METHODS FOR TREATMENT OF CANCER BY TARGETING SIRT5

20190298747 ยท 2019-10-03

Assignee

Inventors

Cpc classification

International classification

Abstract

This disclosure demonstrates that inhibition of Sirt5 can suppress malignant transformation of cells. Therefore, methods of treating cancer based on inhibition of Sirt5 are disclosed.

Claims

1.-10. (canceled)

11. A compound that inhibits Sirt5 demalonylase or desuccinylase activity, having the formula: ##STR00007## wherein: R.sub.1 is an anionic or ionizable group; R.sub.2 is selected from S, NR.sub.5, and O, wherein R.sub.5 is H, methyl, ethyl, isopropyl, phenyl, or benzyl; X.sub.0, X.sub.1, X.sub.2, X.sub.3, X.sub.4, X.sub.5, X.sub.6 and X.sub.7 are independently selected from (CH.sub.2).sub.n (wherein n represents 1, 2, or 3), NR.sub.5, O, S, or a bond, provided that at least one of X.sub.0-X.sub.4 is not a bond, and at least one of X.sub.5-X.sub.7 is not a bond; R.sub.3 and R.sub.4 are independently selected from H, hydrocarbon (R), amino acid, dipeptide, tripeptide, oligopeptide, protein, nucleobase, nucleotide, dinucleotide, trinucleotide, oligonucleotide, monosaccharide, disaccharide, oligosaccharide, and protecting groups or a combination thereof or modified form thereof.

12. The compound of claim 11, wherein R.sub.2 is S.

13. The compound of claim 11, wherein X.sub.4 is NR.sub.5.

14. The compound of claim 11, wherein R.sub.2 is S and X.sub.4 is NR.sub.5.

15. The compound of claim 11, wherein R.sub.1 is an anionic group selected from carboxylate, thiocarboxylate, sulfonate, and phosphonate.

16. The compound of claim 11, wherein R.sub.1 is an anionic group selected from carboxylate and thiocarboxylate.

17. The compound of claim 11, wherein R.sub.1 is an anionic group selected from carboxylate, thiocarboxylate, sulfonate, and phosphonate, and R.sub.2 is S.

18. The compound of claim 11, wherein R.sub.1 is an anionic group selected from carboxylate, thiocarboxylate, sulfonate, and phosphonate, R.sub.2 is S, and X.sub.4 is NR.sub.5.

19. The compound of claim 11, wherein R.sub.1 is an anionic group selected from carboxylate and thiocarboxylate, and R.sub.2 is S.

20. The compound of claim 11, wherein R.sub.1 is an anionic group selected from carboxylate and thiocarboxylate, R.sub.2 is S, and X.sub.4 is NR.sub.5.

21. The compound of claim 11, wherein X.sub.5, X.sub.6 and X.sub.7 are independently selected from (CH.sub.2).sub.n (wherein n represents 1, 2, or 3) or a bond, provided that at least one of X.sub.5-X.sub.7 is (CH.sub.2).sub.n.

22. The compound of claim 11, wherein X.sub.5, X.sub.6 and X.sub.7 are independently selected from CH.sub.2 or a bond, provided that at least one of X.sub.5-X.sub.7 is CH.sub.2.

23. The compound of claim 11, wherein X.sub.0, X.sub.1, X.sub.2, and X.sub.3 are CH.sub.2.

24. The compound of claim 11, wherein R.sub.3 and R.sub.4 are independently selected from amino acid, dipeptide, tripeptide, oligopeptide, and protein.

25. The compound of claim 11, wherein the compound is H3K9 thiosuccinyl peptide.

26. The compound of claim 11, wherein R.sub.1 is an ionizable group that is an ester derivative of a group selected from carboxylate, thiocarboxylate, sulfonate, and phosphonate.

27. The compound of claim 11, wherein R.sub.1 is an ionizable group that is an ester derivative of carboxylate or thiocarboxylate.

28. The compound of claim 11, wherein R.sub.1 is an ionizable group that is an ester derivative of a group selected from carboxylate, thiocarboxylate, sulfonate, and phosphonate, and R.sub.2 is S.

29. The compound of claim 11, wherein R.sub.1 is an ionizable group that is an ester derivative of carboxylate or thiocarboxylate, and R.sub.2 is S.

30. The compound of claim 11, wherein R.sub.1 is an ionizable group that is an ester derivative of a group selected from carboxylate, thiocarboxylate, sulfonate, and phosphonate; R.sub.2 is S; and X.sub.4 is NR.sub.5.

31. The compound of claim 11, wherein R.sub.1 is an ionizable group that is an ester derivative of carboxylate or thiocarboxylate; R.sub.2 is S; and X.sub.4 is NR.sub.5.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0019] FIG. 1. NAD-dependent deacetylation, demalonylation, and desuccinylation catalyzed by different human sirtuins.

[0020] FIG. 2. Sirt5 was specifically present in the mitochondrial fractions from different human cancer cell lines. Total whole cell lysates (T) (25 g of total protein) and mitochondrial fractions (MT) (25 g of total protein) were analyzed in a Western blot analysis using a specific anti-Sirt5 antibody.

[0021] FIGS. 3A-3D. Sirt5 knockdown inhibits the growth of cancer cells. FIG. 3A: RT-PCR results showing that Sirt5 is knocked down by both siRNA in SKBR3 (a breast cancer cell line) and U87 (a brain cancer cell line) cells. FIG. 3B: Soft-agar assay demonstrating that Sirt5 knockdown inhibits the anchorage-independent growth in both cancer cell lines. FIG. 3C: Serum-limitation assay demonstrating that Sirt5 knockdown inhibit cancer cells (SKBR3 and U87), but not normal cells (MCF10A). FIG. 3D: Sirt1 was successfully knocked down as demonstrated by a Western blot (left), but soft-agar assay (right) demonstrated that Sirt1 knockdown has no obvious effects on the anchorage-independent growth of SKBR3 cancer cells.

[0022] FIG. 4. A working model for elevated glutamine metabolism in cancer cells. Because of the Warburg effect, most of the pyruvate generated from the citric acid (TCA) cycle in cancer cells is converted to lactate, rather than acetyl-CoA and citrate. Thus, cancer cells rely on elevated glutamine (Gln) metabolism to help feed the TCA cycle. It is proposed herein that GLS1 and/or GDH are activated through desuccinylation catalyzed by Sirt5.

[0023] FIG. 5. The knock-down of Sirt5 inhibits GLS1 activation in MDAMB231 cells. Top panel shows the siRNA-mediated knock-down of Sirt5 expression in MDAMB231 cells. The expression levels of GLS1 (labeled as GAC) were unaffected by the knock-down of Sirt5. VADC/Vinculin served as a loading control. Bottom panel: GLS1 activity was assayed in the mitochondrial fractions and whole cell lysates (WCL) from MDAMB231 cells treated with a control RNA or with two siRNAs targeting Sirt5.

[0024] FIG. 6. Illustration of a thiosuccinyl peptide modified with a triphenylphosphonium cation for mitochondria delivery.

DETAILED DESCRIPTION

[0025] It has been demonstrated herein that inhibition of Sirt5 can suppress malignant transformation of cells. Thus, this disclosure provides a new target for cancer therapy. Methods and compositions for treating cancer based on inhibition of Sirt5 are provided herein.

[0026] By treating a cancer it means that the cancer development, growth, and/or metastasis is significantly inhibited, as reflected by reduced or delayed cancer appearances or relapses, reduced tumor volumes or number of cancerous cells, a reduced extent of increase in tumor volume or cancerous cells, and/or reduced occurrences of metastasis. Tumor growth can be determined, e.g., by examining the tumor volume via routine procedures (such as obtaining two-dimensional measurements with a dial caliper). Tumor metastasis can be determined by examining the appearance of tumor cells in secondary sites or examining the metastatic potential of biopsied tumor cells in vitro using various laboratory procedures.

[0027] Cancers which can be treated by using the methods disclosed herein based on inhibition of Sirt5 include, but are not limited to, melanoma, lymphoma, plasmocytoma, sarcoma, glioma, thymoma, leukemia, breast cancer, prostate cancer, colon cancer, esophageal cancer, brain cancer, lung cancer, ovary cancer, cervical cancer, hepatoma, and other neoplasms known in the art.

[0028] By inhibition of Sirt5, it is meant that the expression of the Sirt5 gene, the production of the Sirt5 protein, and/or an enzymatic activity of the Sirt5 protein, is inhibited, suppressed, reduced or even eliminated.

[0029] Sirt5 enzymatic activities, as used herein, include enzymatic removal of acyl groups (malonyl, succinyl, glutaryl, and acetyl) from lysine residues. Thus, Sirt5 activities include demalonylation, desuccinylation, deglutarylation, and deacetylation of lysine residues. In specific embodiments, inhibition of Sirt5 results in inhibition of at least the desuccinylase and demalonylase activities of Sirt5. Sirt5 desuccinylase activity refers to Sirt5 enzymatic removal of a succinyl group from a lysine residue. Sirt5 demalonylase activity refers to Sirt5 enzymatic removal of a malonyl group from a lysine residue. Sirt5 can act on a stand-alone lysine residue with an acyl group, or on an acylated lysine residue in a peptide or protein. Sirt5 activities, for example, the desuccinylase and demalonylase activities, can occur in vivo as a posttranslational modification of proteins containing succinylated or malonylated lysines, resulting in the generation of downstream physiological events.

[0030] As used herein, the term Sirt5 inhibitor includes molecules that achieves inhibition of Sirt5, such as a nucleic acid molecule which reduces the level or inhibits the activity of a Sirt5 mRNA, an oligopeptide, a small molecule inhibitory compound, an aptamer, and an antibody that specifically binds the Sirt5 protein, such that an enzymatic activity of Sirt5 (for example, NAD-dependent desuccinylation and demalonylation activities) is effectively suppressed or reduced in the cells being treated. A reduction is considered significant, for example, if the reduction is at least about 20%, and in some embodiments at least about 30%, 40% or 50%, and in other embodiments at least about 70%, 80%, 90% or greater. Sirt5 inhibitors are preferable Sirt5-specific inhibitors, i.e., which inhibit Sirt5 without significantly affecting other sirtuins.

[0031] In one embodiment, the cancer therapeutic method employs a Sirt5 inhibitor that is a nucleic acid molecule. Such nucleic acid molecule includes an antisense RNA, a siRNA, a miRNA (or microRNA), or a transgene which codes for and is capable of expressing any such RNA molecule in the target tissue of a recipient. An antisense RNA is an RNA molecule that is complementary to endogenous mRNA and blocks translation from the endogenous mRNA by forming a duplex with the endogenous mRNA. An antisense RNA should be at least about 10 nucleotides, preferably, at least about 15 or 17 nucleotides, more preferably, at least about 50 nucleotides. siRNAs are small (typically 20-25 nucleotides in length) double-stranded RNAs which are known to be involved in the RNA interference pathway and interfere with the expression of a specific gene. Given the sequence of a target gene, siRNAs can be designed, and made either synthetically or in cells from an exogenously introduced vector (e.g., a plasmid) to achieve suppression of expression of a gene of interest. Similar to siRNAs, miRNAs are also small RNA molecules (generally about 21-22 nucleotides) that regulate gene expression. miRNAs are processed from long precursors transcribed from non-protein-encoding genes, and interrupt translation through imprecise base-pairing with target mRNAs. miRNA can be designed and introduced to cells or tissues to target and suppress the expression of a gene of interest using techniques documented in the art.

[0032] In some embodiments, the Sirt5 inhibitor is a Sirt5 siRNA molecule. The effectiveness of an siRNA molecule can be tested and confirmed in cultured cells prior to use in a cancer recipient, to determine whether a Sirt5 mRNA has been silenced or the Sirt5 gene has been knocked down, as illustrated in Example 1 below. Illustrative examples of Sirt5 siRNA molecules include:

TABLE-US-00001 siRNA1 (SEQIDNO:3) 5-CCAGCGUCCACACGAAACCAGAUUU-3 (SEQIDNO:4) 5-AAAUCUGGUUUCUGGGUGACGCUGG-3 siRNA2 (SEQIDNO:5) 5-CCAAGUCGAUUGAUUUCCCAGCUAU-3 (SEQIDNO:6) 5-AUAGCUGGGAAAUCAAUCGACUUGG-3 siRNA3 (SEQIDNO:7) 5-UGCAAAAGCAAAGCACAUAGUCAUC-3 (SEQIDNO:8) 5-GAUGACUAUGUGCUUUGCUUUUGCA-3 siRNA4 (SEQIDNO:9) 5-ACCCGUCCCGGGUGUGGGAGUUCUA-3 (SEQIDNO:10) 5-UAGAACUCCCACACCCGGGACGGGU-3 siRNA5 (SEQIDNO:11) 5-CUCGAUGUACCUCUUGUGGAGUUGU-3 (SEQIDNO:12) 5-ACAACUCCACAAGAGGUACAUCGAG-3 siRNA6 (SEQIDNO:13) 5-AAACUUCCCCGGUGUGAAGAGGCAG-3 (SEQIDNO:14) 5-CUGCCUCUUCACACCGGGGAAGUUU-3

[0033] A nucleic acid Sirt5 inhibitor molecule such as an antisense RNA, siRNA, or miRNA, can be delivered directly to the target tissue of a recipient. Successful delivery of siRNAs, including in clinical settings, has been documented in the art (Paddison et al., Proc Natl Acad Sci USA 99(3): 1443-1448 (2002), Sah, Life Sci 79 (19): 1773-1780 (2006), Zender et al., Proc Natl Acad Sci USA 100(13): 7797-802 (2003)). Alternatively, an inhibitory RNA molecule can be expressed from a vector carrying a transgene which codes for such RNA molecule, which vector is delivered to the target tissue of a recipient. Suitable vectors include any vectors useful for gene therapy, for example, plasmids, cosmids, viruses (bacteriophage, animal viruses, and plant viruses), and artificial chromosomes (e.g., YACs). Viral vectors include e.g., retroviral vectors (e.g. derived from Moloney murine leukemia virus vectors (MoMLV), MSCV, SFFV, MPSV, SNV etc), lentiviral vectors (e.g. derived from HIV-1, HIV-2, SIV, BIV, FIV etc.), adenoviral (Ad) vectors, adeno-associated viral (AAV) vectors, simian virus 40 (SV-40) vectors, bovine papilloma virus vectors. Epstein-Barr virus vectors, herpes virus vectors, vaccinia virus vectors, Harvey murine sarcoma virus vectors, murine mammary tumor virus vectors, and Rous sarcoma virus vectors.

[0034] In other embodiments, the cancer therapy method utilizes a thiosuccinyl or a thiomalonyl peptide. Thiosuccinyl or thiomalonyl peptides can inhibit Sirt5 desuccinylase and demalonylase activities by forming a stalled covalent intermediate. These peptides can undergo the first step of the Sirt5-catalyzed reaction, forming a covalent intermediate which cannot proceed further. Because other sirtuins do not recognize malonyl and succinyl lysine peptides, thiomalonyl and thiosuccinyl peptides are Sirt5-specific inhibitors.

[0035] In specific embodiments, the Sirt5 inhibitor is a small molecule compound. As used herein, small molecules include organic compounds, organometallic compounds, salts of organic and organometallic compounds, saccharides, amino acids, and nucleotides. Small molecules typically have molecular weights less than approximately 1200 Daltons, in some embodiments less than 1000, 800 or even 500 Daltons. Small molecules include compounds that are found in nature as well as synthetic compounds. The compounds may be modified to enhance, for example, efficacy, stability, or pharmaceutical compatibility.

[0036] Sirt5 inhibitor compounds considered herein can be described by the following generic formula:

##STR00002##

[0037] In Formula (1), R.sub.1 is a negatively-charged (i.e., anionic) or ionizable group. Some examples of negatively-charged or ionizable groups include carboxylate (COO.sup.), carboxylic acid (COOH), thiocarboxylate (CSO.sup.), sulfonate (SO.sub.3.sup.), phosphonate (PO.sub.3.sup.2), and nitro (NO.sub.2) groups. The group R.sub.2 is selected from S, NR.sub.5, and O, wherein R.sub.5 can be a hydrogen atom (H) or a hydrocarbon group containing one to seven carbon atoms (e.g., methyl, ethyl, isopropyl, phenyl, or benzyl). The groups X.sub.0, X.sub.1, X.sub.2, X.sub.3, X.sub.4, X.sub.5, X.sub.6 and X.sub.7 are independently selected from (CH.sub.2).sub.n (wherein n represents 1, 2, or 3), NR.sub.5, O, S, or a bond, provided that at least one of X.sub.0-X.sub.4 is not a bond, and at least one of X.sub.5-X.sub.7 is not a bond. Generally, X.sub.5, X.sub.6, and X.sub.7 are CH.sub.2 groups or a bond, provided that at least one of X.sub.5-X.sub.7 is not a bond. Often, at least one, two, three, or all four of X.sub.0-X.sub.3 are CH.sub.2 groups, while X.sub.4 is selected from CH.sub.2, NR.sub.5, O, or S groups. In specific embodiments, all four of X.sub.0X.sub.3 are CH.sub.2 groups, while X.sub.4 is selected from CH.sub.2, NR.sub.5, O, or S groups, and X.sub.5-X.sub.7 are CH.sub.2 groups or a bond, provided that at least one of X.sub.5-X.sub.7 is not a bond. The groups R.sub.3 and R.sub.4 are independently selected from H, hydrocarbon (R), amino acid, dipeptide, tripeptide, oligopeptide (e.g., from 4, 5, 6, 8, 10, 12, or 15 amino acid residues up to 20, 25, 30, 35, 40, 45, or 50 amino acid residues), protein, nucleobase, nucleotide, dinucleotide, trinucleotide, oligonucleotide, monosaccharide, disaccharide, oligosaccharide, and protecting groups (e.g., tBOC or FMOC groups), or a combination thereof or modified form thereof (e.g., lipoprotein or nucleoprotein), wherein R.sub.4 may also be a OR, NHR, or NC(O)R group, and R.sub.3 may also be a C(O)R or C(O)NHR group. Generally, when R.sub.1 is carboxyl, then R.sub.2 is not O, and when R.sub.2 is O, then R.sub.1 is not carboxyl.

[0038] In particular embodiments of Formula (1), R.sub.2 is S, thus resulting in a sub-generic set of compounds of the following formula:

##STR00003##

[0039] In other particular embodiments of Formula (1), R.sub.2 is S and R.sub.1 is carboxyl, thus resulting in a sub-generic set of compounds of the following formula:

##STR00004##

[0040] In still other particular embodiments of Formula (1), R.sub.2 is S, R.sub.1 is carboxyl, and X.sub.4 is NR.sub.5, thus resulting in a sub-generic set of compounds of the following formula:

##STR00005##

[0041] In Formula (1c), X.sub.0-X.sub.3 are preferably selected from (CH.sub.2).sub.n groups (wherein n represents 1, 2, or 3) or a bond, wherein at least one of X.sub.0-X.sub.3 is not a bond; and X.sub.5-X.sub.7 are preferably CH.sub.2 groups or a bond, and at least one of X.sub.5-X.sub.7 is not a bond. In specific embodiments, all four of X.sub.0-X.sub.3 are CH.sub.2 groups, and X.sub.5-X.sub.7 are CH.sub.2 groups or a bond provided at least one of X.sub.5-X.sub.7 is not a bond.

[0042] The double-bonded group R.sub.2 in Formula (1) may alternatively be replaced with two single-bonded groups (R.sub.5 and R.sub.6), as shown in the following sub-formula:

##STR00006##

[0043] In Formula (2), R.sub.5 and R.sub.6 are independently selected from H, a hydrocarbon group (R) having one to six carbon atoms, OH, OR, SH, SR, and NHR, except that, generally, both of R.sub.5 and R.sub.6 are not selected from OH, OR, SH, SR, and NHR (i.e., if one of R.sub.5 and R.sub.6 is OH, OR, SH, SR, or NHR, then the other of R.sub.5 and R.sub.6 is H or R). In some embodiments, when one of R.sub.5 and R.sub.6 is a OH or OR group, then R.sub.1 is not a carboxyl group.

[0044] The terms hydrocarbon group and hydrocarbon linker, as used herein, are, in a first embodiment, composed solely of carbon and hydrogen. In different embodiments, one or more of the hydrocarbon groups or linkers can contain precisely, or a minimum of, or a maximum of, for example, one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, or eighteen carbon atoms, or a particular range of carbon atoms between any of the foregoing carbon numbers.

[0045] The hydrocarbon groups or linkers can be, for example, saturated and straight-chained (i.e., straight-chained alkyl groups or alkylene linkers). Some examples of straight-chained alkyl groups (or alkylene linkers) include methyl (or methylene, i.e., CH.sub.2, or methine linkers), ethyl (or ethylene or dimethylene, i.e., CH.sub.2CH.sub.2 linkers), n-propyl, n-butyl, n-pentyl, and n-hexyl groups.

[0046] The hydrocarbon groups or linkers can alternatively be saturated and branched (i.e., branched alkyl groups or alkylene linkers). Some examples of branched alkyl groups include isopropyl, isobutyl, sec-butyl, t-butyl, isopentyl, neopentyl, 2-methylpentyl, and 3-methylpentyl. Some examples of branched alkylene linkers are those derived by removal of a hydrogen atom from one of the foregoing exemplary branched alkyl groups (e.g., isopropylene, CH(CH.sub.3)CH.sub.2).

[0047] The hydrocarbon groups or linkers can alternatively be saturated and cyclic (i.e., cycloalkyl groups or cycloalkylene linkers). Some examples of cycloalkyl groups include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, and cycloheptyl groups. The cycloalkyl group can also be a polycyclic (e.g., bicyclic) group by either possessing a bond between two ring groups (e.g., dicyclohexyl) or a shared (i.e., fused) side (e.g., decalin and norbornane). Some examples of cycloalkylene linkers are those derived by removal of a hydrogen atom from one of the foregoing exemplary cycloalkyl groups.

[0048] The hydrocarbon groups or linkers can alternatively be unsaturated and straight-chained (i.e., straight-chained olefinic or alkenyl groups or linkers). The unsaturation occurs by the presence of one or more carbon-carbon double bonds and/or one or more carbon-carbon triple bonds. Some examples of straight-chained olefinic groups include vinyl, 2-propen-1-yl (allyl), 3-buten-1-yl, 2-buten-1-yl, butadienyl, 4-penten-1-yl, 3-penten-1-yl, 2-penten-1-yl, 2,4-pentadien-1-yl, 5-hexen-1-yl, 4-hexen-1-yl, 3-hexen-1-yl, 3,5-hexadien-1-yl, 1,3,5-hexatrien-1-yl, 6-hepten-1-yl, ethynyl, and propargyl (2-propynyl). Some examples of straight-chained olefinic linkers are those derived by removal of a hydrogen atom from one of the foregoing exemplary straight-chained olefinic groups (e.g., vinylene, CHCH, or vinylidene).

[0049] The hydrocarbon groups or linkers can alternatively be unsaturated and branched (i.e., branched olefinic or alkenyl groups or linkers). Some examples of branched olefinic groups include 2-propen-2-yl, 3-buten-2-yl, 3-buten-3-yl, 4-penten-2-yl, 4-penten-3-yl, 3-penten-2-yl, 3-penten-3-yl, and 2,4-pentadien-3-yl. Some examples of branched olefinic linkers are those derived by removal of a hydrogen atom from one of the foregoing exemplary branched olefinic groups.

[0050] The hydrocarbon groups or linkers can alternatively be unsaturated and cyclic (i.e., cycloalkenyl groups or cycloalkenylene linkers). Some examples of unsaturated and cyclic hydrocarbon groups include cyclopropenyl, cyclobutenyl, cyclopentenyl, cyclopentadienyl, cyclohexenyl, cyclohexadienyl, phenyl, and benzyl. The unsaturated cyclic hydrocarbon group can also be a polycyclic (e.g., bicyclic) group by either possessing a bond between two of the ring groups (e.g., biphenyl) or a shared (i.e., fused) side (e.g., naphthalene, anthracene, phenanthrene, phenalene, and indene). Some examples of cycloalkenylene linkers are those derived by removal of a hydrogen atom from one of the foregoing exemplary cycloalkenyl groups (e.g., phenylene and biphenylene).

[0051] In some embodiments, one or more of the hydrocarbon groups or linkers may also include one or more heteroatoms (i.e., non-carbon and non-hydrogen atoms), such as one or more heteroatoms selected from oxygen, nitrogen, sulfur, halide, and phosphorus atoms. Some examples of oxygen-containing groups include hydroxyl (OH) groups, carbonyl groups (e.g., ketone, aldehyde, ester, amide, or urea functionalities), and carbon-oxygen-carbon (ether) groups. The ether group can also be a polyalkyleneoxide group, such as a polyethyleneoxide group. Some examples of nitrogen-containing groups include primary amine groups, secondary amine groups, tertiary amine groups, quaternary amine groups, cyanide group, amide group (i.e., C(O)NR.sub.2, wherein R is independently selected from hydrogen atom and hydrocarbon group, as described above), nitro group, urea group, imino group, and carbamate group, wherein it is understood that a quaternary amine group necessarily possesses a positive charge and requires a counteranion. Some examples of sulfur-containing groups include mercapto (i.e., SH), thioether (i.e., sulfide), disulfide, sulfoxide, sulfone, sulfonate, and sulfate groups. Halide atoms considered herein include fluorine, chlorine, and bromine.

[0052] In a specific embodiment, the candidate compound is a thiosuccinyl compound. In a particular embodiment, the candidate compound is H3K9 thiosuccinyl (H3K9 TSu) peptide, represented by the sequence KQTAR(TSuK)STGGKA (SEQ ID NO: 15).

[0053] The synthesis of the inhibitor compounds described above relies on established and well-known methodologies of the art. For example, the coupling of malonate and succinylate to lysine side chains can be accomplished using well known reaction conditions for the preparation of amides from amines and carboxylic acids. The conversion of a carbonyl oxygen atom (e.g., R.sub.2) to a thiocarbonyl can be accomplished by, for example, reaction with Lawensson reagent by methods well known in the art.

[0054] The effectiveness of a Sirt5 inhibitory compound can be tested and confirmed in in vitro assays, including, for example, the assay described in WO2012/006391A2 (incorporated herein by reference). Essentially, the assay is based on the use of a substrate containing a malonyl, succinyl or glutaryl lysine, linked to an indicator moiety (a fluorescent moiety). The linkage between the lysine and the indicator moiety can be severed by a cleavage agent (such as a protease, e.g., trypsin) which is sensitive to the state of malonylation, succinylation or glutarylation of the lysine residue. Thus, when the substrate is contacted with Sirt5 under conditions for Sirt5 to demalonylate, desuccinylate or deglutarylate the substrate, the removal of the acyl group (possibly leading to the exposure of the cleavage site) permits the cleavage agent to act on the cleavage site and releases the indicator moiety, which then generates a detectable signal (fluorescence). The presence of a Sirt5 inhibitor compound would reduce the amount of signal detected.

[0055] In another embodiment, the Sirt5 inhibitor is an aptamer that binds specifically to the Sirt5 protein and blocks the Sirt5 protein from interacting with its substrates. Aptamers are molecules, either nucleic acid or peptide, that bind to a specific target molecule. Nucleic acid aptamers are generally short strands of DNA or RNA that have been engineered through repeated rounds of in vitro selection known as SELEX (systematic evolution of ligands by exponential enrichment) to bind to various molecular targets. Peptide aptamers can be selected using various systems, most frequently through the yeast two hybrid system. Peptide aptamers generally consist of a variable peptide loop (typically composed of ten to twenty amino acids), attached at both ends to a protein scaffold. This double structural constraint greatly increases the binding affinity of the peptide aptamer to levels comparable to an antibody.

[0056] In other embodiments, the Sirt5 inhibitor is an anti-Sirt5 antibody that specifically binds to and blocks the Sirt5 protein from interacting with its substrates. Both monoclonal antibodies and polyclonal antibodies are suitable for use in the cancer treatment method of this invention.

[0057] Any of the Sirt5-inhibitors described herein, including nucleic acid inhibitors and small molecule inhibitors, can be made or modified to have improved properties for administration to a mammalian subject, e.g., to improve stability, cell penetrating ability, among others. For example, to enhance cell permeability of the substrate, the peptide chain can include a string of multiple amino acids (such as 8-10 arginine residues).

[0058] Sirt5 inhibitors described herein may be formulated in a conventional manner using one or more physiologically or pharmaceutically acceptable carriers or excipients. Examples of carriers include fats, oils, water, saline solutions, lipids, liposomes, resins, binders, fillers and the like, or combinations thereof. For example, Sirt5 inhibitory compounds and their physiologically acceptable salts and solvates may be formulated for administration by, for example, injection (e.g. SubQ, IM, IP, IV), inhalation or insufflation (either through the mouth or the nose), or oral, buccal, sublingual, transdermal, nasal, parenteral or rectal administration. In one embodiment, a Sirt5 inhibitory compound may be administered locally, at the site where the target cancerous cells are present, i.e., in a specific tissue, organ, or fluid (e.g., blood, cerebrospinal fluid, etc.). Sirt5 inhibitory compounds can be formulated for a variety of modes of administration, including systemic and topical or localized administration. Techniques and formulations generally may be found in Remington's Pharmaceutical Sciences, Meade Publishing Co., Easton, Pa.

[0059] In a specific embodiment, a Sirt5 inhibitor is designed and prepared to achieve mitochondria-specific delivery. Sirt5 is known to be mainly localized in mitochondria. Thus, mitochondrial targeting of Sirt5 inhibitors can have improved efficiency in inhibiting Sirt5. It has been shown that a triphenylphosphonium cation can facilitate the targeting of small molecules and liposomes to mitochondria (see, e.g., Smith et al., PNAS 100: 5407-5412 (2003); Boddapati et al., Nano Lett 2008 August; 8(8):2559-63, Epub 2008 Jul. 9). For example, a triphenylphosphonium cation can be introduced into the structures of the inhibitors, which temporarily masks the negative charge on the inhibitors. Two specific examples using a thiosuccinyllysine peptide are shown in FIG. 6. In one example, the negative charge of thiosuccinyl is masked by forming a hexyl ester while the TPP cation is attached to the C-terminal of the peptide. In the other example, the masking of the negative charge and the introduction of TPP cation is achieved at the same time. The ester bond can be slowly hydrolyzed inside the cells, thus releasing the active Sirt5 inhibitor in the mitochondria.

[0060] Pharmaceutical compositions may comprise from about 0.00001 to 100% such as from 0.001 to 10% or from 0.1% to 5% by weight of one or more Sirt5-inhibitory compounds described herein. In certain topical formulations, the active agent is present in an amount in the range of approximately 0.25 wt. % to 75 wt. % of the formulation, preferably in the range of approximately 0.25 wt. % to 30 wt. % of the formulation, more preferably in the range of approximately 0.5 wt. % to 15 wt. % of the formulation, and most preferably in the range of approximately 1.0 wt. % to 10 wt. % of the formulation.

[0061] Toxicity and therapeutic efficacy of Sirt5-inhibitory compounds can be determined by standard pharmaceutical procedures in cell cultures or experimental animals. The LD.sub.50 is the dose lethal to 50% of the population. The dose ratio between toxic and therapeutic effects (LD.sub.50/ED.sub.50) is the therapeutic index. Sirt5 inhibitors that exhibit large therapeutic indexes are preferred. While Sirt5 inhibitors that exhibit toxic side effects may be used, care should be taken to design a delivery system that targets such compounds to the site of affected tissue in order to minimize potential damage to uninfected cells and, thereby, reduce side effects.

[0062] The data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage for use in humans. The dosage of such compounds may lie within a range of circulating concentrations that include the ED.sub.50 with little or no toxicity. The dosage may vary within this range depending upon the dosage form employed and the route of administration utilized. For any compound, the therapeutically effective dose can be estimated initially from cell culture assays. A dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC.sub.50 as determined in cell culture. Such information can be used to more accurately determine useful doses in humans. Levels in plasma may be measured, for example, by high performance liquid chromatography.

[0063] While the precise dosage of an inhibitor to be therapeutically effective can be determined by the skilled artisan, as a general rule, the therapeutically effective dosage of an inhibitor can be in the range of about 0.5 g to about 2 grams per unit dosage form. A unit dosage form refers to physically discrete units suited as unitary dosages for mammalian treatment: each unit containing a pre determined quantity of the active material calculated to produce the desired therapeutic effect in association with any required pharmaceutical carrier. The methods of the present invention contemplate single as well as multiple administrations, given either simultaneously or over an extended period of time.

[0064] The present description is further illustrated by the following examples, which should not be construed as limiting in any way. The contents of all cited references (including literature references, issued patents, and published patent applications as cited throughout this application) are hereby expressly incorporated by reference.

Example-1

[0065] This Example describes experiments performed to examine whether Sirt5 is important for the malignant state of cancer cells.

[0066] The inventors verified that Sirt5 was highly and specifically expressed in the mitochondria of a number of different cancer cell lines, including human breast cancer cells (SKBR3 and MDAMB231 cells), human pancreatic cancer cells (MIA-PaCA and PaNC1 cells), human glioblastoma (U87) cells, and human lung cancer (A549) cells (FIG. 2).

[0067] Two different short interfering RNA molecules were designed based on a Sirt5 variant cDNA sequence (SEQ ID NO: 1).

TABLE-US-00002 siRNA1 (SEQIDNO:3) 5-CCAGCGUCCACACGAAACCAGAUUU-3 (SEQIDNO:4) 5-AAAUCUGGUUUCUGGGUGACGCUGG-3 siRNA2 (SEQIDNO:5) 5-CCAAGUCGAUUGAUUUCCCAGCUAU-3 (SEQIDNO:6) 5-AUAGCUGGGAAAUCAAUCGACUUGG-3

[0068] Knockdown of Sirt5 using each siRNA molecule was confirmed in RT-PCR (FIG. 3A), which resulted in inhibition of the transformed phenotype of cancer cells (monitored using soft agar assay to monitor the anchorage-independent growth, FIG. 3B). This was tested in several cancer cell lines, including a breast cancer cell line (SKBR3) and a brain cancer cell line (U87). A serum limitation assay (to examine the growth factor-independent proliferation of cells, FIG. 3C) also demonstrated that knockdown of Sirt5 significantly inhibited the transformed phenotype of cancerous cells. Furthermore, the inhibition of cell proliferation and growth was selective to cancer cells, as the growth of MCF10A cells (normal cells), was not significantly affected by Sirt5 knockdown (FIG. 3C). In contrast, knockdown of Sirt1 had no obvious effect on the anchorage-independent growth of SKBR3 cells (FIG. 3D), even though Western blot showed successful knockdown of Sirt1.

Example-2

[0069] The inventors then examined whether knock-downs of Sirt5 might affect the activation of GLS1 in cancer cells. GLS1 is an enzyme at a key regulatory node in one of the two major chain of events that represent the metabolic changes accompanying malignant transformation. The first of these changes is the acceleration of various steps in the glycolytic pathway, which fall under the umbrella term of the Warburg effect. A key outcome of these changes is that the normal product of the glycolytic pathway, pyruvate, is predominantly converted to lactic acid, rather than being converted to acetyl-CoA and ultimately to citrate to kick-start the citric acid cycle in the mitochondria. Because cancer cells use components from the citric acid cycle for various biosynthetic processes, and since the normal input into this cycle via pyruvate from the glycolytic pathway has been largely eliminated due to the Warburg effect, cancer cells require alternative inputs. One way in which this is achieved is through elevated glutamine metabolism, specifically, through the accelerated conversion of glutamine to glutamate via GLS1, followed by the production of -ketoglutarate from glutamate as catalyzed by glutamate dehydrogenase (GDH) (FIG. 4).

[0070] The basal GLS1 activity in cancer cells reflects the activation of the enzyme, as non-transformed cells show little or no detectable basal enzyme activity, as is also the case when assaying purified recombinant GLS1 (Wang et al., Cancer Cell 18: 207-209 (2010)). It had been previously shown that the MDAMB231 breast cancer cell line exhibits high levels of basal GLS1 activity. However, as shown in FIG. 5, the siRNA-mediated knock-down of Sirt5 expression was accompanied by a corresponding reduction in the basal GLS1 activity, whereas the levels of GLS1 was essentially not affected when directly assaying GLS1 by adding 100 mM inorganic phosphate. On the other hand, knock-downs of Sirt4, which is also in the mitochondria and has been suggested to regulate GDH activity, resulted in no significant changes in the basal GLS1 activity (not shown).

TABLE-US-00003 Sirt5completeCDs(SEQIDNO:1),withnucleotides274...1206 representingthecodingregion. 1cgcctctaggagaaagcctggaacgcgtaccggagggtaccagagctcttagcgggccgg 61cagcatgtgcggggccaagtaaatggaaatgttttctaacatataaaaacctacagaaga 121agaaaataattttctggatcaaattagaagtctgtattatattgatgtctccagattcaa 181atatattagaaagcagccgtggagacaaccatcttcattttgggagaaataactaaagcc 241cgcctcaagcattagaactacagacaaaccctgatgcgacctctccagattgtcccaagt 301cgattgatttcccagctatattgtggcctgaagcctccagcgtccacacgaaaccagatt 361tgcctgaaaatggctcggccaagttcaagtatggcagattttcgaaagttttttgcaaaa 421gcaaagcacatagtcatcatctcaggagctggtgttagtgcagaaagtggtgttccgacc 481ttcagaggagctggaggttattggagaaaatggcaagcccaggacctggcgactcccctg 541gcctttgcccacaacccgtcccgggtgtgggagttctaccactaccggcgggaggtcatg 601gggagcaaggagcccaacgccgggcaccgcgccatagccgagtgtgagacccggctgggc 661aagcagggccggcgagtcgtggtcatcacccagaacatcgatgagctgcaccgcaaggct 721ggcaccaagaaccttctggagatccatggtagcttatttaaaactcgatgtacctcttgt 781ggagttgtggctgagaattacaagagtccaatttgtccagctttatcaggaaaaggtgct 841ccagaacctggaactcaagatgccagcatcccagttgagaaacttccccggtgtgaagag 901gcaggctgcgggggcttgctgcgacctcacgtcgtgtggtttggagaaaacctggatcct 961gccattctggaggaggttgacagagagctcgcccactgtgatttatgtctagtggtgggc 1021acttcctctgtggtgtacccagcaaccatgtttgccccccaggtggctgccaggggcgtg 1081ccagtggctgaatttaacacggagaccaccccagctacgaacagattcaggtttcatttc 1141cagggaccctgtggaacgactcttcctgaagcccttgcctgtcatgaaaatgaaactgtt 1201tcttaagtgtcctggggaagaaagaaattacagtatatctaagaactaggccacacgcag 1261aggagaaatggtcttatgggtggtgagctgagtactgaacaatctaaaaatagcctctga 1321ttccctcgctggaatccaacctgttgataagtgatgggggtttagaagtagcaaagagca 1381cccacattcaaaagtcacagaactggaaagttaattcatattatttggtttgaactgaaa 1441cgtgaggtatctttgatgtgtatggttggttattgggagggaaaaattttgtaaattaga 1501ttgtctaaaaaaaatagttattctgattatatttttgttatctgggcaaagtagaagtca 1561aggggtaaaaaccctactattctgatttttgcacaagttttagtggaaaataaaatcaca 1621ctctacagtaggt Sirt5Proteinsequence(SEQIDNO:2) MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTF RGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRV VVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPR CEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAE FNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS