant tissue from a plant part selected from the group consisting of: fruit, embryo, meristem, cotyledon, pollen, ovule, leaf, anther, root, root tip, pistil, flower, seed, stem. Also parts of any of these are included, such as e.g. only the seed coat (maternal tissue).
[0245] Thus, in one aspect of the invention a cell culture or a tissue culture of cells of a plant comprising one, two, three or four copies of a mutant wop1 allele, all as described above, is provided. As mentioned, a cell culture or a tissue culture comprises cells or protoplasts or plant tissue from a plant part of a plant comprising a mutant wop1 allele may comprise or consist of cells or tissues selected from the group consisting of: embryo, meristem, cotyledon, pollen, leaf, anther, root, root tip, pistil, flower, seed, stem; or parts of any of these.
[0246] Also provided is a watermelon plant regenerated from such a cell culture or tissue culture, wherein the regenerated plant (or progeny thereof, e.g. obtained after selfing the regenerated plant) comprises the mutant wop1 allele. Therefore, in one aspect the watermelon plant comprising a mutant wop1 allele in one or more copies is a vegetatively propagated watermelon plant.
[0247] In a different aspect the cells and tissues of the invention (and optionally also the cell or tissue culture), comprising wop1 in one or more copies, are non-propagating cells or tissues.
Methods According to the Invention
[0248] A method for seedless triploid watermelon fruit production is provided, said method comprising: [0249] 1. providing a triploid hybrid (F1) watermelon plant or seed comprising at least one, preferably two or preferably three copies of a mutant wop1 allele, [0250] 2. planting or seeding said triploid hybrid plants in a field, preferably without planting or seeding diploid pollenizer plants in the same field, and optionally [0251] 3. harvesting the seedless watermelon fruits produced on the triploid plants, whereby the fruits are preferably produced without pollination of the female flowers.
[0252] In one aspect the triploid hybrid plant of step 1 is preferably not grafted onto a different rootstock.
[0253] As mentioned, there is no need anymore to provide diploid pollenizer plants to induce fruit set on of the female flowers of the triploid plants. This means that an entire field can be sown or transplanted with essentially only seeds or transplants of the F1 triploid seeds or plants. Yield of seedless watermelon fruits per hectare is therefore greatly enhanced. Also seeding and planting is made much easier as only one genotype is seeded or planted.
[0254] Thus, the method can also be described as a method of producing seedless watermelon fruits, said method comprising growing a triploid plant comprising at least one, preferably two, more preferably three copies of mutant wop1 allele and harvesting the fruits produced by said plants. The fruits develop preferably without pollination of the female flowers, i.e. in the absence of viable pollen. No insects, such as bees, are required anymore for fruit set, i.e. placing bee hives into or near the fields is not necessary.
[0255] The harvested triploid fruits may be packaged for fresh markets or for processing. Fruits comprising one, two or three wop1 alleles obtainable by the above method are encompassed herein. Optionally detection of the mutant wop1 allele e.g. by detection of the mutant wop1 allele using DNA, RNA or protein detection as described elsewhere, e.g. by PCR, genotyping or marker analysis of markers linked to (or closely linked to) the wop1 allele, can distinguish such fruits. Thus, in one embodiment, harvested triploid fruits (i.e. wop1/WOP1/WOP1 or wop1/wop1/WOP1 or wop1/wop1/wop1) are provided, such as packaged whole fruits or fruit parts and/or processed fruits or fruit parts.
[0256] Also provided is a method for production of a facultative parthenocarpic cultivated watermelon plant comprising the steps of [0257] a) introducing mutations in a population of watermelon plants or providing a mutant population of watermelon plants; [0258] b) selecting a plant producing seedless fruits without pollination of the female flowers and producing a seeded fruit after pollination of the female flowers and/or selecting a plant comprising a mutant allele of the WOP1 gene; [0259] c) optionally verifying if the plant selected under b) comprises a mutant allele of a WOP1 gene; and [0260] d) optionally growing the plants obtained under c).
[0261] A watermelon plant produced by the above method is encompassed.
[0262] The population of watermelon plants under a) is preferably a single genotype of a cultivated watermelon breeding line or variety, which is treated/has been treated with (or subjected to) a mutagenic agent, or progeny of such a population e.g. obtained after selfing individuals of the population to produce M2, M3 or further generation plants. This may for example be a TILLING population.
[0263] In step b) plants are screened for the phenotype, i.e. for being facultative parthenocarpic and/or the plants (or plant parts or DNA therefrom) are screened for the presence of a mutant allele of the WOP1 gene, i.e. an allele which either has reduced expression or no expression of the WOP1 protein or an allele encoding a mutant WOP1 protein. Regarding the screening for the phenotype, it is understood that without pollination of the female flowers, seedless fruits should develop; with pollination of the female flowers seeded fruits should develop. This phenotypic screening can be done in several steps. For example first plants can be grown in an insect free environment and male flowers can be removed. Female flowers can be observed visually for flowering and fruit development (in absence of pollen). The developed fruit can be cut in half at maturity to check if these are seedless. Selected plants can e.g. be vegetatively reproduced to confirm the parthenocarpy phenotype and/or to e.g. hand-pollinate flowers to see if fruits are seeded upon pollination (facultative parthenocarpy). Regarding the screening of the plants for the presence of a mutant allele of the WOP1 gene, this can be done by various methods which detect wop1 DNA, RNA or protein, for example by e.g. designing PCR primers which amplify part of the coding region or all of the coding region to amplify the genomic DNA in order to determine if a plant comprises a mutation in the genomic DNA, or other methods.
[0264] Step c) can involve various methods to determine whether a mutant wop1 allele is present. For example an allelism test with plants deposited herein can be carried out. Alternatively or in addition marker analysis or sequence analysis of the chromosome 4 region comprising the WOP1 locus can be carried out, or PCR or RT-PCR can be used to amplify the wop1 allele (or a part thereof) or the mRNA (cDNA). Also genetic analysis to determine the recessive inheritance may be carried out.
[0265] Also the use of a facultative parthenocarpic watermelon plant for producing seedless watermelon fruits is provided, preferably without pollination of the female flowers of the plant. Further the use of a mutant wop1 allele for generating facultative parthenocarpic watermelon plants and/or seedless watermelon fruits in the absence of pollination of the female flowers is provided. Likewise the use of a mutant wop1 allele of a WOP1 gene according to the invention for producing facultative parthenocarpic watermelon plants is encompassed herein.
[0266] In one aspect the plants, plant parts and plant cells according to the invention are not exclusively obtained by means of an essentially biological process as defined by Rule 28 (2) EPC (European Patent Convention).
[0267] In one aspect the plants are non-GMO (not genetically modified).
[0268] In one aspect the mutant allele of the WOP1 gene comprises a human induced mutation, i.e. a mutation introduced by mutagenesis techniques, such as chemical mutagenesis or UV mutagenesis, or targeted mutagenesis techniques.
[0269] In one aspect an isolated mutant WOP1 protein and an isolated wild type WOP1 protein is provided or an isolated nucleic acid molecule encoding a mutant WOP1 protein or a wild type WOP1 protein. Also an antibody able to bind a mutant or wild type WOP1 protein is encompassed herein.
[0270] Detection methods:
[0271] In one aspect a screening method for identifying and/or selecting seeds, plants or plant parts or DNA from such seeds, plants or plant parts comprising in their genome a mutant allele of a WOP1 protein-encoding gene is provided.
[0272] The method comprises screening at the DNA, RNA (or cDNA) or protein level using known methods, in order to detect the presence of the mutant allele. There are many methods to detect the presence of a mutant allele of a gene.
[0273] Thus a method for screening and/or selecting plants or plant material or plant parts, or DNA or RNA or protein derived therefrom, for the presence of a mutant wop1 allele is provided comprising one or more of the following steps: [0274] a) determining if the gene expression of the endogenous WOP1 gene is reduced or abolished; [0275] b) determining if the amount of wild type WOP1 protein is reduced or abolished; [0276] c) determining if a mutant mRNA, cDNA or genomic DNA encoding a mutant WOP1 protein is present; [0277] d) determining if a mutant WOP1 protein is present; [0278] e) determining if plants or progeny thereof have a modified leaf morphology as shown in
[0280] Routine methods can be used, such as RT-PCR, PCR, antibody based assays, sequencing, genotyping assays, phenotyping for steps e and f, etc.
[0281] The plants or plant material or plant parts may be watermelon, cucumber or melon plants or plant materials or plant parts, such as leaves, leaf parts, cells, fruits, fruit parts, ovaries, stem, hypocotyl, seed, parts of seeds, seed coat, embryo, etc.
[0282] For example if there is a single nucleotide difference (single nucleotide polymorphism, SNP) between the wild type and the mutant allele, a SNP genotyping assay can be used to detect whether a plant or plant part or cell comprises the wild type nucleotide or the mutant nucleotide in its genome. For example the SNP can easily be detected using a KASP-assay (see world wide web at kpbioscience.co.uk) or other SNP genotyping assays. For developing a KASP-assay, for example 70 base pairs upstream and 70 base pairs downstream of the SNP can be selected and two allele-specific forward primers and one allele specific reverse primer can be designed. See e.g. Allen et al. 2011, Plant Biotechnology J. 9, 1086-1099, especially p097-1098 for KASP-assay method.
[0283] Equally other genotyping assays can be used. For example, a TaqMan SNP genotyping assay, a High Resolution Melting (HRM) assay, SNP-genotyping arrays (e.g. Fluidigm, Illumina, etc.) or DNA sequencing may equally be used.
[0284] Also provided is a method for determining, or detecting or assaying, whether a cell or of a watermelon plant or plant part comprises a mutant allele of a gene name WOP1 encoding a protein of SEQ ID NO: 32, or a protein comprising at least 95%, 96%, 97% or 98% sequence identity to SEQ ID NO: 32, is provided herein. In one aspect the method comprises determining the expression of the allele, and/or determining the coding sequence of the allele and/or determining part of the coding sequence of the allele (e.g. a SNP genotype of the allele), and/or determining the amino acid sequence of the protein produced and/or the amount of protein produced. The same applies to a method for determining, or detecting or assaying, whether a cell or of a cucumber or melon plant or plant part comprises a mutant allele of a gene name WOP1 encoding a protein of SEQ ID NO: 33, or a protein comprising at least 95%, 96%, 97% or 98% sequence identity to SEQ ID NO: 33 (cucumber), or a protein of SEQ ID NO: 34, or a protein comprising at least 95%, 96%, 97% or 98% sequence identity to SEQ ID NO: 34 (melon).
[0285] Various method can be used to determine whether a plant or part thereof comprises a mutant wop1 allele of the invention. As mentioned, the mRNA (or cDNA) level of the wild type allele may be determined, or the wild type protein level may be determined, to see if there is a reduced expression or no expression of the wild type allele. Also, the coding sequence or part thereof may be analysed, for example if one already knows which mutant allele may be presence, an assay can be developed to detect the mutation, e.g. a SNP genotyping assay can e.g. distinguish between the presence of the mutant allele in watermelon and the wild type allele, e.g. genotyping for SNP16a.
[0286] A method for selection of a plant comprising the steps of:
a) identifying a plant which has a mutation in an allele encoding a WOP1 protein-encoding gene wherein the wild type allele of the gene encodes a WOP1 protein comprising at least 95%, 96%, 97% or 98% sequence identity to any one of the proteins selected from the group of: SEQ ID NO:32 or SEQ ID NO: 33 or SEQ ID NO: 34, and optionally
b) determining whether the plant, or a progeny plant produced by self-fertilization, is facultative parthenocarpic and optionally
c) selecting a plant comprising at least on copy of the mutant allele of step a).
[0287] A method for production of a plant comprising the steps of:
a) introducing mutations in a population of plants,
b) selecting a plant producing seedless fruit in the absence of pollination and seeded fruits after pollination and/or comprising a mutant wop1 allele,
c) optionally verifying if the plant selected under b) has a mutation in an allele encoding a WOP1 protein encoding gene and selecting a plant comprising such a mutation, and optionally
d) growing/cultivating the plants obtained under c),
wherein the wild type allele of the gene encodes a WOP1 protein comprising at least 95% sequence identity to any one of the proteins selected from the group of: SEQ ID NO:32 or SEQ ID NO: 33 or SEQ ID NO: 34.
[0288] A method for production of a plant comprising the steps of:
a) introduction of a foreign nucleic acid molecule into a plant, wherein the foreign nucleic acid molecule is chosen from the group consisting of
i) DNA molecules, which code at least one antisense RNA, which effects a reduction in the expression of an endogenous gene encoding a WOP1 protein;
ii) DNA molecules, which by means of a co-suppression effect lead to the reduction in the expression of an endogenous gene encoding a WOP1 protein;
iii) DNA molecules, which code at least one ribozyme, which splits specific transcripts of an endogenous gene encoding a WOP1 protein;
iv) DNA molecules, which simultaneously code at least one antisense RNA and at least one sense RNA, wherein the said antisense RNA and the said sense RNA form a double-stranded RNA molecule, which effects a reduction in the expression of an endogenous gene encoding a WOP1 protein (RNAi technology);
v) nucleic acid molecules introduced by means of in vivo mutagenesis, which lead to a mutation or an insertion of a heterologous sequence in an endogenous gene encoding a WOP1 protein, wherein the mutation or insertion effects a reduction in the expression of a gene encoding a WOP1 protein or results in the synthesis of a loss-of-function or reduced function WOP1 protein;
vi) nucleic acid molecules, which code an antibody, wherein the antibody results in a reduction in the activity of an endogenous gene encoding a WOP1 protein due to the bonding of the antibody to an endogenous WOP1 protein,
vii) DNA molecules, which contain transposons, wherein the integration of these transposons leads to a mutation or an insertion in an endogenous gene encoding a WOP1 protein, which effects a reduction in the expression of an endogenous gene encoding a WOP1 protein, or results in the synthesis of an inactive cyclin SDS like protein;
viii) T-DNA molecules, which, due to insertion in an endogenous gene encoding a cyclin SDS like protein, effect a reduction in the expression of an endogenous gene encoding a cyclin SDS like protein, or result in the synthesis of a loss-of-function or reduced function WOP1 protein;
ix) nucleic acid molecules encoding rare-cleaving endonucleases or custom-tailored rare-cleaving endonucleases preferably a meganuclease, a TALENs or a CRISPR/Cas system
b) selecting a plant wherein the plant, or a progeny of the plant produced by self-fertilization, produces seedless fruit in the absence of pollination and seeded fruits after pollination, optionally
c) verifying if the plant selected under b) has a decreased activity of a WOP1 protein compared to wild type plants into whose genome no foreign nucleic acid molecules had been integrated, optionally
d) growing/cultivating the plants obtained under c).
[0289] A plant obtained by any of the methods above is encompassed herein.
[0290] In one aspect a genetically modified plant and plant part is provided, whereby the plant has reduced expression or no expression of the endogenous WOP1 gene, e.g. through silencing of the endogenous WOP1 gene. Such a plant may be any plant, in one aspect it is a watermelon, melon or cucumber. However, it can also be a maize, soybean, wheat, canola, tomato, cotton, etc.
[0291] In another aspect a plant and plant part is provided comprising a mutation in the endogenous WOP1 gene, e.g. an induced mutation generated e.g. by targeted mutagenesis, whereby either the gene expression is reduced or abolished or the expressed gene encodes a reduced function or loss of function WOP1 protein compared to the wild type protein. Such a plant may be any plant, in one aspect it is a watermelon, melon or cucumber as described. However, it can also be a maize, soybean, wheat, canola, tomato, cotton, pepper, etc. As the WOP1 gene in other species may have less sequence identity to the Cucurbitaceae WOP1 gene, it is encompassed herein that in this aspect of the invention the WOP1 gene is a gene encoding a protein comprising at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% sequence identity to SEQ ID NO: 32. Optionally the WOP1 gene is a gene encoding a protein comprising at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% sequence identity to SEQ ID NO: 32 whereby the protein comprises the conserved domain of SEQ ID NO: 35 or a sequence comprising at least 70%, 75%, 80%, 85%, 90%, 95% sequence identity to SEQ ID NO: 35. The skilled person can identify orthologs of the WOP1 gene in such other species, e.g. in pepper or tomato, and thereby make facultative parthenocarpic pepper or tomato plants. All embodiments described herein for watermelon, cucumber and melon apply equally for other crop species, with the difference that the WOP1 gene may thus encode a protein with less than 95% sequence identity to the wild type WOP1 watermelon protein of SEQ ID NO: 32.
DEPOSIT INFORMATION
[0292] Diploid Citrullus lanatus seeds of plants segregating for a mutant wop1 allele have been deposited by Nunhems B.V. under the Budapest Treaty under accession No. NCIMB42533 at NCIMB Ltd., Ferguson Building, Craibstone Estate, Bucksburn Aberdeen AB21 9YA, Scotland, UK on 27 Jan. 2016. The seeds were produced by selfing a plant heterozygous for the mutant wop1 allele (i.e. WOP1/wop1). The deposited seeds consist of 25% WOP1/WOP1 (homozygous wild type WOP1 allele), 50% WOP1/wop1 (heterozygous) and 25% wop1/wop1 (homozygous for the mutant wop1 allele) plants.
[0293] Diploid Citrullus lanatus seeds of plants segregating for a mutant allele of a cyclin SDS like protein encoding gene (mutant emb1 allele) have been deposited by Nunhems B.V. under the Budapest Treaty under accession No. NCIMB 42532 at NCIMB Ltd., Ferguson Building
[0294] Craibstone Estate Bucksburn Aberdeen AB21 9YA, Scotland, UK on 27 Jan. 2016. The deposited seeds were obtained from a self-pollinated back-cross of a plant homozygous for the emb1 mutant allele with plants homozygous for the emb1 wild type allele. Therefore 25% of the deposited seeds are homozygous for the emb1 mutant allele and produce seedless fruits, 50% are heterozygous for the mutant allele and 25% are homozygous for the wild type allele, encoding the wild type cyclin SDS like protein.
[0295] The Applicant requests that samples of the biological material and any material derived from said samples be only released to a designated Expert in accordance with Rule 32(1) EPC or related legislation of countries or treaties having similar rules and regulation, until the mention of the grant of the patent, or for 20 years from the date of filing if the application is refused, abandoned, withdrawn or deemed to be withdrawn.
[0296] Access to the deposits will be available during the pendency of this application to persons determined by the Commissioner of Patent and Trademarks to be entitled thereto upon request.
[0297] Subject to 37 C.F.R. ? 1.808(b), all restrictions imposed by the depositor on the availability to the public of one or more deposits will be irrevocably removed upon the granting of the patent by affording access to the deposits. The deposits will be maintained for a period of 30 years, or 5 years after the most recent request, or for the enforceable life of the patent whichever is longer, and will be replaced if it ever becomes nonviable during that period. Applicant does not waive any rights granted under this patent on this application or under the Plant Variety Protection Act (7 USC 2321 et seq.).
SEQUENCE DESCRIPTION
[0298] SEQ ID NO 1-24 and SEQ ID NO 29: Sequences of Citrullus lanatus comprising Single Nucleotide Polymorphisms on chromosome 4, said SNPs being polymorphic between plants comprising the mutant wop1 allele and plants lacking the mutant wop1 allele of seeds deposited under NCIMB42533. [0299] SEQ ID NO 25: Genomic sequence of a wild type cyclin SDS like protein encoding gene (Emb1 gene) from Citrullus lanatus. [0300] SEQ ID NO 26: Amino acid sequence of a SDS like protein from Citrullus lanatus. The amino acid sequence is derivable from the coding sequence of SEQ ID NO 25. [0301] SEQ ID NO 27: mRNA sequence of a mutant allele of a cyclin SDS like protein from Citrullus lanatus. [0302] SEQ ID NO 28: Amino acid sequence of the mutant allele of a SDS like protein. The amino acid sequence is derivable from SEQ ID NO 27. [0303] SEQ ID NO 30: cDNA and genomic DNA of watermelon encoding the mutant WOP1 protein of SEQ ID NO: 31 [0304] SEQ ID NO 31: Amino acid sequence of a mutant WOP1 protein, comprising an S143N mutation, as found in seed deposited under NCIMB42533. [0305] SEQ ID NO 32: Amino acid sequence of a wild type WOP1 protein of watermelon [0306] SEQ ID NO 33: Cucumis sativus wild type WOP1 protein [0307] SEQ ID NO 34: Cucumis melo wild type WOP1 protein [0308] SEQ ID NO 35: conserved domain myb-like DNA binding domain SHAQKYF-class comprised in the WOP1 proteins of SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 34 [0309] SEQ ID NO 36 to 38: primer pair for WOP1 gene expression analysis and resulting amplified product [0310] SEQ ID NO 39 to 41: primer pair for WOP1 gene expression analysis and resulting amplified product
Examples
Forward Screening of Mutant Plants
[0311] A mutant population was established by treating approximately 10.000 watermelon seeds from an inbred diploid line with EMS several hours and subsequently washing the seeds in streaming tap water for 30 minutes. After that the seeds were kept wet until sowing in soil. M1 Plants were grown from the mutagenized seeds, self-pollinated and the seeds (M2 generation) were harvested.
[0312] M2 families were grown in insect proof greenhouse and monitored regularly for fruit setting.
[0313] Mutant plants producing seedless fruits were isolated. One of these mutant plants was designated wop1.
[0314] Propagation of the wop1 mutant plant was performed by grafting cuttings of the wop1 mutant plant to rootstock of a non-mutagenized watermelon plant. The plant was analysed to confirm that the fruit setting was not coming from accidental insect pollination or from hermaphroditic flowers. The plant phenotype was confirmed in two growing seasons. Pollination of the female flowers led to normal, seeded fruits, while in the absence of pollination seedless fruits developed.
[0315] The wop1 gene is a single recessive gene.
[0316] An homozygous wop1 mutant was back-crossed with the original non-mutagenized watermelon inbred line, (BC1 generation). 25% of the plants grown from the self-pollinated BC1 generation did produce seedless fruits without pollination. Results show that the wop1 mutation is due to a single recessive gene.
Identification of the Gene Causing the Seedless Fruit Phenotype
[0317] Pollen from the wop1 mutant was also used for crossing with a watermelon inbred line for establishing an F2 mapping population. F2 individuals were phenotyped for the production of seedless fruits in the absence of pollination of the female flowers. From selected F2 individuals, F2:3 families were phenotyped in the same way.
[0318] Using the genotyping and phenotyping data, the mutant wop1 allele was mapped to chromosome 4, between SNP1a and SNP24, especially between SNP1 and SNP24, most likely between SNP3 and SNP23.
Further Identification of the WOP1 Gene
[0319] Whole Genome Sequencing was carried out and the mutant wop1 allele was identified to lie in-between SNP16 and SNP17. In this region a SNP was identified in a coding sequence of a gene, SNP16a, which resulted in an amino acid substitution in a small protein comprising a myb-like DNA binding domain SHAQKYF-class. This mutation was unique in the mutant population and was only found in the single mutant plant, the wop1 mutant plant.
TABLE-US-00003 ProteinWOP1mutant (SEQIDNO:31) MREEHSNWFSRWEEELPSPDELMPLSQTLITPDLALAFDIQNPSNSSPPLP
[0320] The protein contained a conserved myb-like DNA binding domain SHAQKYF-class (highlighted in boxes above) and the amino acid substation was in the SHAQKYF motif of the domain. This motif is a conserved motif having amino acids SH[A/L]QKY[R/F]L and is part of an alpha-helix.
[0321] SIFT analysis (Pauline and Henikoff 2003, NAR 31, 3812-3814) confirmed that the mutant WOP protein is predicted to have a reduced function or loss of function.
[0322] The facultative parthenocarpic phenotype co-segregated with the mutant wop1 allele and in plants homozygous for the mutation (wop1/wop1) leaf margin and leaf blade was found to be modified, see
[0323] Orthologs of the WOP1 gene were identified using protein BLAST analysis.
TABLE-US-00004 ProteinWOP1cucumber (SEQIDNO:33) MREEHSNWFSRWEDELPSPDELMPLSQTLITPDLALAFDIQNPSNSSPPLP
[0324] These two proteins also contain the myb-like DNA binding domain SHAQKYF-class (highlighted in boxes above). The proteins each have 95.3% sequence identity to the wild type watermelon WOP1 protein (SEQ ID NO: 32) and comprise 98.7% sequence identity to each other using the program Needle of website ebi.ac.uk with default parameters).
Expression Analysis of the WOP1 Gene in Watermelon:
[0325] RT-PCR analysis was carried out to determine mRNA expression in the wop1 mutant plant and in the WOP1 wild type plant. Tissue samples were taken from young leaf tissue, ovary tissue of open flowers, ovary tissue at 3-4 and 5-6 days after pollination/fruit development of both wild type and mutant plants.
[0326] Two primer combination (A6254-6255 and A6256-6257) were used for measuring the expression of WOP1. The primer combinations amplify different parts of the mRNA/cDNA. Two household genes (C1PP2A and C1YLS8) were added as control.
TABLE-US-00005 A6254 (SEQ ID NO: 36) CCTACACGACGCTCTTCCAAGAGGAGCTTCCATCTCCAG A6255 (SEQ ID NO: 37) CTGCTGAACCGCTCTTCCAGCCCAAATCGGCAGAATC
[0327] Amplified fragment (nucleotides 38 to 250 of SEQ ID NO: 30):
TABLE-US-00006 (SEQ ID NO: 38) AAGAGGAGCTTCCATCTCCAGATGAATTGATGCCTCTTTCTCAAACCCTA ATAACCCCCGATCTAGCTTTGGCCTTTGATATTCAGAATCCCAGCAATAG CAGTCCGCCGTTGCCTTGTCCATCTCCGCCGCTTTCGAATCCTCTGCCTG GCTCTGGCAACGGAATTGCGCAGCCCAACTCGGCGGATTTCGGCGATTCT GCCGATTTGGGCT A6256 (SEQ ID NO: 39) CCTACACGACGCTCTTCCGTGGCTTGGTTGCTTCCTC A6265 (SEQ ID NO: 40) CTGCTGAACCGCTCTTCCGATGATAAGGCGGCTGGAG
[0328] Amplified fragment (nucleotides 500 to 712 of SEQ ID NO: 30):
TABLE-US-00007 (SEQ ID NO: 41) GTGGCTTGGTTGCTTCCTCCGATCCCGCCACTGACCATTTGTTTGCCAGC TCCCCAGTTCCACCCCATTTGCTTCACTCTGCTCGCACCAGTTCAGACCA TTTCTTGCCCTTTGTTCCCATGGCCACTCTGCAGCAGCACCACCATCACC AGCAGCAGATGGCCGCTGCTGCTGCTGTCGCCGTCCATCCGCAGCTCCAG CCGCCTTATCATC
[0329] The expression was normalized to one of the household genes. The wild type young leaf sample was put at 100%. The expression of the wop1 mutant allele was essentially similar to the expression of the WOP1 wild type allele in the young leaf and in the developing ovary tissues. For both primer pairs similar results were obtained. This shows that the wop1 mutation in the coding sequence has no effect on WOP1 gene expression.