Treating conditions associated with sepsis
10429385 ยท 2019-10-01
Assignee
Inventors
Cpc classification
G01N2333/70596
PHYSICS
G01N33/566
PHYSICS
International classification
A61K39/00
HUMAN NECESSITIES
A61K39/395
HUMAN NECESSITIES
G01N33/566
PHYSICS
A61M37/00
HUMAN NECESSITIES
Abstract
A method for treating sepsis and/or respiratory distress syndrome (RDS) comprises applying peripheral blood from a patient or subject to an apheresis column loaded with a solid support comprising one or more binding reagents capable of specifically binding to a chemokine receptor, optionally the chemokine receptor CCR5, CXCR1, CXCR2, and/or CCR2 immobilized directly or indirectly on the support thus removing one or more chemokine receptor, optionally CCR5, CXCR1, CXCR2, and/or CCR2 expressing cells from the peripheral blood of the patient or subject. Various companion therapeutic methods and useful binding reagents are also described.
Claims
1. A method for treating sepsis in a subject in need thereof, which comprises applying peripheral blood from the subject to an apheresis column loaded with a solid support comprising one or more binding reagents capable of specifically binding to a chemokine CXCR1 receptor immobilized directly or indirectly on the support, whereby one or more cells expressing chemokine receptor CXCR1 are removed from the peripheral blood of the subject, wherein the applied blood is recirculated back into the systemic circulation of the subject, and whereby the sepsis is treated.
2. The method of claim 1, wherein the sepsis is a systemic inflammation syndrome or causes multiple organ dysfunction syndrome.
3. The method of claim 1, wherein the binding reagent is an agonist or an antagonist of CXCR1.
4. The method of claim 1, wherein the binding reagent is an antibody or a chemokine.
5. The method of claim 4, wherein the chemokine is selected from CXCL6, CXCL8.
6. The method of claim 1, wherein the one or more cells are monocytes, macrophages, or neutrophils.
7. The method of claim 1, wherein the subject has increased levels of expression of CXCR1 as compared to a subject that does not have sepsis.
8. The method of claim 1, wherein 20-50% of the subject's blood is applied to the column in a single treatment.
Description
DESCRIPTION OF THE FIGURES
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
DESCRIPTION OF PREFERRED EMBODIMENTS
(25) Sepsis is defined as a systemic inflammation syndrome (SIRS) in response to an infection. If not successfully treated, it may lead to the potentially lethal Multiple Organ Dysfunction Syndrome. Thus, the invention may be aimed at treating SIRS and/or Multiple Organ Dysfunction Syndrome. In short, increased vascular permeability due to released inflammatory cytokines leads to decreased blood pressure. As a consequence, there is insufficient circulation in important organs such as kidneys and lungs, which may lead to organ dysfunction.
(26) The exact cellular mechanism of the progress of SIRS is still unknown, but it has been shown that neutrophils show impaired migrational capacity into infected tissue in patients suffering from sepsis. The neutrophils act as the first line of defense against invading pathogens. If neutrophils cannot efficiently migrate into infected tissue the infection will persists which contributes to the systemic inflammation response.
(27) In addition, in a later stage of SIRS, activated neutrophils migrate in to healthy tissue in remote organs (not affected by the infection) causing tissue destruction.
(28) The combination of organ dysfunction and tissue destruction may be fatal for the patient. Factors causing increased vascular permeability:
(29) Proinflammatory molecules such interleukin1-beta, interleukin 6 and tumor necrosing factor-alpha, released by macrophages in the liver and the spleen and granulas released by mast cells.
(30) Role of MCP-1/CCL2 and the CCR2 receptor in sepsis Neutrophils stimulated by bacterial antigen lipopolysaccharide through Toll-Like Receptors upregulate MCP-1 receptor CCR2. Neutrophils do not normally express CCR2. Interestingly, migration of neutrophils into healthy tissue is mediated through CCR2.
(31) It has been shown that CCR2 plays an important role in the recruitment of neutrophils in a variety of models of inflammation in addition it has been shown that a CCR2 antagonist reduces the severity of acute lung injury.
(32) It may be possible to protect the patient from tissue destruction in remote organs by removing activated neutrophils through the MCP-1/CCR2 interaction.
(33) Chemokine receptor-Chemokine pairs of relevance to the present invention thus include:
(34) CCR2-MCP-1
(35) CXCL1, CXCL2, CXCL3, CXCL5, CXCL6, CXCL7 and CXCL8-CXCR2 CXCL8-CXCR1
(36) CCR5-CCL5, CCL3, CCL8
(37) The invention may also be directed to treating RDS, including but not limited to sepsis-associated RDS. The RDS treated according to the invention is typically acute respiratory distress syndrome (ARDS). Three clinical settings account for 75% of ARDS cases: sepsis, severe multiple trauma and aspiration of saliva/gastric contents. Sepsis is the most common cause of ARDS (referred to herein as sepsis-associated RDS). Some cases of ARDS are linked to large volumes of fluid used during resuscitation post trauma. Other causes include shock, near-drowning, multiple transfusions and inhalation of irritants or toxic fumes that damage the alveolar epithelium. It is shown herein that patients suffering from respiratory distress syndrome (RDS) exhibit an increase in circulating neutrophils compared to healthy controls. The neutrophils express characteristic chemokine receptors including CXCR1, CXCR2 and CCR5. This provides a therapeutic approach to treat this condition, by removal of CXCR1, CXCR2 and/or CCR5 expressing cells using a suitable binding reagent. Moreover, it is also shown herein that CCR5 expressing neutrophils are highly increased in bronchoalveolar lavage fluid (BALF) in patients suffering from RDS. Thus, the invention may be applied to treat sepsis and/or RDS, including but not limited to sepsis-associated RDS.
EXAMPLES
(38) Materials and Methods
(39) Isolation of peripheral blood leukocytes. Heparinized peripheral blood from healthy blood donors or inflammatory bowel disease (IBD) patients was fixed with 4% paraformaldehyde for 4 minutes, hemolyzed for 15 minutes with a 0.83% ammonium chloride solution and washed twice in FACS buffer to obtain a suspension of blood leukocytes.
(40) Chemokines. The leukocytes were incubated for 30 min in the dark at 4 C. with biotinylated and Alexa647 Fluor labelled MCP-1 or IL-8 (in concentrations 10 ng/L and 50 ng/L). The cells were then washed with FACS-buffer and analyzed by flow cytometry. All chemokines used in the Examples were provided by Almac Sciences Scotland Ltd, Edinburgh, Scotland.
(41) Flow cytometry assay. The flow cytometry assay was performed on a two laser FACS Calibur cytometer (BD Immunocytometry systems, San Jos, Calif., USA). Ten thousand cells were counted and analysed in each sample. For data analyses, Cell Quest Pro software from Becton Dickinson was used.
Example 1
(42) Binding of monocytes to MCP-1. In the experiment with biotinylated MCP-1 it was found that about 90% of the monocytes obtained from peripheral blood of healthy donors had bound to the cytokine after 30 min of incubation (
Example 2
(43) Affinity of blood cells to biotinylated IL-8. In
Example 3
(44) Monocytes were investigated for their expression of CCR2 (
Example 4Tailored Leukapheresis
(45) Column Design and Properties
(46) Introduction
(47) Apheresis is an established treatment used for depletion of blood components, such as antibodies, low-density lipoproteins (LDL) and blood cells. Leukapheresis is the apheresis treatment used for removal of white blood cells, leukocytes. The patient is connected to an extracorporeal blood circulating system; the blood is drawn from a vein in one arm, passed through a column device and returned into the other arm of the patient. Side effects of leukapheresis treatments are varying from mild events like headache, dizziness, hypotension, palpitation and flush seen in 0.1 to 5% of treated patients.
(48) The Column
(49) The column is intended to be used as a leukapheresis treatment for sepsis. It will specifically remove CCR2, CXCR1, CXCR2 and/or CCR5-expressing leukocytes, in particular monocytes, through the use of a binding reagent, more specifically an MCP-1, MCP-2, MCP-3, MCP-4, MCP-5 and/or CXCL8 containing resin or a CCL5, CCL3 or CCL8 containing resin, exploiting the CCR2, CXCR1, CXCR2 and/or CCR5-chemokine interaction. The column consists of three combined components, the plastic house, the streptavidin (SA) Sepharose BigBeads matrix and one or more of biotinylated MCP-1, MCP-2, MCP-3, MCP-4, MCP-5, CXCL8, CCL5, CCL3 or CCL8 bound to the matrix. The treatment is conducted using the same techniques as a standard apheresis procedure.
(50) The Plastic House (
(51) The plastic house, designed to keep a continuous blood flow through the matrix, consists of a transparent body and red-coloured top. The top has a distribution plate (2) at the inflow site (1) to spread the blood evenly over the entire matrix area. The plate is the first safety barrier preventing larger particles flowing through the column and into the patient. Safety filter units (3 and 4) are placed at the inflow (1) and outflow (5) sites of the plastic housing. The safety filter unit contains three filters designed to be a robust barrier and stop all particles larger than blood cells passing through the column. The plastic housing design is shown in
(52) Streptavidin Sepharose BigBeads
(53) The second component in the device is the affinity matrix called streptavidin Sepharose BigBeads (Sepharose GE Healthcare, Sweden). Sepharose is a cross linked, beaded-form of agarose, which is a polysaccharide extracted from seaweed. Sepharose and agarose are commonly used as column matrices in biomedical affinity techniques. It is chosen for its optimal distribution capacity and can provide a large available area for affinity binding.
(54) Binding Reagent
(55) Coupled to the matrix is the third component of the device, one or more binding reagents that bind specifically to CCR2, CXCR1, CXCR2 and/or CCR5. One or more chemokines selected from the group consisting of: MCP-1, MCP-2, MCP-3, MCP-4, MCP-5 and CXCL8 may be employed and/or CXCL1, CXCL2, CXCL3, CXCL5, CXCL6, CXCL7 and CXCL8 or CCL5, CCL3 or CCL8 (bind CCR5). These peptides may be synthetic, engineered versions of the human chemokine, which are truncated and biotinylated, but retain binding activity to the CCR2, CXCR1, CXCR2 and/or CCR5 receptor. By biotinylating the engineered chemokine, it is able to bind to the streptavidin molecules in the Sepharose matrix. The biotin-streptavidin binding is known be one of the strongest biological interactions with a Kd in the order of 410.sup.14 M. The calculated ratio of streptavidin:biotin binding sites in the column is 10:1. Therefore, the coupling between the matrix and chemokine will be immediate, minimising the risk of chemokine decoupling from the matrix.
(56) The Apheresis System
(57) To conduct the leukapheresis the following components are needed; the column, tubing system, and a 4008 ADS pump (Fresenius Medical Care).
(58) The Circuit
(59) The system is illustrated in
(60) The 4008 ADS Pump
(61) An apheresis pump, from Fresenius Medical Care, monitors the patient's inflow and outflow, the pressure in the extracorporeal circulation and can discriminate air by a bubble catcher and air detector. A clot catcher filter is placed inside the bubble catcher. The pump also has an optical detector to distinguish between light, e.g. saline solution or air present in the tubing system and dark e.g. blood present in the tubing system.
(62) A schematic diagram of the pump, showing the air detector and optical filter is shown in
(63) Legend for
(64) Preparation of the Patient
(65) The patient will be administered anticoagulants prior to each treatment session. A sterile saline solution with 5000 IE Heparin will be used for priming the extracorporeal system, thereafter a bolus injection with 4000 IE Heparin will be added into the circuit at the start of each treatment session.
(66) Leukapheresis Time and Flow Rate
(67) The apheresis system should be operated at a flow rate of 30-60 ml/min. A treatment is finalised after 1800 mL of blood has been circulated.
(68) Storage Conditions
(69) The column devices should be stored between 1 and 25 C. avoiding freezing and more elevated temperatures. Stability data >3 months indicate no difference in functionality over time or by temperature (room temperature and refrigerated). The columns will be kept in refrigerated conditions until use. Mechanical damage as those resulting from violent vibrations and trauma should be avoided. Column stored outside of these recommendations should not be used.
(70) Transport Conditions
(71) The column devices will be transported under refrigerated condition, avoiding freezing and more elevated temperatures. Mechanical damage such as those resulting from violent vibrations and trauma should be avoided.
(72) In-Vitro Depletion of Target Cell Populations
(73) To investigate the ability to eliminate CCR2-expressing cells, in vitro tests have been performed on the bMCP-1 coupled matrix. Blood was collected from blood donors and passed through the column device containing bMCP-1 coupled matrix. Blood samples were taken before and after column passage and analyzed by flow cytometry (FACS) for the depletion of CCR2-expressing cells.
(74) The results demonstrate significant depletion of the target population CCR2-expressing monocytes post matrix perfusion. Depletion tests were performed on blood from three healthy donors. The results are shown in
(75) The in-vitro results demonstrate a specific reduction of up to 80% of the CCR2-expressing cells by the column. Notably, individuals with fewer CCR2 expressing cells initially achieved lower depletion. The remaining levels of monocytes were around 20-30% in each case, irrespective of the starting point. Non-CCR2-expressing cells remained unaffected (data not shown).
Example 5MCP1 Derivatives
(76) MCP-1 has been produced with residue 75 as the site of biotinylation on the chemokine (numbering based upon the mature protein having the amino acid sequence of SEQ ID NO: 2). Biotinylation permits immobilization of MCP-1 on a solid support (via a biotin-avidin interaction). The basic amino acid sequence of MCP-1, including a 23 amino acid leader sequence is set forth as SEQ ID NO: 1,
(77) TABLE-US-00009 MKVSAALLCL LLIAATFIPQ GLAQPDAINA PVTCCYNFTN RKISVQRLAS YRRITSSKCP KEAVIFKTIV AKEICADPKQ KWVQDSMDHL DKQTQTPKT
(78) The amino acid sequence of the mature protein is set forth as SEQ ID NO: 2,
(79) TABLE-US-00010 QPDAINA PVTCCYNFTN RKISVQRLAS YRRITSSKCP KEAVIFKTIV AKEICADPKQ KWVQDSXDHL DKQTQTPKT
(80) X=Met or Nleu
(81) The inventors have determined that chemokines may display improved binding properties where the chemokine is biotinylated via a spacer group. The spacer may prevent the biotin group from impacting on the binding affinity of the chemokine.
(82) Thus, MCP-1 derivatised at the -amino side chain functionality of Lys75 with PEG-Biotin (TFA salt) will be synthesised. The PEG spacer will be 3,6,-dioxoaminooctanoic acid. The Gln at the N-terminus of the proteins is subject to pyroGlu formation under physiological conditions. Thus the first glutamine (Gln1) of the sequence will be substituted with pyroglutamine. The molecule will be synthesised as a C-terminal amide (via synthesis on an amide linker). The molecule is shown schematically in
(83) A biotinMCP-1 Met to Nleu analogue will also be synthesised. The single methionine within the sequence will be altered to Norleucine, to mitigate against oxidation of this residue during the chain assembly and improve stability of the final product. This molecule is shown schematically in
(84) Once synthesised, the activity of the various biotinMCP-1 derivatives will be determined in cell-based assays. In particular, agonist and antagonist properties will be determined in aequorin functional cell-based assay on human CCR2 receptor.
Example 6Synthesis of a CCR2 Antagonist BiotinMCP-1 which Binds to the Receptor Without Activation
(85) Antagonist Activity (J-H Gong and I. Clark-Lewis, J. Exp. Med., 1995, 181, 63) has been shown for an MCP-1 derivative truncated at the N-terminus. In particular, deletion of residues 1-8, results in binding to CCR2 with Kd 8.3 nM. This protein was unable to cause chemotaxis of CCR2 positive cells. (inhibition of chemotaxis IC50 20 nM)
(86) The amino acid sequence of the truncated version is set forth as SEQ ID NO:3:
(87) TABLE-US-00011 VTCCYNFTN RKISVQRLAS YRRITSSKCP KEAVIFKTIV AKEICADPKQ KWVQDSMDHL DKQTQTPKT
(88) A derivative of this truncated version will be synthesised comprising residues 9 to 76 of the mature protein (MCP-19-76) with Met64 to Nleu substitution and derivatised at the -amino side chain functionality of Lys75 with PEG-Biotin (TFA salt). This molecule is shown schematically in
(89) Once synthesised, the activity of the various biotinMCP-1 derivatives will be determined in cell-based assays. In particular, agonist and antagonist properties will be determined in aequorin functional cell-based assay on human CCR2 receptor.
Example 7Demonstrate Removal of CCR2 Expressing Cells Using an Alternative Chemokine Ligand to MCP-1
(90) CCR2 also binds chemokines MCP-2, MCP-3, MCP-4 and MCP-5 in addition to MCP-1. MCP-5 only binds CCR2 and should be selective in its removal of CCR2 expressing cells. MCP5 is a mouse chemokine shown to chemotact human CCR2 cells with EC50<3 nM.
(91) The full length amino acid sequence, including the signal peptide, is set forth as SEQ ID NO: 4
(92) TABLE-US-00012 MKISTLLCLL LIATTISPQV LAGPDAVSTP VTCCYNVVKQ KIHVRKLKSY RRITSSQCPR EAVIFRTILD KEICADPKEK WVKNSINHLD KTSQTFILEP SCLG
(93) The amino acid sequence of N-terminal processed MCP-5 chemokine is 82 amino acids long and is set forth as SEQ ID NO: 5
(94) TABLE-US-00013 GPDAVSTP VTCCYNVVKQ KIHVRKLKSY RRITSSQCPR EAVIFRTILD KEICADPKEK WVKNSINHLD KTSQTFILEP SCLG
(95) An amino acid sequence alignment suggests that MCP-5 has a C-terminal extension when compared to the amino acid sequence of MCP-1. The results of this alignment are shown in
(96) TABLE-US-00014 GPDAVSTP VTCCYNVVKQ KIHVRKLKSY RRITSSQCPR EAVIFRTILD KEICADPKEK WVKNSINHLD KTSQTFIL
(97) In the truncated version, Ile75 to be substituted with Lys, set forth as SEQ ID NO: 7:
(98) TABLE-US-00015 GPDAVSTP VTCCYNVVKQ KIHVRKLKSY RRITSSQCPR EAVIFRTILD KEICADPKEK WVKNSINHLD KTSQTFXL
(99) X is an amino acid residue that can be biotinylated, such as lysine, ornithine or diaminopropionic acid and optionally is biotinylated, optionally via a spacer molecule such as PEG, e.g. K(PEG-Biotin)
(100) Following substitution, the substituted version will be biotinylated at position 75, a lysine or other suitable residue such as ornithine or diaminopropanoic acid via A PEG spacer (3,6,-dioxoaminooctanoic acid). The protein will be synthesised on an amide linker to yield a C-terminal amide derivative. This molecule is shown schematically in
(101) Once synthesised, the activity of the various biotinMCP-5 derivatives will be determined in cell-based assays. In particular, agonist and antagonist properties will be determined in aequorin functional cell-based assay on human CCR2 receptor.
Further Chemokine Examples
(102) General Protocols
(103) Assembly:
(104) Chemical synthesis of chemokines was performed using standard Fmoc solid phase peptides synthesis (SPPS) techniques on an ABI 433 peptide synthesiser. DIC (0.5 M in DMF) and OxymaPure (0.5 M in DMF) were used for activation, acetic anhydride (0.5 M in DMF) for capping, and 20% piperidine in DMF for Fmoc deprotection. Rink Amide resin was utilised for the generation of C-terminal amide chemokines and Wang resin for C-terminal acid chemokines. After assembly, the resin was washed with DMF and DCM and then dried in vacuo.
(105) Removal of Dde Protection:
(106) The Dde protecting group was removed by treatment of resin with a solution of 2.5% hydrazine in DMF (200 ml) over a 2 hour period. The resin was then washed with DMF.
(107) Labeling Steps:
(108) 1. Couple Fmoc-8-amino-3,6-dioctanoic acid (PEG)
(109) Resin was swollen in DMF and then a solution of Fmoc-8-amino-3,6-dioctanoic acid (0.38 g, 1 mmol), DIC solution (2 ml, 0.5 M in DMF) and OxymaPure solution (2 ml, 0.5 M in DMF) was added. The mixture was sonicated for 3 hours and then washed with DMF.
(110) 2. Capping
(111) The resin was capped with acetic anhydride solution (0.5 M in DMF, 10 ml) for 5 minutes and then washed with DMF. 3. Fmoc Deprotection
(112) Fmoc deprotection was carried out by treatment with 20% piperidine in DMF solution (250 ml) for 15 minutes each. The resin was washed with DMF.
(113) 4. Couple Biotin-OSu
(114) A solution of Biotin-OSu (341 mg, 1 mmol) and DIPEA (348 l) in DMF (10 ml) was added to the resin and the mixture was sonicated for 3 hours. The resin was washed thoroughly with DMF and DCM then dried in vacuo.
(115) Cleavage:
(116) Dry resin was treated with TFA (10 ml) containing a scavenger cocktail consisting of TIS (500 thioanisole (500 l), water (500 l), DMS (500 l), EDT (250 l), NH.sub.4I (500 g) and phenol (500 g) and the mixture was stirred at room temperature for 5 hours. The solution was filtered into cold ether and the resin rinsed with TFA. The precipitated peptide was centrifuged, washed with ether, centrifuged and lyophilised.
(117) Purification Protocol:
(118) The crude peptide was purified by reverse phase HPLC (RP-HPLC) using a Jupiter C18, 25021 mm column, 9 ml/min, eluting with an optimised gradient [Buffer A: water containing 0.1% TFA, Buffer B: acetonitrile containing 0.1% TFA].
(119) Folding Protocol:
(120) Pure peptide (10 mg) was dissolved into 6M GnHCl (16 ml) and then rapidly diluted to 2M GnHCl concentration by the addition of 50 mM TRIS pH 8.5 (84 ml) containing 0.3 mM GSSG and 3 mM GSH. The mixture was stirred at room temperature for 24 hours and then analysed by RP-HPLC (Jupiter C18, 2504.6 mm column, 10-60% B over 30 minutes. Purification by RP-HPLC using an optimised gradient afforded the desired product.
Example 8BiotinMCP-1 (CCL2)
(121) Target Molecule: MCP-1 derivatised at the s-amino side chain functionality of Lys(75) with PEG-Biotin (TFA salt)
(122) Modifications: Human MCP-1 corresponding to residues 1-76, is initially expressed as 99 amino acids comprising the chemokine fold, and a 23 amino acid signal peptide which is cleaved off. The Gln at the N-terminus of the protein is subject to pyroGlu formation under physiological conditions. Thus Gln1 of the sequence was substituted with pyroglutamine to prevent mixed species of N-terminal Gln and pyroGlu being generated. This improves the yield of synthesis and ensures a homogeneous chemokine preparation through column manufacture and use. The naturally occurring lysine at position 75 was modified through biotinylation on the resin. A PEG spacer was incorporated between the -amino functionality and the biotin.
(123) The linear amino acid sequence (SEQ ID NO: 8) is shown, prior to attachment of the PEG spacer and biotin molecules at amino acid 75 (K):
(124) TABLE-US-00016 H-XPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIV AKEICADPKQKWVQDSMDHLDKQTQTPKT-NH.sub.2
(125) X=pyroGlu or Gln
(126) The engineered MCP-1 sequence was assembled on a solid support (Rink Amide resin), using Fmoc protocols for solid-phase peptide synthesis as described in the general protocols section:
(127) TABLE-US-00017 H-XPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIV AKEICADPKQKWVQDSMDHLDKQTQTPXT-RESIN
(128) X1=pyroGlu or Gln
(129) X75=K(ivDde)
(130) FmocLys(ivDde)-OH was incorporated as residue 75 to facilitate site-specific labelling at this position of the protein (SEQ ID NO: 9). Subsequent removal of the ivDde protecting group, followed by coupling of the PEG spacer and Biotin, was carried out as described in the general protocol section. Cleavage, purification and folding protocols were carried out as described to furnish the desired active chemokine (SEQ ID NO: 10):
(131) TABLE-US-00018 H-XPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIV AKEICADPKQKWVQDSMDHLDKQTQTPXT-NH.sub.2
(132) X1=pyroGlu or Gln
(133) X75=an amino acid residue that can be biotinylated, such as lysine, ornithine or diaminopropionic acid and optionally is biotinylated, optionally via a spacer molecule such as PEG, e.g. K(PEG-Biotin).
(134) Electrospray ionisation with tandem mass spectrometry (ESI-TOF-MS) data of purified folded biotinMCP-1: obtained=9032.8 Da; expected 9034.4 Da.
(135) Functional Assay Data:
(136) biotinMCP-1 was tested for agonist activity in an Aequorin assay against hCCR2b, (Euroscreen) and an EC50 value of 9.6 nM was reported. c.f. EC50 for recombinant native MCP-1 is 3.1 nM.
Example 9BiotinMCP-2 (CCL8)
(137) Target Molecule: MCP-2 derivatised at the s-amino side chain functionality of Lys(75) with PEG-Biotin (TFA salt)
(138) Modifications: Human MCP-2 corresponding to residues 1-76, is initially expressed as 99 amino acids comprising the chemokine fold, and a 23 amino acid signal peptide which is cleaved off. The Gln at the N-terminus of the protein is subject to pyroGlu formation under physiological conditions. Thus Gln1 of the sequence was substituted with pyroglutamine to prevent mixed species of N-terminal Gln and pyroGlu being generated. This improves the yield of synthesis and ensures a homogeneous chemokine preparation through column manufacture and use. The naturally occurring lysine at position 75 was modified through biotinylation on the resin. A PEG spacer was incorporated between the -amino functionality and the biotin.
(139) The linear amino acid sequence (SEQ ID NO: 11) is shown, prior to attachment of the PEG spacer and biotin molecules at amino acid 75 (K):
(140) TABLE-US-00019 H-XPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKR GKEVCADPKERWVRDSMKHLDQIFQNLKP-NH.sub.2
(141) X=pyroGlu or Gln
(142) The engineered MCP-2 sequence was assembled on a solid support (Rink Amide resin), using Fmoc protocols for solid-phase peptide synthesis as described in the general protocols section:
(143) TABLE-US-00020 H-XPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKR GKEVCADPKERWVRDSMKHLDQIFQNLXP-NH.sub.2
(144) X1=pyroGlu or Gln
(145) X75=K(ivDde)
(146) FmocLys(ivDde)-OH was incorporated as residue 75 to facilitate site-specific labelling at this position of the protein (SEQ ID NO: 12). Subsequent removal of the ivDde protecting group, followed by coupling of the PEG spacer and Biotin, was carried out as described in the general protocol section. Cleavage, purification and folding protocols were carried out as described to furnish the desired active chemokine (SEQ ID NO: 13):
(147) TABLE-US-00021 H-XPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKR GKEVCADPKERWVRDSMKHLDQIFQNLXP-NH.sub.2
(148) X1=pyroGlu or Gln
(149) X75=an amino acid residue that can be biotinylated, such as lysine, ornithine or diaminopropionic acid and optionally is biotinylated, optionally via a spacer molecule such as PEG, e.g. K(PEG-Biotin).
(150) Electrospray ionisation with tandem mass spectrometry (ESI-TOF-MS) data of purified folded biotinMCP-2: obtained=9263.6 Da; expected 9263.8 Da.
(151) Functional Assay Data:
(152) biotinMCP-2 was tested for activity in an Aequorin assay against hCCR2b, (Euroscreen) and was shown to be a partial agonist with an EC50 value of 50.9 nM. c.f. EC50 for recombinant native MCP-2 is 23.5 nM (partial agonist).
Example 10BiotinRANTES (CCL5)
(153) Target Molecule: RANTES derivatised at the s-amino side chain functionality of Lys(67) with Biotin (TFA salt)
(154) Modifications: Human RANTES corresponding to residues 1-68, is initially expressed as 91 amino acids comprising the chemokine fold, and a 23 amino acid signal peptide which is cleaved off. The single methionine (Met67) within the sequence was mutated to lysine, to mitigate against oxidation of this residue during the chain assembly, which was observed during the synthesis of the natural sequence derivative. This Met to Lys substitution provided a lysine at position 67 which was modified through biotinylation on the resin.
(155) The linear amino acid sequence (SEQ ID NO: 14) is shown, prior to attachment of the biotin molecule at amino acid 67 (K):
(156) TABLE-US-00022 H-SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNR QVCANPEKKWVREYINSLEKS-OH
(157) The engineered RANTES sequence was assembled on a solid support (Wang resin), using Fmoc protocols for solid-phase peptide synthesis as described in the general protocols section:
(158) TABLE-US-00023 H-SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNR QVCANPEKKWVREYINSLEXS-RESIN
(159) X is K(ivDde)
(160) FmocLys(ivDde)-OH was incorporated as residue 67 to facilitate site-specific labelling at this position of the protein (SEQ ID NO: 15). Subsequent removal of the ivDde protecting group, followed by coupling of the Biotin, was carried out as described in the general protocol section. Cleavage, purification and folding protocols were carried out as described to furnish the desired active chemokine (SEQ ID NO: 16).
(161) TABLE-US-00024 H-SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNR QVCANPEKKWVREYINSLEXS-OH
(162) X is an amino acid residue that can be biotinylated, such as lysine, ornithine or diaminopropionic acid and optionally is biotinylated, optionally via a spacer molecule such as PEG (e.g. K(Biotin))
(163) Electrospray ionisation with tandem mass spectrometry (ESI-TOF-MS) data of purified folded biotinRANTES: obtained=8068.9 Da; expected 8070.2 Da.
(164) Functional Assay Data:
(165) BiotinRANTES was tested for agonist activity in an Aequorin assay against hCCR5, (Euroscreen) and an EC50 value of 0.5 nM was reported.
Example 11BiotinIL-8 (CXCL8)
(166) Target Molecule: IL-8 derivatised at the s-amino side chain functionality of Lys(78) with PEG-Biotin (TFA salt)
(167) Modifications: Human IL-8 corresponding to residues 1-77, is initially expressed as 99 amino acids comprising the chemokine fold, and a 22 amino acid signal peptide which is cleaved off. An additional lysine was inserted at the C-terminus at position 78, and modified through biotinylation on the resin. A PEG spacer was incorporated between the s-amino functionality and the biotin.
(168) The linear amino acid sequence (SEQ ID NO:17) is shown, prior to attachment of the PEG spacer and biotin molecules:
(169) TABLE-US-00025 H-AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKL SDGRELCLDPKENWVQRVVEKFLKRAENSX-NH.sub.2
(170) X is an amino acid residue that can be biotinylated, such as lysine, ornithine or diaminopropionic acid and optionally is biotinylated, optionally via a spacer molecule such as PEG
(171) The engineered IL-8 sequence was assembled on a solid support (Rink Amide resin), using Fmoc protocols for solid-phase peptide synthesis as described in the general protocols section:
(172) TABLE-US-00026 H-AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKL SDGRELCLDPKENWVQRVVEKFLKRAENSX-RESIN
(173) X is K(ivDde)
(174) FmocLys(ivDde)-OH was incorporated as residue 78 to facilitate site-specific labelling at this position of the protein (SEQ ID NO: 18). Subsequent removal of the ivDde protecting group, followed by coupling of the PEG spacer and Biotin, was carried out as described in the general protocol section. Cleavage, purification and folding protocols were carried out as described to furnish the desired active chemokine (SEQ ID NO: 19):
(175) TABLE-US-00027 H-AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKL SDGRELCLDPKENWVQRVVEKFLKRAENSK(PEG-Biotin)-NH.sub.2
(176) Electrospray ionisation with tandem mass spectrometry (ESI-TOF-MS) data of purified folded biotinIL-8: obtained=9416.9 Da; expected 9417.0 Da.
(177) Functional Assay Data:
(178) BiotinIL-8 was tested for agonist activity in an Aequorin assay against hCXCR1, (Euroscreen) and an EC50 value of 18.9 nM was reported. c.f. EC50 for recombinant native IL-8 is 5.2 nM.
Example 12BiotinIL-8 (6-78)
(179) Target Molecule: IL-8 (6-78) derivatised at the s-amino side chain functionality of Lys(78) with PEG-Biotin (TFA salt)
(180) Modifications: Truncated form of IL-8 corresponding to residues 6-77, the first five N-terminal residues have been removed and an additional lysine was inserted at the C-terminus at position 78, and modified through biotinylation on the resin. A PEG spacer was incorporated between the s-amino functionality and the biotin.
(181) The linear amino acid sequence (SEQ ID NO: 20) is shown, prior to attachment of the PEG spacer and biotin molecules:
(182) TABLE-US-00028 H-SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGREL CLDPKENWVQRVVEKFLKRAENSX-NH.sub.2
(183) X is an amino acid residue that can be biotinylated, such as lysine, ornithine or diaminopropionic acid and optionally is biotinylated, optionally via a spacer molecule such as PEG
(184) The engineered IL-8 sequence was assembled on a solid support (Rink Amide resin), using Fmoc protocols for solid-phase peptide synthesis as described in the general protocols section:
(185) TABLE-US-00029 H-SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGREL CLDPKENWVQRVVEKFLKRAENSX-RESIN
(186) X is K(ivDde)
(187) FmocLys(ivDde)-OH was incorporated as residue 78 to facilitate site-specific labelling at this position of the protein (SEQ ID NO: 21). Subsequent removal of the ivDde protecting group, followed by coupling of the PEG spacer and Biotin, was carried out as described in the general protocol section. Cleavage, purification and folding protocols were carried out as described to furnish the desired active chemokine (SEQ ID NO: 22):
(188) TABLE-US-00030 H-SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGREL CLDPKENWVQRVVEKFLKRAENSX-NH.sub.2
(189) X is K(PEG-Biotin)
(190) Electrospray ionisation with tandem mass spectrometry (ESI-TOF-MS) data of purified folded biotinIL-8 (6-78): obtained=8880.50 Da; expected 8880.4 Da.
(191) Functional Assay Data:
(192) BiotinIL-8 (6-78) was tested for agonist activity in an Aequorin assay against hCXCR1, (Euroscreen) and an EC50 value of 6.1 nM was reported. c.f. EC50 for recombinant native IL-8 is 4.2 nM.
Example 13Diagnosis and Treatment of RDS
(193) Materials and Methods
(194) 1. Flow Cytometric Analysis of Peripheral Blood
(195) Peripheral blood from patients and healthy controls was collected in heparin tubes. The red blood cells were lysed using Fix Buffer (Phosphate Buffer Saline (PBS) citrate with 4% paraformaldehyde) for four minutes at 37 C. and Lysing buffer (PBS with 10 mM Tris and 160 mM NH4Cl, pH 7.5) for 15 min at 37 C. The cells were washed in PBS with 2% Bovine Growth Serum, incubated with 10% human serum for 15 min at room temperature (RD and stained with antibodies (Table 2) at 4 C. for 30 min. The cells were analysed with flow cytometry on a FACS Canto flow cytometer with the FACSDiva software (BD Biosciences).
(196) TABLE-US-00031 TABLE 2 List of antibodies for flow cytometric analysis. Antibody Fluorophore Supplier CD14 FITC Beckman Coulter CCR5 PE Biolegend CXCR2 PE Biolegend Streptavidin PE, APC Biolegend CD16 PE Cy7 BD Biosciences CXCR1 APC Biolegend CD3 V450 BD Biosciences CD14 V500 BD Biosciences
(197) 2. Chemokine Binding Test
(198) Peripheral blood from patients and healthy controls was collected in heparin tubes. The red blood cells were lysed using Fix Buffer (Phosphate Buffer Saline (PBS) citrate with 4% paraformaldehyde) for four minutes at 37 C. and Lysing buffer (PBS with 10 mM Tris and 160 mM NH4Cl, pH 7.5) for 15 min at 37 C. The cells were washed in PBS with 2% Bovine Growth Serum, incubated with 10% human serum 15 min at room temperature (RD and stained with cell specific antibodies together with biotinylated chemokine (1 M) or the corresponding chemokine receptor antibody at 4 C. for 30 min (Table 2). The biotinylated chemokine was detected via the interaction between biotin and a fluorophore conjugated Streptavidin. The samples were analysed by flow cytometry on a FACS Canto flow cytometer with the FACSDiva software (BD Biosciences).
(199) 3. Cell Depletion with Antibody and Magnetic Activated Cell Sorting (MACS)
(200) Cells were prepared from peripheral blood (section 1) and kept in MACS buffer (PBS pH 7.2 supplemented with 2 mM EDTA and 0.5% bovine serum albumin (BSA)). The cells were incubated with an anti-CXCR1-APC antibody for 30 min at 4 C. Next, the cells were incubated with anti-APC microbeads for 15 min, 4 C. (Miltenyi Biotec). The cells were run through MACS columns (Miltenyi Biotec) to enable binding of the CXCR1 positive cells. The cells were then analysed with flow cytometry.
(201) Results and Discussion
(202) 1. Flow Cytometric Analysis of Peripheral Blood
(203) White blood cells from patients with respiratory distress syndrome (RDS) were analysed for cell surface markers with flow cytometry. The patients exhibited an increased frequency of circulating neutrophils, 73% compared to 45% in healthy controls (
(204) 2. Chemokine Binding Test
(205) The neutrophils expressed the chemokine receptors CXCR1 and CXCR2 based upon flow cytometry data and binding by anti-CXCR1 and CXCR2 antibodies (
(206) Biotinylated IL-8 (bIL-8) could bind to the neutrophils to the same extent as the receptor-specific antibody anti-CXCR1 (
(207) 3. Cell Depletion with Antibody and Magnetic Activated Cell Sorting (MACS)
(208) Furthermore, the neutrophils could be efficiently depleted with an anti-CXCR1 antibody and Magnetic Activated Cell Sorting (MACS) (
(209) We conclude that the frequency of neutrophils is increased in sepsis patients. The neutrophils express the IL-8 receptors CXCR1 and CXCR2 and can bind the ligand IL-8. Furthermore, the neutrophils can be depleted with an anti-CXCR1-antibody and MACS.
Example 14In-Vitro Depletion of Target Cell Populations (CCR5)
(210) To investigate the ability to eliminate CCR5-expressing cells, in vitro tests have been performed on the biotinylated RANTES coupled matrix. Blood was collected from blood donors and passed through the column device containing biotinylated RANTES coupled matrix. Blood samples were taken before and after column passage and analyzed by flow cytometry (FACS) for the depletion of CCR5-expressing cells.
(211) The RANTES molecule was synthesized by Almac. The amino acid sequence of the RANTES molecule, prior to biotinylation, is set forth as SEQ ID NO: 14:
(212) TABLE-US-00032 H2N- SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQV CANPEKKWVREYINSLEKS-CO2H
(213) This molecule has the naturally occurring methionine at position 67 replaced with lysine to facilitate biotinylation at position 67. The biotinylated version is shown as SEQ ID NO: 16.
(214) The side-chain of Lys 67 was directly biotinylated to given the protein primary structure shown in
(215) The results demonstrate significant depletion of the target population chemokine receptor-expressing cells post matrix perfusion. Depletion tests were performed on blood from a healthy donor. The results are shown in
(216) The in-vitro results demonstrate a specific reduction of around 20% of the chemokine receptor-expressing cells by the column. Non-CCR5-expressing cells remained unaffected (data not shown).
(217) The various embodiments of the present invention are not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the various embodiments of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description and accompanying figures. Such modifications are intended to fall within the scope of the appended claims. Moreover, all embodiments described herein are considered to be broadly applicable and combinable with any and all other consistent embodiments, as appropriate.
(218) Various publications are cited herein, the disclosures of which are incorporated by reference in their entireties.