P AERUGINOSA PCRV-LINKED ANTIGEN VACCINES
20240139304 ยท 2024-05-02
Inventors
- Christiane Marie-Paule Simone Jeanne Feron (Rixensart, BE)
- Stefan Jochen KEMMLER (Schlieren, CH)
- Michael Thomas KOWARIK (Schlieren, CH)
- Julien Laurent QUEBATTE (Schlieren, CH)
Cpc classification
A61K47/6415
HUMAN NECESSITIES
A61K2039/64
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
C12N9/1014
CHEMISTRY; METALLURGY
C12N9/1081
CHEMISTRY; METALLURGY
A61K47/646
HUMAN NECESSITIES
International classification
A61K45/06
HUMAN NECESSITIES
A61K47/64
HUMAN NECESSITIES
Abstract
The present invention discloses a conjugate comprising an antigen (for example a saccharide antigen) covalently linked to a Pseudomonas aeruginosa PcrV carrier protein comprising an amino acid sequence which is at least 80% identical to the sequence of SEQ ID NO:1-4, wherein the antigen is linked (either directly or through a linker) to an amino acid residue of the P. aeruginosa PcrV carrier protein. The invention also discloses Pseudomonas aeruginosa PcrV proteins that contain glycosylation site consensus sequences.
Claims
1. A PcrV protein having an amino acid sequence that is at least 70% or 80% identical to the sequence of SEQ ID NO:1-4, said amino acid sequence comprising a D/E-XNXS/T consensus sequence wherein X is any amino acid apart from proline.
2. The PcrV protein of claim 1, wherein the D/E-XNXS/T consensus wherein X is any amino acid apart from proline, is situated at a position between amino acids 23-166 or amino acids 281-317 or amino acid 317 of SEQ ID NO:3, or wherein the D/E-XNXS/T consensus sequence wherein X is any amino acid apart from proline, is situated between amino acids 1-143 or amino acids 258-294 or amino acid 294 of SEQ ID NO:4.
3. The PcrV protein of claim 1, wherein a peptide comprising the D/E-XNXS/T consensus sequence is introduced into the amino acid sequence by the removal of a PcrV peptide sequence and its replacement with a peptide comprising the D/E-XNXS/T consensus sequence, preferably wherein the PcrV peptide sequence to be removed contains 1-7 amino acids, preferably wherein the PcrV peptide sequence to be removed contains one amino acid.
4. The PcrV protein of claim 3, wherein the peptide comprising the D/E-XNXS/T consensus sequence is introduced into the amino acid sequence at a position between amino acid residue 24-143 of SEQ ID NO:3 or amino acids residue 1-120 of SEQ ID:4.
5. The PcrV protein of claim 3, wherein the peptide comprising the D/E-XNXS/T consensus sequence is introduced into the amino acid sequence at a position between amino acid residue 24-48 of SEQ ID NO:3 or amino acids residue 1-24 of SEQ ID:4.
6. The PcrV protein of claim 1, wherein at least 2, 3 or 4 D/E-XNXS/T consensus sequences are introduced into the sequence of any one of SEQ ID NO:1-4 or a sequence with at least 80% identity thereto.
7. The PcrV protein of claim 1, which has an amino acid sequence that comprises at least one of SEQ ID NO: 6-62, preferably which has an amino acid sequence that comprises at least one of SEQ ID NO:6-12 and 33, preferably which has an amino acid sequence that comprises at least 3 of SEQ ID NO:6-12 and 33, preferably which has an amino acid sequence that comprises SEQ ID NO:6 and/or SEQ ID NO:9 and/or SEQ ID NO:11 and/or SEQ ID NO:33.
8. The PcrV protein of claim 1, wherein the amino acid sequence comprises a peptide tag which is useful for the purification of the PcrV protein, preferably wherein the peptide tag is located at the C-terminus of the amino acid sequence, preferably wherein the peptide tag comprises six histidine residues.
9. The PcrV protein of claim 8, wherein the peptide tag comprises six histidine residues.
10. The PcrV protein of claim 8, wherein the amino acid sequence comprises a leader sequence which is capable of directing the PcrV protein to the periplasm of a bacterium, preferably wherein the leader sequence has an amino acid sequence at least 80% identical to SEQ ID NO:63.
11. An immunogenic composition comprising the PcrV of claim 8 and a pharmaceutically acceptable excipient.
12. The immunogenic composition of claim 11, further comprising additional antigens.
13. The immunogenic composition of claim 12, wherein the additional antigens are selected from the group consisting of a conjugate of and O-antigen and a carrier protein, a conjugate of a bacterial capsular polysaccharide and a carrier protein, a conjugate of an LOS and a carrier protein and a protein.
14. A method of making the immunogenic composition of claim 11, comprising the step of mixing the conjugate or PcrV protein with a pharmaceutically acceptable excipient.
Description
DESCRIPTION OF FIGURES
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
DETAILED DESCRIPTION
[0041] The present invention discloses a conjugate comprising an antigen covalently linked to a Pseudomonas aeruginosa PcrV carrier protein comprising an amino acid sequence which is at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO:1-4, wherein the antigen is linked (either directly or through a linker) to an amino acid residue of the P. aeruginosa PcrV carrier protein.
[0042] In an embodiment, the amino acid residue to which the antigen is linked is not an asparagine residue and in this case, the conjugate is typically produced by chemical conjugation, for which many processes are well known in the art. For example, the amino acid is selected from the group consisting of: Ala, Arg, Asp, Cys, Gly, Glu, Gln, His, Ile, Leu, Lys, Met, Phe, Pro, Ser, Thr, Trp, Tyr, and Val. Optionally, the amino acid is: an amino acid containing a terminal amine group, a lysine, an arginine, a glutaminic acid, an aspartic acid, a cysteine, a tyrosine, a histidine, an arginine or a tryptophan.
[0043] In an embodiment, the antigen is covalently linked to the Pseudomonas aeruginosa PcrV carrier protein through a chemical linkage obtainable using a chemical conjugation method.
[0044] In an embodiment, the chemical conjugation method is selected from the group consisting of carbodiimide chemistry, reductive animation, cyanylation chemistry (for example CDAP chemistry), maleimide chemistry, hydrazide chemistry, ester chemistry, and N-hydroysuccinimide chemistry. Optionally, the antigen is covalently linked to an aspartic acid, glutamic acid, lysine, cysteine, tyrosine, histidine, arginine or tryptophan amino acid on the P. aeroginosa PcrV carrier protein.
[0045] In an embodiment, the antigen is directly linked to the P. aeruginosa PcrV carrier protein.
[0046] In an embodiment, the antigen is attached to the P. aeruginosa PcrV carrier protein via a linker. Optionally, the linker is selected from the group consisting of linkers with 4-12 carbon atoms, bifunctional linkers, linkers containing 1 or 2 reactive amino groups at the end, B-proprionamido, nitrophenyl-ethylamine, haloacyl halides, 6-aminocaproic acid and ADH.
[0047] In general the following types of chemical groups on a protein carrier can be used for coupling/conjugation: [0048] A) Carboxyl (for instance via aspartic acid or glutamic acid). In one embodiment this group is linked to amino groups on saccharides directly or to an amino group on a linker with carbodiimide chemistry e.g. with EDAC. [0049] B) Amino group (for instance via lysine). In one embodiment this group is linked to carboxyl groups on saccharides directly or to a carboxyl group on a linker with carbodiimide chemistry e.g. with EDAC. In another embodiment this group is linked to hydroxyl groups activated with CDAP or CNBr on saccharides directly or to such groups on a linker; to saccharides or linkers having an aldehyde group; to saccharides or linkers having a succinimide ester group. [0050] C) Sulphydryl (for instance via cysteine). In one embodiment this group is linked to a bromo or chloro acetylated saccharide or linker with maleimide chemistry. In one embodiment this group is activated/modified with bis diazobenzidine. [0051] D) Hydroxyl group (for instance via tyrosine). In one embodiment this group is activated/modified with bis diazobenzidine. [0052] E) Imidazolyl group (for instance via histidine). In one embodiment this group is activated/modified with bis diazobenzidine. [0053] F) Guanidyl group (for instance via arginine). [0054] G) Indolyl group (for instance via tryptophan).
[0055] On a saccharide, in general the following groups can be used for a coupling: OH, COOH or NH2. Aldehyde groups can be generated after different treatments known in the art such as: periodate, acid hydrolysis, hydrogen peroxide, etc.
[0056] Direct Coupling Approaches: [0057] Saccharide-OH+CNBr or CDAP.fwdarw.cyanate ester+NH2-Prot.fwdarw.conjugate [0058] Saccharide-aldehyde+NH2-Prot.fwdarw.Schiff base+NaCNBH3.fwdarw.conjugate [0059] Saccharide-COOH+NH2-Prot+EDAC.fwdarw.conjugate [0060] Saccharide-NH2+COOH-Prot+EDAC.fwdarw.conjugate
[0061] Indirect Coupling Via Spacer (Linker) Approaches: [0062] Saccharide-OH+CNBr or CDAP.fwdarw.cyanate ester+NH2-NH2.fwdarw.saccharide-NH2+COOH-Prot+EDAC.fwdarw.conjugate [0063] Saccharide-OH+CNBr or CDAP.fwdarw.cyanate ester+NH2-SH.fwdarw.saccharide-SH+SH-Prot (native Protein with an exposed cysteine or obtained after modification of amino groups of the protein by SPDP for instance).fwdarw.saccharide-SS-Prot [0064] Saccharide-OH+CNBr or CDAP.fwdarw.cyanate ester+NH2-SH.fwdarw.saccharide-SH+maleimide-Prot (modification of amino groups).fwdarw.conjugate [0065] Saccharide-COOH+EDAC+NH2-NH2.fwdarw.saccharide-NH2+EDAC+COOH-Prot.fwdarw.conjugate [0066] Saccharide-COOH+EDAC+NH2-SH.fwdarw.saccharide-SH+SH-Prot (native Protein with an exposed cysteine or obtained after modification of amino groups of the protein by SPDP for instance).fwdarw.saccharide-SS-Prot [0067] Saccharide-COOH+EDAC+NH2-SH.fwdarw.saccharide-SH+maleimide-Prot (modification of amino groups).fwdarw.conjugate [0068] Saccharide-Aldehyde+NH2-NH2.fwdarw.saccharide-NH2+EDAC+COOH-Prot.fwdarw.conjugate
[0069] Note: instead of EDAC above, any suitable carbodiimide may be used.
[0070] In an embodiment, the conjugate of the invention contains an amino acid residue to which the antigen is linked, wherein the amino acid residue is an asparagine residue.
[0071] In an embodiment, the asparagine residue is not part of a D/E-XNXS/T consensus sequence introduced into the amino acid sequence which is at least 50%, 60%, 70%, 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO:1-4, wherein X is any amino acid apart from proline.
[0072] However, in a further embodiment, the asparagine residue is part of a D/E-XNXS/T consensus sequence introduced into the amino acid sequence which is at least 50%, 60%, 70%, 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO:1-4, wherein X is any amino acid apart from proline, wherein the asparagine residue is situated at a position equivalent to amino acids 23-166 or amino acids 281-317 or at amino acid 317 of SEQ ID NO:3. For example, amino acid 24-100, amino acid 24-50, amino acid 310-317.
[0073] In an embodiment, the asparagine residue is part of a D/E-XNXS/T consensus sequence introduced into the amino acid sequence which is at least 50%, 60%, 70%, 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO:1-4, wherein X is any amino acid apart from proline, wherein the asparagine residue is situated between amino acids 1-143 or amino acids 258-294 or at amino acid 294 of SEQ ID NO:4. For example, at amino acid 1-100 or amino acid 1-50 or amino acid 1-25 or amino acid 290-294 of SEQ IS NO:4.
[0074] In an embodiment, the asparagine residue is part of a D/E-XNXS/T consensus sequence, wherein X is any amino acid apart from proline, wherein the asparagine residue is not introduced by mutation into the sequence of SEQ ID NO:5 or a sequence having at least 50%, 60%, 70%, 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98%, 99% or 100% identity to SEQ ID NO:5.
[0075] In an embodiment, a peptide comprising the D/E-XNXS/T consensus sequence is introduced into the amino acid sequence by the removal of a PcrV peptide sequence and its replacement with the peptide comprising the D/E-XNXS/T consensus sequence. In an embodiment, the PcrV peptide sequence which is removed contains 1-7 amino acids or 7, 6, 7, 4, 3, 2 or one amino acid.
[0076] In an embodiment, the peptide comprising the D/E-XNXS/T consensus sequence is introduced into the amino acid sequence at a position between amino acid residue 23-166 of SEQ ID NO:3 or amino acids residue 1-143 of SEQ ID:4 or at a position between amino acid residue 23-100, 23-50 of SEQ ID NO:3 or amino acids residue 1-100, 1-50 or 1-24 of SEQ ID:4.
[0077] In an embodiment, at least 1, 2, 3, 4 or 5 D/E-XNXS/T consensus sequences are introduced into the sequence of any one of SEQ ID NO:1-4 or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98%, 99% or 100% identity thereto.
[0078] In an embodiment, the PcrV carrier protein has a sequence comprising at least one of SEQ ID NO: 6-62, for example SEQ ID NO:6-12 and 33.
[0079] In an embodiment, the PcrV carrier protein has a sequence comprising at least 1, 2, 3, 4 or 5 of SEQ ID NO:6-12 and 33, optionally at least 3 of SEQ ID NO:6-12 and 33.
[0080] In an embodiment, the PcrV carrier protein has a sequence comprising SEQ ID NO:6 and/or SEQ ID NO:9 and/or SEQ ID NO:11 and/or SEQ ID NO:33.
[0081] In an embodiment the antigen is a saccharide such as a bacterial capsular saccharide, a bacterial lipopolysaccharides or lipooligosaccharide.
[0082] The saccharides may be selected from a group consisting of: N. meningitidis serogroup A capsular saccharide (MenA), N. meningitidis serogroup C capsular saccharide (MenC), N. meningitidis serogroup Y capsular saccharide (MenY), N. meningitidis serogroup W capsular saccharide (MenW), H. influenzae type b capsular saccharide (Hib), Group B Streptococcus group I capsular saccharide, Group B Streptococcus group II capsular saccharide, Group B Streptococcus group Ill capsular saccharide, Group B Streptococcus group IV capsular saccharide, Group B Streptococcus group V capsular saccharide, Staphylococcus aureus type 5 capsular saccharide, Staphylococcus aureus type 8 capsular saccharide, Vi saccharide from Salmonella typhi, N. meningitidis LPS (such as L3 and/or L2), M. catarrhalis LPS, H. influenzae LPS, Shigella O-antigens, P. aeruginosa O-antigens, E. coli O-antigens and from any of the capsular pneumococcal saccharides such as from serotype: 1, 2, 3, 4, 5, 6A, 6B, 7F, 8, 9N, 9V, 10A, 11A, 12F, 14, 15B, 17F, 18C, 19A, 19F, 20, 22F, 23F or 33F.
[0083] In an embodiment, the antigen is a lipopolysaccharides from P. aeruginosa. Optionally the antigen is a O-antigen from P. aeruginosa, optionally O1, O2, O3, O4, O5, O6, O7, O8, O9, O10, O11, O12, O13, O14, O15, O16, O17, O18, O19 or O20, for example O6 or 011. In an embodiment, there is provided a bioconjugate comprising a PcrV carrier protein linked to a Pseudomonas aeruginosa O antigen, wherein said Pseudomonas aeruginosa O antigen is one of the serotypes described in Knirel et al., 2006, Journal of Endotoxin Research 12(6):324-336, the disclosure of which is incorporated herein by reference in its entirety. In specific embodiments the P. aeruginosa O-antigen is from O6 or O11.
[0084] A further aspect of the invention is a PcrV protein having an amino acid sequence that is at least 50%, 60%, 70%,80%, 85%, 90%, 92%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO:1-4, said amino acid sequence comprising a D/E-XNXS/T consensus sequence wherein X is any amino acid apart from proline.
[0085] In an embodiment the D/E-XNXS/T consensus wherein X is any amino acid apart from proline, is situated at a position between amino acids 23-166 or amino acids 281-317 or amino acid 317 of SEQ ID NO:3.
[0086] In an embodiment, the D/E-XNXS/T consensus sequence wherein X is any amino acid apart from proline, is situated between amino acids 1-143 or amino acids 258-294 or amino acid 294 of SEQ ID NO:4.
[0087] In an embodiment, a peptide comprising the D/E-XNXS/T consensus sequence is introduced into the amino acid sequence by the removal of a PcrV peptide sequence and its replacement with a peptide comprising the D/E-XNXS/T consensus sequence. In an embodiment, the PcrV peptide sequence contains 1-7 amino acids, optionally 7, 6, 5, 4, 3, 2 or one amino acid.
[0088] In an embodiment, the peptide comprising the D/E-XNXS/T consensus sequence is introduced into the amino acid sequence at a position between amino acid residue 23-166 of SEQ ID NO:3 or amino acids residue 1-143 of SEQ ID:4.
[0089] In an embodiment, the peptide comprising the D/E-XNXS/T consensus sequence is introduced into the amino acid sequence at a position between amino acid residue 23-100 or 23-48 of SEQ ID NO:3 or amino acids residue 1-75 or 1-24 of SEQ ID:4.
[0090] In an embodiment at least 2, 3 or 4 D/E-XNXS/T consensus sequences or exactly 1, 2, 3, 4, 5, or 6 D/E-XNXS/T consensus seuqences are introduced into the sequence of any one of SEQ ID NO:1-4 or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98%, 99% or 100% identity thereto.
[0091] In an embodiment, the PcrV protein has an amino acid sequence that comprises at least one of SEQ ID NO: 6-62, optionally at least one of SEQ ID NO:6-12 and 33, optionally at least 3 of SEQ ID NO:6-12 and 33.
[0092] In an embodiment, the PcrV protein of the invention has an amino acid sequence that comprises SEQ ID NO:6 and/or SEQ ID NO:9 and/or SEQ ID NO:11 and/or SEQ ID NO:33.
[0093] In an embodiment, the PcrV carrier proteins used in the generation of the bioconjugates described herein comprise a tag, i.e., a sequence of amino acids that allows for the isolation and/or identification of the carrier protein. For example, adding a tag to a carrier protein described herein can be useful in the purification of that protein and, hence, the purification of conjugate vaccines comprising the tagged carrier protein. Exemplary tags that can be used herein include, without limitation, histidine (HIS) tags (e.g., hexa histidine-tag (SEQ ID NO: 69), or 6XHis-Tag (SEQ ID NO: 69)), FLAG-TAG, and HA tags. In certain embodiments, the tags used herein are removable, e.g., removal by chemical agents or by enzymatic means, once they are no longer needed, e.g., after the protein has been purified.
[0094] In certain embodiments, the carrier proteins described herein comprise a signal sequence that targets the carrier protein to the periplasmic space of the host cell that expresses the carrier protein. In a specific embodiment, the signal sequence is from E. coli DsbA, E. coli outer membrane porin A (OmpA), E. coli maltose binding protein (MalE), Erwinia carotovorans pectate lyase (PeIB), Flgl, NikA, or Bacillus sp. endoxylanase (XynA), heat labile E. coli enterotoxin LTIIb, Bacillus endoxylanase XynA, or E. coli flagellin (Flgl). In an embodiment, the PcrV protein of the invention comprises a leader sequence which is capable of directing the PcrV protein ot the peripasm of the bacterium. Optionally, the leader sequence has an amino acid sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO:63. In an embodiment, an alanine residue is added between the leader sequence and the start of the sequence of the mature protein. Such an alanine residue has the advantage of leading to more efficient cleavage of the leader sequence.
[0095] In an embodiment, the PcrV protein of the invention has an amino acid sequence that comprises a peptide tag which is useful for the purification of the PcrV protein. Optionally the peptide tag is located at the C-terminus of the amino acid sequence. Optionally the peptide tag comprises six histidine residues (SEQ ID NO: 69).
[0096] A further aspect of the invention is a method of making the immunogenic composition of the invention comprising the step of mixing the conjugate or PcrV protein with a pharmaceutically acceptable excipient.
[0097] The PcrV proteins and conjugates of the invention are particularly suited for inclusion in immunogenic compositions and vaccines. A process of the invention may therefore include the step of formulating the PcrV protein or conjugate as an immunogenic composition or vaccine. A further aspect of the invention is an immunogenic composition comprising the conjugate of the invention or the PcrV protein of the invention and a pharmaceutically acceptable excipient. The immunogenic composition of the invention optionally further comprises additional antigens. Examples of such additional antigens are; a conjugate of an O-antigen and a carrier protein, a conjugate of a bacterial capsular polysaccharide and a carrier protein, a conjugate of an LOS and a carrier protein and a protein. Suitably conjugates include 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 of P. aeruginosa O1, O2, O3, O4, O5, O6 O7, O8, O9, O10, O11, O12, O13, O14, O15, O16, O17, O18, O19 or O20. Suitable proteins include further P. aeruginosa proteins such as P. aeruginosa Exoprotein A or variants thereof such as those described in WO 13/36574, P. aeruginosa Ompl or OmpF or PopB (YpoB, YopD, FIiC) or hybrid proteins of OprF-Ompl (see U.S. Pat. No. 5,955,090 or U.S. Pat. No. 6,300,102).
[0098] Immunogenic compositions and vaccines of the invention will typically comprise pharmaceutically acceptable excipients which include any excipicent that does not itself induce the production of antibodies harmful to the individual receiving the composition. The compositions typically also contain a diluents such as water, saline, glycerol etc. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, polyols and the like may be present.
[0099] The compositions comprising the conjugates or PcrV proteins described herein may comprise any additional components suitable for use in pharmaceutical administration. In specific embodiments, the compositions described herein are monovalent formulations. In other embodiments, the compositions described herein are multivalent formulations, e.g., bivalent, trivalent, and tetravalent formulations. For example, a multivalent formulation comprises more than one antigen for example more tha one conjugate.
[0100] In certain embodiments, the compositions described herein additionally comprise a preservative, e.g., the mercury derivative thimerosal. In a specific embodiment, the pharmaceutical compositions described herein comprise 0.001% to 0.01% thimerosal. In other embodiments, the pharmaceutical compositions described herein do not comprise a preservative.
[0101] In certain embodiments, the compositions described herein (e.g., the immunogenic compositions) comprise, or are administered in combination with, an adjuvant. The adjuvant for administration in combination with a composition described herein may be administered before, concomitantly with, or after administration of said composition. In some embodiments, the term adjuvant refers to a compound that when administered in conjunction with or as part of a composition described herein augments, enhances and/or boosts the immune response to a bioconjugate, but when the compound is administered alone does not generate an immune response to the bioconjugate. In some embodiments, the adjuvant generates an immune response to the conjugate or PcrV protein and does not produce an allergy or other adverse reaction. Adjuvants can enhance an immune response by several mechanisms including, e.g., lymphocyte recruitment, stimulation of B and/or T cells, and stimulation of macrophages.
[0102] Specific examples of adjuvants include, but are not limited to, aluminum salts (alum) (such as aluminum hydroxide, aluminum phosphate, and aluminum sulfate), 3 De-O-acylated monophosphoryl lipid A (MPL) (see United Kingdom Patent GB2220211), MF59 (Novartis), AS03 (GlaxoSmithKline), ASO4 (GlaxoSmithKline), polysorbate 80 (Tween 80; ICL Americas, Inc.), imidazopyridine compounds (see International Application No. PCT/US2007/064857, published as International Publication No. WO2007/109812), imidazoquinoxaline compounds (see International Application No. PCT/US2007/064858, published as International Publication No. WO2007/109813) and saponins, such as QS21 (see Kensil et al., in Vaccine Design: The Subunit and Adjuvant Approach (eds. Powell & Newman, Plenum Press, N Y, 1995); U.S. Pat. No. 5,057,540). In some embodiments, the adjuvant is Freund's adjuvant (complete or incomplete). Other adjuvants are oil in water emulsions (such as squalene or peanut oil), optionally in combination with immune stimulants, such as monophosphoryl lipid A (see Stoute et al., N. Engl. J. Med. 336, 86-91 (1997)). Another adjuvant is CpG (Bioworld Today, Nov. 15, 1998).
[0103] In certain embodiments, the compositions described herein are formulated to be suitable for the intended route of administration to a subject. For example, the compositions described herein may be formulated to be suitable for subcutaneous, parenteral, oral, intradermal, transdermal, colorectal, intraperitoneal, and rectal administration. In a specific embodiment, the pharmaceutical composition may be formulated for intravenous, oral, intraperitoneal, intranasal, intratracheal, subcutaneous, intramuscular, topical, intradermal, transdermal or pulmonary administration.
[0104] In certain embodiments, the compositions described herein additionally comprise one or more buffers, e.g., phosphate buffer and sucrose phosphate glutamate buffer. In other embodiments, the compositions described herein do not comprise buffers.
[0105] In certain embodiments, the compositions described herein additionally comprise one or more salts, e.g., sodium chloride, calcium chloride, sodium phosphate, monosodium glutamate, and aluminum salts (e.g., aluminum hydroxide, aluminum phosphate, alum (potassium aluminum sulfate), or a mixture of such aluminum salts). In other embodiments, the compositions described herein do not comprise salts.
[0106] The compositions described herein can be included in a container, pack, or dispenser together with instructions for administration.
[0107] The compositions described herein can be stored before use, e.g., the compositions can be stored frozen (e.g., at about ?20? C. or at about ?70? C.); stored in refrigerated conditions (e.g., at about 4? C.); or stored at room temperature.
[0108] Immunogenic compositions used as vaccines comprise an immunologically effective amount of the PcrV protein or conjugate of the invention, as well as any other components. By immunologicaly effective amount, it is meant that the administration of that amount to an individual, either as a single dose or as part of a series is effective for treatment or prevention. This amount varies depending on the health and physical condition of the individual to be treated, age, the degree of protection desired, the formulation of the vaccine and other relevant factors. It is expected that the amount will fall in a relatively braod range that can be determined through routine trials.
[0109] The vaccines of the present invention are preferably adjuvanted. Suitable adjuvants include an aluminum salt such as aluminum hydroxide gel (alum) or aluminium phosphate, but may also be a salt of calcium, magnesium, iron or zinc, or may be an insoluble suspension of acylated tyrosine, or acylated sugars, cationically or anionically derivatized polysaccharides, or polyphosphazenes.
[0110] It is preferred that the adjuvant be selected to be a preferential inducer of either a TH1 or a TH2 type of response. High levels of Th1-type cytokines tend to favor the induction of cell mediated immune responses to a given antigen, whilst high levels of Th2-type cytokines tend to favour the induction of humoral immune responses to the antigen.
[0111] It is important to remember that the distinction of Th1 and Th2-type immune response is not absolute. In reality an individual will support an immune response which is described as being predominantly Th1 or predominantly Th2. However, it is often convenient to consider the families of cytokines in terms of that described in murine CD4+ve T cell clones by Mosmann and Coffman (Mosmann, T. R. and Coffman, R. L. (1989) TH1 and TH2 cells: different patterns of lymphokine secretion lead to different functional properties. Annual Review of Immunology, 7, p145-173). Traditionally, Th1-type responses are associated with the production of the INF-? and IL-2 cytokines by T-lymphocytes. Other cytokines often directly associated with the induction of Th1-type immune responses are not produced by T-cells, such as IL-12. In contrast, Th2-type responses are associated with the secretion of II-4, IL-5, IL-6, IL-10. Suitable adjuvant systems which promote a predominantly Th1 response include: Monophosphoryl lipid A or a derivative thereof, particularly 3-de-O-acylated monophosphoryl lipid A (3D-MPL) (for its preparation see GB 2220211 A); and a combination of monophosphoryl lipid A, preferably 3-de-O-acylated monophosphoryl lipid A, together with either an aluminium salt (for instance aluminium phosphate or aluminium hydroxide) or an oil-in-water emulsion. In such combinations, antigen and 3D-MPL are contained in the same particulate structures, allowing for more efficient delivery of antigenic and immunostimulatory signals. Studies have shown that 3D-MPL is able to further enhance the immunogenicity of an alum-adsorbed antigen [Thoelen et al. Vaccine (1998) 16:708-14; EP 689454-B1].
[0112] An enhanced system involves the combination of a monophosphoryl lipid A and a saponin derivative, particularly the combination of QS21 and 3D-MPL as disclosed in WO 94/00153, or a less reactogenic composition where the QS21 is quenched with cholesterol as disclosed in WO 96/33739. A particularly potent adjuvant formulation involving QS21, 3D-MPL and tocopherol in an oil in water emulsion is described in WO 95/17210, and is a preferred formulation. Preferably the vaccine additionally comprises a saponin, more preferably QS21. The formulation may also comprise an oil in water emulsion and tocopherol (WO 95/17210). The present invention also provides a method for producing a vaccine formulation comprising mixing a protein of the present invention together with a pharmaceutically acceptable excipient, such as 3D-MPL. Unmethylated CpG containing oligonucleotides (WO 96/02555) are also preferential inducers of a TH1 response and are suitable for use in the present invention.
[0113] The compositions of the invention may contain an oil in water emulsion, since these have been suggested to be useful as adjuvant compositions (EP 399843; WO 95/17210). Oil in water emulsions such as those described in WO95/17210 (which discloses oil in water emulsions comprising from 2 to 10% squalene, from 2 to 10% alpha tocopherol and from 0.3 to 3% tween 80 and their use alone or in combination with QS21 and/or 3D-MPL), WO99/12565 (which discloses oil in water emulsion compositions comprising a metabolisable oil, a saponin and a sterol and MPL) or WO99/11241 may be used. Further oil in water emulsions such as those disclosed in WO 09/127676 and WO 09/127677 are also suitable.
[0114] The vaccine preparations of the present invention may be used to protect or treat a mammal susceptible to infection, by means of administering said vaccine via systemic or mucosal route. These administrations may include injection via the intramuscular, intraperitoneal, intradermal or subcutaneous routes; or via mucosal administration to the oral/alimentary, respiratory, genitourinary tracts. Intranasal administration of vaccines for the treatment of pneumonia or otitis media is preferred (as nasopharyngeal carriage of pneumococci can be more effectively prevented, thus attenuating infection at its earliest stage). Although the vaccine of the invention may be administered as a single dose, components thereof may also be co-administered together at the same time or at different times (for instance pneumococcal polysaccharides could be administered separately, at the same time or 1-2 weeks after the administration of any bacterial protein component of the vaccine for optimal coordination of the immune responses with respect to each other). For co-administration, the optional Th1 adjuvant may be present in any or all of the different administrations, however it is preferred if it is present in combination with the bacterial protein component of the vaccine. In addition to a single route of administration, 2 different routes of administration may be used. For example, polysaccharides may be administered IM (or ID) and bacterial proteins may be administered IN (or ID). In addition, the vaccines of the invention may be administered IM for priming doses and IN for booster doses. The amount of conjugate antigen in each vaccine dose is selected as an amount which induces an immunoprotective response without significant, adverse side effects in typical vaccines. Such amount will vary depending upon which specific immunogen is employed and how it is presented. Generally, it is expected that each dose will comprise 0.1-100 ?g of polysaccharide, preferably 0.1-50 ?g for polysaccharide conjugates, preferably 0.1-10 ?g, more preferably 1-10 ?g, of which 1 to 5 ?g is a more preferable range.
[0115] The content of protein antigens in the vaccine will typically be in the range 1-100 g, preferably 5-50 g, most typically in the range 5-25 g. Following an initial vaccination, subjects may receive one or several booster immunizations adequately spaced.
[0116] Vaccine preparation is generally described in Vaccine Design (The subunit and adjuvant approach (eds Powell M. F. & Newman M. J.) (1995) Plenum Press New York). Encapsulation within liposomes is described by Fullerton, U.S. Pat. No. 4,235,877.
[0117] The vaccines of the present invention may be stored in solution or lyophilized. Preferably the solution is lyophilized in the presence of a sugar such as sucrose, trehalose or lactose. It is still further preferable that they are lyophilized and extemporaneously reconstituted prior to use.
[0118] In an embodiment, the conjugate or PcrV protein of the invention is for use in the treatment of infection, particularly in the treatment of P. aeruginosa infection, for example of a human subject in need thereof.
[0119] A further aspect of the invention is a polynucleotide encoding the PcrV protein of the invention. For example a polynucleotide encoding a PcrV protein, having a nucleotide sequence that encodes a polypeptide with an amino acid sequence that is at least 50%, 60%, 70%, 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98%, 99% or 100% identical to any one of SEQ ID NO: 1-4. A vector comprising such a polynucleotide is a further aspect of the invention.
[0120] A further aspect of the invention is a host cell comprising: [0121] i) A nucleic acid that encodes a glycosyltransferase; [0122] ii) A nucleic acid that encodes an oligosaccharyl transferase; and [0123] iii) A nucleic acid that encodes a P. aeruginosa PcrV protein of the invention.
[0124] Such a a modified prokaryotic host cell comprises nucleic acids encoding enzymes capable of producing a bioconjugate comprising an antigen, for example a saccharide antigen attached to a PcrV protein. Such host cells may naturally express nucleic acids specific for production of a saccharide antigen, or the host cells may be made to express such nucleic acids, i.e., in certain embodiments said nucleic acids are heterologous to the host cells. In certain embodiments, one or more of said nucleic acids specific for production of a saccharide antigen are heterologous to the host cell and intergrated into the genome of the host cell. In certain embodiments, the host cells provided herein comprise nucleic acids encoding additional enzymes active in the N-glycosylation of proteins, e.g., the host cells provided herein further comprise a nucleic acid encoding an oligosaccharyl transferase and/or one or more nucleic acids encoding other glycosyltransferases. In certain embodiments, the host cells provided herein comprise a nucleic acid encoding a carrier protein, e.g., a protein to which oligosaccharides and/or polysaccharides can be attached to form a bioconjugate. In a specific embodiment, the host cell is E. coli.
[0125] Nucleic acid sequences comprising rfb gene clusters that can be inserted into the host cells described herein are known in the art. In a specific embodiment, the rfb gene cluster inserted into a host cell described herein is an rfb gene cluster from E. coli, e.g., an E. coli rfb cluster from any O serogroup/O antigen known in the art, e.g., O1, O2, O3, O4, O5, O6, O7, O8, O9, O10, O11, O12, O13, O14, O15, O16, O17, O18, O19, O20, O21, O22, O23, O24, O25, O26, O27, O28, O29, O30, O32, O33, O34, O35, O36, O37, O38, O39, O40, O41, O42, O43, O44, O45, O46, O48, O49, O50, O51, O52, O53, O54, O55, O56, O57, O58, O59, O60, O61, O62, O63, O64, O65, O66, O68, O69, O70, O71, O73, O74, O75, O76, O77, O78, O79, O80, O81, O82, O83, O84, O85, O86, O87, O88, O89, O90, O91, O92, O93, O95, O96, O97, O98, O99, O100, O101, O102, O103, O104, O105, O106, O107, O108, O109, O110, O111, O112, O113, O114, O115, O116, O117, O118, O119, O120, O121, O123, O124, O125, O126, O127, O128, O129, O130, O131, O132, O133, O134, O135, O136, O137, O138, O139, O140, O141, O142, O143, O144, O145, O146, O147, O148, O149, O150, O151, O152, O153, O154, O155, O156, O157, O158, O159, O160, O161, O162, O163, O164, O165, O166, O167, O168, O169, O170, O171, O172, O173, O174, O175, O176, O177, O178, O179, O180, O181, O182, O183, O184, O185, O186, or O187, and subserotypes thereof. In another specific embodiment, the rfb gene cluster inserted into a host cell described herein is an rfb gene cluster from a Pseudomonas strain (e.g., a P. aeruginosa strain), a Salmonella strain (e.g., a S. enterica strain), a Yersinia strain, a Klebsiella pneumoniae strain, a Francisella strain (e.g., F. tularensis), an Acinetobacterbaumannii strain, a Burkholderia strain, or a Shigella strain.
[0126] Nucleic acid sequences comprising capsular polysaccharide gene clusters that can be inserted into the host cells described herein are known in the art. In a specific embodiment, the capsular polysaccharide gene cluster inserted into a host cell described herein is a capsular polysaccharide gene cluster from an E. coli strain, a Streptococcus strain (e.g., S. pneumoniae, S. pyrogenes, S. agalacticae), a Staphylococcus strain (e.g. S. aureus), or a Burkholderia strain (e.g. B. mallei, B. pseudomallei, B. thailandensis). Disclosures of methods for making such host cells which are capable of producing conjugates are found in WO 06/119987, WO 09/104074, WO 11/62615, WO 11/138361, WO 14/57109, WO14/72405.
[0127] In a specific embodiment, provided herein is a modified prokaryotic host cell comprising nucleic acids encoding enzymes capable of producing a bioconjugate comprising a saccharide antigen, wherein said host cell comprises an rfb cluster from Pseudomonas or a glycosyltransferase derived from an rfb cluster from Pseudomonas. In a specific embodiment, said rfb cluster from Pseudomonas or glycosyltransferase derived from an rfb cluster from Pseudomonas is integrated into the genome of said host cell. In another specific embodiment, said rfb cluster from Pseudomonas or glycosyltransferase derived from an rfb cluster from Pseudomonas is an rfb cluster from Pseudomonas aeruginosa. In another specific embodiment, said host cell comprises a nucleic acid encoding an oligosaccharyl transferase (e.g., pgIB from Campylobacterjejuni). In another specific embodiment, said nucleic acid encoding an oligosaccharyl transferase (e.g., pgIB from Campylobacterjejuni) is integrated into the genome of the host cell. In a specific embodiment, said host cell comprises a nucleic acid encoding a carrier protein. In another specific embodiment, the host cell is E. coli.
[0128] In another specific embodiment, provided herein is a modified prokaryotic host cell comprising (i) an rfb cluster from Pseudomonas, wherein said rfb cluster is integrated into the genome of said host cell; (ii) a nucleic acid encoding an oligosaccharyl transferase (e.g., pgIB from Campylobacter jejuni), wherein said nucleic acid encoding an oligosaccharyl transferase is integrated into the genome of the host cell; and (iii) a carrier protein, wherein said carrier protein is either plasmid-borne or integrated into the genome of the host cell. In another specific embodiment, said rfb cluster from Pseudomonas is an rfb cluster from Pseudomonas aeruginosa. In another specific embodiment, the host cell is E. coli.
[0129] In another specific embodiment, provided herein is a modified prokaryotic host cell comprising (i) a glycosyltransferase derived from an rfb cluster from Pseudomonas, wherein said glycosyltransferase is integrated into the genome of said host cell; (ii) a nucleic acid encoding an oligosaccharyl transferase (e.g., pgIB from Campylobacter jejuni), wherein said nucleic acid encoding an oligosaccharyl transferase is integrated into the genome of the host cell; and (iii) a carrier protein, wherein said carrier protein is either plasmid-borne or integrated into the genome of the host cell. In another specific embodiment, said glycosyltransferase derived from an rfb cluster from Pseudomonas is an rfb cluster from Pseudomonas aeruginosa. In another specific embodiment, the host cell is E. coli.
[0130] In a specific embodiment, the rfb cluster from Pseudomonas or glycosyltransferase derived from an rfb cluster from Pseudomonas is an rfb cluster or glycosyltransferase from Pseudomonas aeruginosa. In another specific embodiment, said rfb cluster from Pseudomonas or glycosyltransferase derived from an rfb cluster from Pseudomonas is an rfb cluster or glycosyltransferase from Pseudomonas aeruginosa serotype O1, O2, O3, O4, O5, O6, O7, O8, O9, O10, O11, O12, O13, O14, O15, O16, O17, O18, O19, or O20. In another specific embodiment, said rfb cluster from Pseudomonas aeruginosa is the rfb cluster from any one of the serotypes described in Knirel et al., 2006, Journal of Endotoxin Research 12(6):324-336, the disclosure of which is incorporated herein by reference in its entirety. In a specific embodiment, said rfb cluster from Pseudomonas or glycosyltransferase derived from an rfb cluster from Pseudomonas is an rfb cluster or glycosyltransferase from Pseudomonas aeruginosa serotype O6 PAK strain. In a specific embodiment, said rfb cluster from Pseudomonas or glycosyltransferase derived from an rfb cluster from Pseudomonas is an rfb cluster or glycosyltransferase from Pseudomonas aeruginosa serotype O11, e.g., Pseudomonas aeruginosa strain PA103 (see, e.g., Genbank Accession No. KF364633.1). In a specific embodiment, the genes encoding a formyltransferase enzyme (GenBank: EOT23134.1; NCBI protein ID: PAK_01412; SEQ ID NO:2) and a wzy polymerase (GenBank: EOT19368.1; NCBI protein ID: PAK_01823; SEQ ID NO:3) are introduced (e.g., via plasmid or integration) in addition to said rfb cluster from Pseudomonas aeruginosa serotype O6 PAK strain in order to functionally extend it.
[0131] In a specific embodiment, a modified prokaryotic host cell provided herein comprises a nucleic acid that encodes a formyltransferase. In another specific embodiment, said formyltransferase is the formyltransferase presented in SEQ ID NO:65, or a homolog thereof. In another specific embodiment, said formyltransferase is incorporated (e.g., inserted into the genome of or plasmid expressed by) in said host cell as part of a Pseudomonas rfb cluster, wherein said Pseudomonas rfb cluster has been modified to comprise the formyltransferase. In another specific embodiment, said Pseudomonas rfb cluster is a Pseudomonas aeruginosa serotype O6 rfb cluster.
[0132] In another specific embodiment, a modified prokaryotic host cell provided herein comprises a nucleic acid that encodes a wzy polymerase. In another specific embodiment, said wzy polymerase is the wzy polymerase presented in SEQ ID NO:66, or a homolog thereof. In another specific embodiment, said wzy polymerase is incorporated (e.g., inserted into the genome of or plasmid expressed by) in said host cell as part of a Pseudomonas rfb cluster, wherein said Pseudomonas rfb cluster has been modified to comprise the wzy polymerase. In another specific embodiment, said Pseudomonas rfb cluster is a Pseudomonas aeruginosa serotype O6 rfb cluster.
[0133] In another specific embodiment, a modified prokaryotic host cell provided herein comprises (i) a nucleic acid that encodes a formyltransferase and (ii) a nucleic acid that encodes a wzy polymerase. In a specific embodiment, said formyltransferase is the formyltransferase presented in SEQ ID NO:65, or a homolog thereof having at least 85%, 90% or 95% identity to SEQ ID NO:65. In another specific embodiment, said wzy polymerase is the wzy polymerase presented in SEQ ID NO:66, or a homolog thereof having at least 85%, 90% or 95% identity to SEQ ID NO:66. In a specific embodiment, said formyltransferase and said wzy polymerase are incorporated (e.g., inserted into the genome of or plasmid expressed by) in said host cell as part of a Pseudomonas rfb cluster, wherein said Pseudomonas rfb cluster has been modified to comprise the formyltransferase and wzy polymerase. In another specific embodiment, said Pseudomonas rfb cluster is a Pseudomonas aeruginosa serotype O6 rfb cluster.
[0134] Nucleic acids that encode formyltransferases and nucleic acids that encode wzy polymerases that are use to generate modified Pseudomonas rfb clusters, e.g., modified Pseudomonas aeruginosa serotype O6 rfb clusters, can be inserted into the rfb cluster at multiple positions and in multiple orientations.
[0135] In a specific embodiment, the gene encoding said formyltransferase and/or the gene encoding said wzy polymerase is/are inserted downstream of the genes of the Pseudomonas rfb cluster, e.g., the Pseudomonas aeruginosa serotype O6 rfb cluster. In a specific emnodiment, the gene encoding said formyltransferase and/or the gene encoding said wzy polymerase is/are inserted downstream of the wbpM gene of the Pseudomonas aeruginosa serotype O6 rfb cluster.
[0136] In a specific embodiment, the gene encoding said formyltransferase and/or the gene encoding said wzy polymerase is/are inserted upstream of the genes of the Pseudomonas rfb cluster, e.g., the Pseudomonas aeruginosa serotype O6 rfb cluster. In a specific emnodiment, the gene encoding said formyltransferase and/or the gene encoding said wzy polymerase is/are inserted downstream of the wzz gene of the Pseudomonas aeruginosa serotype O6 rfb cluster.
[0137] In a specific embodiment, the gene encoding said formyltransferase and/or the gene encoding said wzy polymerase is/are inserted in a clockwise orientation relative to the genes of the Pseudomonas rfb cluster, e.g., the Pseudomonas aeruginosa serotype O6 rfb cluster.
[0138] In a specific embodiment, the gene encoding said formyltransferase and/or the gene encoding said wzy polymerase is/are inserted in a counter-clockwise orientation relative to the genes of the Pseudomonas rfb cluster, e.g., the Pseudomonas aeruginosa serotype O6 rfb cluster.
[0139] In a specific embodiment, provided herein is a modified prokaryotic host cell comprising nucleic acids encoding enzymes capable of producing a bioconjugate comprising a Pseudomonas O6 antigen. In a specific embodiment, said host cell comprises the Pseudomonas aeruginosa serotype O6 rfb cluster, a nucleic acid encoding a wzy polymerase, and a formyltransferase. In a specific embodiment, the wzy polymerase is the P. aeruginosa O6 wzy polymerase (SEQ ID NO:66), or a homolog thereof (e.g., the wzy polymerase from the PAK or LESB58 strain of Pseudomonas aeruginosa). In another specific embodiment, the formyltransferase is the P. aeruginosa O6 formyltransferase (SEQ ID NO:65), or a homolog thereof (e.g., the formyltransferase from the PAK or LESB58 strain of Pseudomonas aeruginosa). In certain embodiments, one or more of the nucleic acids encoding the rfb cluster, the wzy polymerase, and/or the formyltransferase are inserted into the genome of the host cell, e.g., using a method described herein. In a specific embodiment, each of the nucleic acids encoding the rfb cluster, the wzy polymerase, and the formyltransferase are inserted into the genome of the host cell, e.g., using a method described herein. In certain embodiments, the host cell further comprises a nucleic acid encoding an oligosaccharyl transferase (e.g., pgIB from Campylobacterjejuni), wherein said nucleic acid encoding an oligosaccharyl transferase is either plasmid-borne or integrated into the genome of the host cell; and a nucleic acid encoding a carrier protein, wherein said nucleic acid encoding said carrier protein is either plasmid-borne or integrated into the genome of the host cell. In a specific embodiment, said nucleic acid encoding said oligosaccharyl transferase is integrated into the genome of the host cell.
[0140] Genetic Background
[0141] Exemplary host cells that can be used to generate the modified host cells described herein include, without limitation, Escherichia species, Shigella species, Klebsiella species, Xhantomonas species, Salmonella species, Yersinia species, Lactococcus species, Lactobacillus species, Pseudomonas species, Corynebacterium species, Streptomyces species, Streptococcus species, Staphylococcus species, Bacillus species, and Clostridium species. In a specific embodiment, the host cell used herein is E. coli.
[0142] In certain embodiments, the host cell genetic background is modified by, e.g., deletion of one or more genes. Exemplary genes that can be deleted in host cells (and, in some cases, replaced with other desired nucleic acid sequences) include genes of host cells involved in glycolipid biosynthesis, such as waaL (see, e.g., Feldman et al., 2005, PNAS USA 102:3016-3021), the O antigen cluster (rfb or wb), enterobacterial common antigen cluster (wec), the lipid A core biosynthesis cluster (waa), and prophage O antigen modification clusters like the gtrABS cluster. In a specific embodiment, the host cells described herein are modified such that they do not produce any O antigens other than a desired O antigen from, e.g., an O antigen Pseudomonas. In a specific embodiment, one or more of the waaL gene, gtrA gene, gtrB gene, gtrS gene, or a gene or genes from the wec cluster or a gene or genes from the rfb gene cluster are deleted or functionally inactivated from the genome of a prokaryotic host cell provided herein. In one embodiment, a host cell used herein is E. coli, wherein the waaL gene, gtrA gene, gtrB gene, gtrS gene are deleted or functionally inactivated from the genome of the host cell. In another embodiment, a host cell used herein is E. coli, wherein the waaL gene and gtrS gene are deleted or functionally inactivated from the genome of the host cell. In another embodiment, a host cell used herein is E. coli, wherein the waaL gene and genes from the wec cluster are deleted or functionally inactivated from the genome of the host cell.
[0143] Carrier Proteins
[0144] Any carrier protein suitable for use in the production of conjugate vaccines (e.g., bioconjugates for use in vaccines) can be used herein, e.g., nucleic acids encoding the carrier protein can be introduced into a host provided herein for the production of a bioconjugate comprising a carrier protein linked to Pseudomonas antigen. Exemplary carrier proteins include, without limitation, detoxified Exotoxin A of P. aeruginosa (EPA; see, e.g., Ihssen, et al., (2010) Microbial cell factories 9, 61), CRM197, maltose binding protein (MBP), Diphtheria toxoid, Tetanus toxoid, detoxified hemolysin A of S. aureus, clumping factor A, clumping factor B, E. coli FimH, E. coli FimHC, E. coli heat labile enterotoxin, detoxified variants of E. coli heat labile enterotoxin, Cholera toxin B subunit (CTB), cholera toxin, detoxified variants of cholera toxin, E. coli Sat protein, the passenger domain of E. coli Sat protein, Streptococcus pneumoniae Pneumolysin and detoxified variants thereof, C. jejuni AcrA, Pseudomonas PcrV protein, and C. jejuni natural glycoproteins. The PcrV protein is used in many embodiments of the invention.
[0145] In specific embodiments, the carrier proteins expressed by the modified host cells provided herein are expressed from a nucleic acid that has been integrated into the genome of the modified host cell. That is, a nucleic acid encoding the carrier protein has been integrated into the host cell genome. In certain embodiments, the carrier proteins expressed by the modified host cells provided herein are expressed from a plasmid that has been introduced into the modified host cell.
[0146] In certain embodiments, the carrier proteins used in the generation of the bioconjugates described herein are modified, e.g., modified in such a way that the protein is less toxic and/or more susceptible to glycosylation. In a specific embodiment, the carrier proteins used in the generation of the bioconjugates described herein are modified such that the number of glycosylation sites in the carrier proteins is maximized in a manner that allows for lower concentrations of the protein to be administered, e.g., in an immunogenic composition, in its bioconjugate form.
[0147] In certain embodiments, the carrier proteins described herein are modified to include 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more glycosylation sites than would normally be associated with the carrier protein (e.g., relative to the number of glycosylation sites associated with the carrier protein in its native/natural, e.g., wild-type state). In specific embodiments, introduction of glycosylation sites is accomplished by insertion of glycosylation consensus sequences (e.g., Asn-X-Ser(Thr), wherein X can be any amino acid except Pro; or Asp(Glu)-X-Asn-Z-Ser(Thr), wherein X and Z are independently selected from any natural amino acid except Pro (see WO 2006/119987)) anywhere in the primary structure of the protein. Introduction of such glycosylation sites can be accomplished by, e.g., adding new amino acids to the primary structure of the protein (i.e., the glycosylation sites are added, in full or in part), or by mutating existing amino acids in the protein in order to generate the glycosylation sites (i.e., amino acids are not added to the protein, but selected amino acids of the protein are mutated so as to form glycosylation sites). Those of skill in the art will recognize that the amino acid sequence of a protein can be readily modified using approaches known in the art, e.g., recombinant approaches that include modification of the nucleic acid sequence encoding the protein. In specific embodiments, glycosylation consensus sequences are introduced into specific regions of the carrier protein, e.g., surface structures of the protein, at the N or C termini of the protein, and/or in loops that are stabilized by disulfide bridges at the base of the protein. In certain embodiments, the classical 5 amino acid glycosylation consensus sequence may be extended by lysine residues for more efficient glycosylation, and thus the inserted consensus sequence may encode 5, 6, or 7 amino acids that should be inserted or that replace acceptor protein amino acids.
[0148] In certain embodiments, the carrier proteins used in the generation of the bioconjugates described herein comprise a tag, i.e., a sequence of amino acids that allows for the isolation and/or identification of the carrier protein. For example, adding a tag to a carrier protein described herein can be useful in the purification of that protein and, hence, the purification of conjugate vaccines comprising the tagged carrier protein. Exemplary tags that can be used herein include, without limitation, histidine (HIS) tags (e.g., hexa histidine-tag (SEQ ID NO: 69), or 6XHis-Tag (SEQ ID NO: 69)), FLAG-TAG, and HA tags. In certain embodiments, the tags used herein are removable, e.g., removal by chemical agents or by enzymatic means, once they are no longer needed, e.g., after the protein has been purified.
[0149] In certain embodiments, the carrier proteins described herein comprise a signal sequence that targets the carrier protein to the periplasmic space of the host cell that expresses the carrier protein. In a specific embodiment, the signal sequence is from E. coli DsbA, E. coli outer membrane porin A (OmpA), E. coli maltose binding protein (MalE), Erwinia carotovorans pectate lyase (PeIB), Flgl, NikA, or Bacillus sp. endoxylanase (XynA), heat labile E. coli enterotoxin LTIlb, Bacillus endoxylanase XynA, or E. coli flagellin (Flgl).
[0150] Glycosylation Machinery
[0151] Oligosaccharyl Transferases
[0152] Oligosaccharyl transferases transfer lipid-linked oligosaccharides to asparagine residues of nascent polypeptide chains that comprise an N-glycoxylation consensus motif, e.g., Asn-X-Ser(Thr), wherein X can be any amino acid except Pro; or Asp(Glu)-X-Asn-Z-Ser(Thr), wherein X and Z are independently selected from any natural amino acid except Pro (see WO 2006/119987). See, e.g., WO 2003/074687 and WO 2006/119987, the disclosures of which are herein incorporated by reference in their entirety.
[0153] In certain embodiments, the host cells provided herein comprise a nucleic acid that encodes an oligosaccharyl transferase. The nucleic acid that encodes an oligosaccharyl transferase can be native to the host cell, or can be introduced into the host cell using genetic approaches, as described above. The oligosaccharyl transferase can be from any source known in the art. In a specific embodiment, the oligosaccharyl transferase is an oligosaccharyl transferase from Campylobacter. In another specific embodiment, the oligosaccharyl transferase is an oligosaccharyl transferase from Campylobacter jejuni (i.e., pgIB; see, e.g., Wacker et al., 2002, Science 298:1790-1793; see also, e.g., NCBI Gene ID: 3231775, UniProt Accession No. 086154). In another specific embodiment, the oligosaccharyl transferase is an oligosaccharyl transferase from Campylobacter lari (see, e.g., NCBI Gene ID: 7410986).
[0154] In a specific embodiment, the modified host cells provided herein comprise a nucleic acid sequence encoding an oligosaccharyl transferase, wherein said nucleic acid sequence encoding an oligosaccharyl transferase is integrated into the genome of the host cell.
[0155] Accessory Enzymes
[0156] In certain embodiments, nucleic acids encoding one or more accessory enzymes are introduced into the modified host cells described herein. Such nucleic acids encoding one or more accessory enzymes can be either plasmid-borne or integrated into the genome of the host cells described herein. Exemplary accessory enzymes include, without limitation, epimerases, branching, modifying, amidating, chain length regulating, acetylating, formylating, polymerizing enzymes.
[0157] Nucleic acid sequences encoding epimerases that can be inserted into the host cells described herein are known in the art. In certain embodiments, the epimerase inserted into a host cell described herein is an epimerase described in International Patent Application Publication No. WO 2011/062615, the disclosure of which is incorporated by reference herein in its entirety. In a specific embodiment, the epimerase is the epimerase encoded by the Z3206 gene of E. coli strain O157. See, e.g., WO 2011/062615 and Rush et al., 2009, The Journal of Biological Chemistry 285:1671-1680, which is incorporated by reference herein in its entirety. In a specific embodiment, the modified host cells provided herein comprise a nucleic acid sequence encoding an epimerase, wherein said nucleic acid sequence encoding an epimerase is integrated into the genome of the host cell.
[0158] In certain embodiments, a nucleic acid sequence encoding a formyltransferase is inserted into or expressed by the host cells described herein. Formyltransferases are enzymes that catalyse the transfer of a formyl group to an acceptor molecule. In a specific embodiment, a nucleic acid sequence encoding the Pseudomonas aeruginosa O6 formyltransferase fmtO6 (SEQ ID NO:65), or a homolog thereof, is inserted into or expressed by the host cells described herein. In another specific embodiment, a nucleic acid sequence that encodes a protein having about or at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity or homology to SEQ ID NO:65 is inserted into or expressed by the host cells described herein.
[0159] Certain formyltransferases involved in polysaccharide biosynthesis are known, and can be inserted into or expressed by the host cells described herein. For example, vioF is an enzyme from P. alcalifaciens serotype O30, which is 48% identical to the formyltransferase from Francisella tularensis (Nagaraja et al. 2005). It converts dTDP-D-Qui4N to dTDP-D-Qui4NFo, and is involved in O-antigen biosynthesis (Liu et al. 2012, Glycobiology 22(9):1236-1244). Another formyltransferase involved in polysaccharide biosynthesis is amA (e.g., from E. coli), a bifunctional enzyme in which the N-terminal domain converts UDP-Ara4N to UDP-AraNFo, while the C-terminal domain is involved in oxidative decarboxylation of UDP-glucuronic acid. Both enzymatic activities are required for L-Ara4N modification of LipidA and polymyxin resistance (Breazeale et al., 2005, The Journal of Biological Chemistry 280(14):14154-14167). Another formyltransferase involved in polysaccharide biosynthesis is wekD, an enzyme from E. coli serotype 0119, involved in the biosynthesis of TDP-DRhaNAc3NFo (Anderson et al., 1992, Carbohydr Res. 237:249-62).
[0160] Further, domains that are related to formyltransferase activity have been characterized. The so called FMT_core domain is present in the majority of formyltransferases. Examples include the methionyl-tRNA formyltransferase, phosphoribosylglycinamide formyltransferase 1, UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase, vioF from Providencia alcalifaciens O30, and amA from E. coli. The above mentioned formyltransferases use FTHF (N-10-formyltetrahydrofolate) as formyl donor. Also, formate producing enzymes using FTHF (10-formyltetrahydrofolate) as substrate contain this domain. In addition, AICARFT is present in phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase and FDH_GDH is present in phosphoribosylglycinamide formyltransferase 2.
[0161] In certain embodiments, a nucleic acid sequence encoding an O antigen polymerase (wzy gene) is inserted into or expressed by the host cells described herein. O antigen polymerases are multi spanning transmembrane proteins. They use undecaprenylpyrophosphate bound O antigen repeat units as substrates to generate a linear polymer constisting of the repeat units. O antigen polymerases (wzy) are present in Gram negative bacteria that synthesize O antigen polymers via a wzy dependent mechanism.
[0162] In a specific embodiment, a nucleic acid sequence encoding the Pseudomonas aeruginosa wzy polymerase (SEQ ID NO:66), or a homolog thereof (e.g., the wzy polymerase from the PAK or LESB58 strain of Pseudomonas aeruginosa), is inserted into or expressed by the host cells described herein. Examples of bacteria known to comprise wzy polymerases include Escherichia coli, Pseudomonas aeruginosa, Shigella flexneri and Salmonella typhimurium. In another specific embodiment, a nucleic acid sequence that encodes a protein having about or at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity or homology to SEQ ID NO:66 is inserted into or expressed by the host cells described herein.
[0163] Gene Copy Number
In certain embodiments, the copy number of a gene(s) integrated into a modified host cell provided herein is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In a specific embodiment, the copy number of a gene(s) integrated into a modified host cell provided herein is 1 or 2.
[0164] Benefits
[0165] The modified host cells described herein are of particular commercial importance and relevance, as they allow for large scale fermentation of bioconjugates comprising saccharide, for example, Pseudomonas antigens that can be used as therapeutics (e.g., in immunogenic compositions, vaccines), at a lower risk due to the increased stability of the chromosomally inserted DNA and thus expression of the DNA of interest during fermentation. The modified host cells described herein are advantageous over host cells that rely on plasmid borne expression of nucleic acids required for generation of the bioconjugates described herein because, interalia, antibiotic selection during fermentation is not required once the heterologous DNA is inserted into the host cell genome. That is, when the insert DNA is inserted in the chromosome, it doesn't need to be selected for, because it is propagated along with replication of the host genome. Further, it is a known disadvantage in plasmid borne systems that with every generation (i.e., cycle of host cell replication) the risk for losing the plasmid increases. This loss of plasmid is due to the sometimes inappropriate distribution of plasmids to daughter cells at the stage of cell separation during cell division. At large scale, bacterial cell cultures duplicate more often than in smaller fermentation scales to reach high cell densities. Thus, higher cell stability and insert DNA expression leads to higher product yields, providing a distinct advantage. Cell stability is furthermore a process acceptance criteria for approval by regulatory authorities, while antibiotic selection is generally not desired during fermentation for various reasons, e.g., antibiotics present as impurities in the final medicial products and bear the risk of causing allergic reactions, and antibiotics may promote antibiotic resistance (e.g., by gene transfer or selection of resistant pathogens).
[0166] The present application provides modified host cells for use in making bioconjugates comprising saccharide antigens that can be used as therapeutics (e.g., in immunogenic compositions, vaccines), wherein certain genetic elements required to drive the production of bioconjugates are integrated stably into the host cell genome. Consequently the host cell can contain a reduced number of plasmids, just a single plasmid or no plasmids at all. In some embodiments, the presence of a single plasmid can result in greater flexibility of the production strain and the ability to change the nature of the conjugation (in terms of its saccharide or carrier protein content) easily leading to greater flexibility of the production strain.
[0167] In general, a reduction in the use of plasmids leads to a production strain which is more suited for use in the production of medicinal products. A drawback of essential genetic material being present on plasmids is the requirement for selection pressure to maintain the episomal elements in the host cell. The selection pressure requires the use of antibiotics, which is undesirable for the production of medicinal products due to, e.g., the danger of allergic reactions against the antibiotics and the additional costs of manufacturing. Furthermore, selection pressure is often not complete, resulting in inhomogeneous bacterial cultures in which some clones have lost the plasmid and thus are not producing the bioconjugate. The host cells described herein therefore are able to produce a safer product that can be obtained in high yields.
[0168] Bioconjugates
[0169] The modified host cells described herein can be used to produce bioconjugates comprising a saccharide antigen, for example a Pseudomonas antigen linked to a carrier protein. Methods of producing bioconjugates using host cells are known in the art. See, e.g., WO 2003/074687 and WO 2006/119987. Bioconjugates, as described herein, have advantageous properties over chemical conjugates of antigen-carrier protein, in that they require less chemicals in manufacture and are more consistent in terms of the final product generated.
[0170] In a specific embodiment, provided herein is a bioconjugate comprising a carrier protein linked to a Pseudomonas antigen. In a specific embodiment, said Pseudomonas antigen is an O antigen of Pseudomonas aeruginosa. In a specific embodiment, provided herein is a bioconjugate comprising a P. aeruginosa O antigen and a carrier protein, wherein said carrier protein is EPA, PcrV (aka LcrV,EspA, SseB), PopB (YopB, YopD, FliC), or OprF, OprI. The exemplified embodiments use EPA and PcrV as carrier protein.
[0171] In a specific embodiment, provided herein is a bioconjugate comprising a carrier protein linked to a Pseudomonas aeruginosa O antigen, wherein said Pseudomonas aeruginosa O antigen is an O antigen from Pseudomonas aeruginosa serotype O1, O2, O3, O4, O5, O6, O7, O8, O9, O10, O11, O12, O13, O14, O15, O16, O17, O18, O19, or O20.
[0172] In a specific embodiment, provided herein is a bioconjugate comprising a carrier protein linked to a Pseudomonas aeruginosa O antigen, wherein said Pseudomonas aeruginosa O antigen is one of the serotypes described in Knirel et al., 2006, Journal of Endotoxin Research 12(6):324-336, the disclosure of which is incorporated herein by reference in its entirety.
[0173] In a specific embodiment, provided herein is a bioconjugate comprising a carrier protein linked to a Pseudomonas aeruginosa O antigen, wherein said Pseudomonas aeruginosa O antigen is an O antigen from Pseudomonas aeruginosa serotype O6.
[0174] In a specific embodiment, provided herein is a bioconjugate comprising a carrier protein linked to a Pseudomonas aeruginosa O antigen, wherein said Pseudomonas aeruginosa O antigen is an O antigen from Pseudomonas aeruginosa serotype O11. In a specific embodiment, said O antigen from Pseudomonas aeruginosa serotype O11 is from Pseudomonas aeruginosa strain PA103 (see, e.g., Genbank Accession No. KF364633.1).
[0175] The bioconjugates described herein can be purified by any method known in the art for purification of a protein, for example, by chromatography (e.g., ion exchange, anionic exchange, affinity, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins. See, e.g., Saraswat et al., 2013, Biomed. Res. Int. ID #312709 (p. 1-18); see also the methods described in WO 2009/104074. Further, the bioconjugates may be fused to heterologous polypeptide sequences described herein or otherwise known in the art to facilitate purification. The actual conditions used to purify a particular bioconjugate will depend, in part, on the synthesis strategy and on factors such as net charge, hydrophobicity, and/or hydrophilicity of the bioconjugate, and will be apparent to those having skill in the art.
[0176] Analytical Methods
[0177] Various methods can be used to analyze the structural compositions and sugar chain lengths of the bioconjugates described herein.
[0178] In one embodiment, hydrazinolysis can be used to analyze glycans. First, polysaccharides are released from their protein carriers by incubation with hydrazine according to the manufacturer's instructions (Ludger Liberate Hydrazinolysis Glycan Release Kit, Oxfordshire, UK). The nucleophile hydrazine attacks the glycosidic bond between the polysaccharide and the carrier protein and allows release of the attached glycans. N-acetyl groups are lost during this treatment and have to be reconstituted by re-N-acetylation. The free glycans are purified on carbon columns and subsequently labeled at the reducing end with the fluorophor 2-amino benzamide. See Bigge J C, Patel T P, Bruce J A, Goulding P N, Charles S M, Parekh R B: Nonselective and efficient fluorescent labeling of glycans using 2-amino benzamide and anthranilic acid. Anal Biochem 1995, 230(2):229-238. The labeled polysaccharides are separated on a GlycoSep-N column (GL Sciences) according to the HPLC protocol of Royle et al. See Royle L, Mattu T S, Hart E, Langridge J I, Merry A H, Murphy N, Harvey D J, Dwek R A, Rudd P M: An analytical and structural database provides a strategy for sequencing O-glycans from microgram quantities of glycoproteins. Anal Biochem 2002, 304(1):70-90. The resulting fluorescence chromatogram indicates the polysaccharide length and number of repeating units. Structural information can be gathered by collecting individual peaks and subsequently performing MS/MS analysis. Thereby the monosaccharide composition and sequence of the repeating unit could be confirmed and additionally in homogeneity of the polysaccharide composition could be identified.
[0179] In another embodiment, SDS-PAGE or capillary gel electrophoresis can be used to assess glycans and bioconjugates. Polymer length for the O antigen glycans is defined by the number of repeat units that are linearly assembled. This means that the typical ladder like pattern is a consequence of different repeat unit numbers that compose the glycan. Thus, two bands next to each other in SDS PAGE or other techniques that separate by size differ by only a single repeat unit. These discrete differences are exploited when analyzing glycoproteins for glycan size: The unglycosylated carrier protein and the bioconjugate with different polymer chain lengths separate according to their electrophoretic mobilities. The first detectable repeating unit number (n.sub.1) and the average repeating unit number (n.sub.average) present on a bioconjugate are measured. These parameters can be used to demonstrate batch to batch consistency or polysaccharide stability.
[0180] In another embodiment, high mass MS and size exclusion HPLC could be applied to measure the size of the complete bioconjugates.
[0181] In another embodiment, an anthrone-sulfuric acid assay can be used to measure polysaccharide yields. See Leyva A, Quintana A, Sanchez M, Rodriguez E N, Cremata J, Sanchez J C: Rapid and sensitive anthrone-sulfuric acid assay in microplate format to quantify carbohydrate in biopharmaceutical products: method development and validation. Biologicals: journal of the International Association of Biological Standardization 2008, 36(2):134-141. In another embodiment, a Methylpentose assay can be used to measure polysaccharide yields. See, e.g., Dische et al., J Biol Chem. 1948 September; 175(2):595-603.
[0182] Change in Glycosylation Site Usage
[0183] To show that the site usage in a specific protein is changed in a multiple plasmid system as opposed to an inserted system, the glycosylation site usage must be quantified. Methods to do so are listed below.
[0184] Glycopeptide LC-MS/MS: bioconjugates are digested with protease(s), and the peptides are separated by a suitable chromatographic method (C18, Hydriphilic interaction HPLC HILIC, GlycoSepN columns, SE HPLC, AE HPLC), and the different peptides are identified using MS/MS. This method can be used with our without previous sugar chain shortening by chemical (smith degradation) or enzymatic methods. Quantification of glycopeptide peaks using UV detection at 215 to 280 nm allow relative determination of glycosylation site usage.
[0185] Size exclusion HPLC: Higher glycosylation site usage is reflected by a earlier elution time from a SE HPLC column.
[0186] Homogeneity
[0187] Bioconjugate homogeneity (i.e., the homogeneity of the attached sugar residues) can be assessed using methods that measure glycan length and hydrodynamic radius.
[0188] Other Potential Clinical/Practical Applications
[0189] Integrated strains can make a higher yield of bioconjugates due to the reduced antibiotic selection burden as compared to the three plasmid system. In addition, less proteolytic degradation occurs due to reduced metabolic burden to the cells.
[0190] Integrated strains make bioconjugates with shorter, less spread polysaccharide length distributions. Thus, the bioconjugates are easier to characterize and are better defined. In addition, insertion may reduce the extent of periplasmic stress to the cells which may lead to less proteolysis of product during the fermentation process due to the reduced antibiotic selection burden as compared to the three plasmid system.
[0191] Protein glycosylation systems require three recombinant elements in the production host: a carrier protein expression DNA, an oligosaccharyl transferase expression DNA, and a polysaccharide expression DNA. Prior art bacterial production systems contain these three elements on plasmids. Thus, there is a risk for instability during manufacture due to plasmid loss, particularly because antibiotics used for maintenance of the plasmids mustn't be present during fermentation of GMP material. Since inserted strains contain one plasmid less, they are more stable over many generations. This means that higher scale fermentations and longer incubation times (higher generation numbers) are more feasible. In addition, the absence of an antibiotic for selection makes a safer product, due to the absence of trace antibiotics which can cause allergic reactions in sensitive subjects. See COMMITTEE WE, BIOLOGICAL O, STANDARDIZATION: WHO Technical Report Series 941. In: Fifty-sixth Report. Edited by Organization WH. Geneva: World Health Organization; 2007.
[0192] Inserted strains are more genetically stable due to the fixed chromosomal insertion, thus leading to higher reproducibility of desired protein products during the production process, e.g., during culture of host cell comprising inserted heterologous DNA.
[0193] Analytical Methods for Testing Benefit
[0194] Yield. Yield is measured as carbohydrate amount derived from a liter of bacterial production culture grown in a bioreactor under controlled and optimized conditions. After purification of bioconjugate, the carbohydrate yields can be directly measured by either the anthrone assay or ELISA using carbohydrate specific antisera. Indirect measurements are possible by using the protein amount (measured by well known BCA, Lowry, or bardford assays) and the glycan length and structure to calculate a theoretical carbohydrate amount per gram of protein. In addition, yield can also be measured by drying the glycoprotein preparation from a volatile buffer and using a balance to measure the weight.
[0195] Homogeneity. Homogeneity means the variability of glycan length and possibly the number of glycosylation sites. Methods listed above can be used for this purpose. SE-HPLC allows the measurement of the hydrodynamic radius. Higher numbers of glycosylation sites in the carrier lead to higher variation in hydrodynamic radius compared to a carrier with less glycosylation sites. However, when single glycan chains are analyzed, they may be more homogenous due to the more controlled length. Glycan length is measured by hydrazinolysis, SDS PAGE, and CGE. In addition, homogeneity can also mean that certain glycosylation site usage patterns change to a broader/narrower range. These factors can be measured by Glycopeptide LC-MS/MS.
[0196] Strain stability and reproducibility. Strain stability during bacterial fermentation in absence of selective pressure is measured by direct and indirect methods that confirm presence or absence of the recombinant DNA in production culture cells. Culture volume influence can be simulated by elongated culturing times meaning increased generation times. The more generations in fermentation, the more it is likely that a recombinant element is lost. Loss of a recombinant element is considered instability. Indirect methods rely on the association of selection cassettes with recombinant DNA, e.g. the antibiotic resistance cassettes in a plasmid. Production culture cells are plated on selective media, e.g. LB plates supplemented with antibiotics or other chemicals related to a selection system, and resistant colonies are considered as positive for the recombinant DNA associated to the respective selection chemical. In the case of a multiple plasmid system, resistant colonies to multiple antibiotics are counted and the proportion of cells containing all three resistances is considered the stable population. Alternatively, quantitative PCR can be used to measure the amount of recombinant DNA of the three recombinant elements in the presence, absence of selection, and at different time points of fermentation. Thus, the relative and absolute amount of recombinant DNA is measured and compared. Reproducibility of the production process is measured by the complete analysis of consistency batches by the methods stated in this application.
[0197] In an embodiment, there is provided a host cell wherein the nucleic acid that encodes a glycosyltransferase is derived from an rfb cluster of Pseudomonas, wherein said nucleic acid is optionally stably inserted into the genome of the host cell. The rfb cluster is optionally from Pseudomonas aeruginosa, optionally serotype O6 or O11.
[0198] In an embodiment, the host cell comprises an oligosaccharyl transferase derived from Campylobacter, for example wherein the oligosaccharyl transferase is PgIB of C. jejuni.
[0199] In an embodiment, the host cell comprises the nucleic acid that encodes a P. aeruginosa PcrV protein in a plasmid in the host cell.
[0200] In an embodment, the host cell further comprises a formyltranferase enzyme, wherein said nucleic acid encodes a protein having about or at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity or homology to SEQ ID NO:65, or wherein said nucleic acid encodes SEQ ID NO:65.
[0201] In an embodiment, the host cell of the invention, further comprising a nucleic acid that encodes a wzy polymerase, wherein said nucleic acid encodes a protein having about or at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity or homology to SEQ ID NO:66, or wherein said nucleic acid encodes SEQ ID NO:66.
[0202] In an embodiment, he host cell comprises the nucleic acid encoding a formyltransferase enzyme and/or the nucleic acid encoding a wzy polymerase which are stably inserted into the genome of the host cell. Optionally, a gene encoding a formyltransferase enzyme and/or a gene encoding a wzy polymerase is present on a plasmid in the host cell.
[0203] In an embodiment, the host cell is E. coli.
[0204] A further aspect of the invention is a method of producing a bioconjugate that comprises a P. aeruginosa PcrV protein linked to a saccharide, said method comprising culturing the host cell of the invention under condtions suitable for the production of proteins.
[0205] A further aspect of the invention is a bioconjugate produced by the process of the invention, wherein said bioconjugate comprises a saccharide linked to a P. aeruginosa PcrV protein.
[0206] The terms comprising, comprise and comprises herein are intended by the inventors to be optionally substitutable with the terms consisting of, consist of and consists of, respectively, in every instance.
[0207] The term wherein the asparagine residue is situated at a position equivalent to between amino acids . . . of SEQ ID NO: . . . is defined as the asparagine residue being introduced into an amino acid sequence at the position that would be equivalent to the defined position if the reference sequence and the mutated sequence were lined up to maximise the sequence identity between the two sequences. The addition or deletion of amino acids from the mutated sequence could lead to a difference in the actual amino acid position of the asparagine residue in the mutated sequence, however, by lining the mutated sequence up with the reference sequence, the appropriate position for insertion of the asparagine amino acid can be established.
[0208] The term the peptide comprising the D/E-XNXS/T consensus sequence is situated at a position between amino acids . . . of SEQ ID NO: . . . is defined as the consensus sequence being introduced into an amino acid sequence at the position that would be equivalent to the defined position, if the reference sequence and the mutated sequence were lined up to maximise the sequence identity between the two sequences. The addition or deletion of amino acids from the mutated sequence could lead to a difference in the actual amino acid position of the consensus sequence in the mutated sequence, however, by lining the mutated sequence up with the reference sequence, the appropriate position for insertion of the consensus sequence can be established.
[0209] The O-antigens of P. aeruginosa (O-1 to O20) are according to the classification of serotypes according to the IATS nomenclature.
[0210] All references or patent applications cited within this patent specification are incorporated by reference herein.
[0211] In order that this invention may be better understood, the following examples are set forth. These examples are for purposes of illustration only, and are not to be construed as limiting the scope of the invention in any manner.
TABLE-US-00001 Sequencesofproteinsandnucleicacids PcrVproteinwildtypesequence SEQIDNO:1 MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALA WLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYK DVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYA VGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGN FATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI PcrV SEQIDNO:2 AKDQNATKVRNLNAARELFKDQNATKDELLAASKDQNATKAPASAEQEELLALLRSERIV LAHAGQPLSEAQVLKALAWLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVS AYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQG IRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELK GLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQ KYDSVLRDILSAI SEQIDNO:3 MSFKKIIKAFVIMAALVSVQAHAAEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSE RIVLAHAGQPLSEAQVLKALAWLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFL VSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAK QGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSG ELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNR FIQKYDSVLRDILSAI mature SEQIDNO:4 AEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALA WLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYK DVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYA VGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGN FATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI epitopesequence SEQIDNO:5 VYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGK LSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNE SEQIDNO:6 AKDQNATKVRNLNAARELF SEQIDNO:7 VRNKDQNATKNAARELF SEQIDNO:8 VRNLNAAKDQNATKELF SEQIDNO:9 ELFKDQNATKDELLAAS SEQIDNO:10 DELKDQNATKAAS SEQIDNO:11 DELLAASKDQNATKAP SEQIDNO:12 APKDQNATKSAEQEEL SEQIDNO:13 ALLRSEKDQNATKI SEQIDNO:14 ALLRSERIKDQNATKLAH SEQIDNO:15 LAHKDQNATKGQPL SEQIDNO:16 GQPLKDQNATKEAQVLKA SEQIDNO:17 EAKDQNATKVLKALA SEQIDNO:18 VLKALAKDQNATKLLAA SEQIDNO:19 VLKALAWKDQNATKLAA SEQIDNO:20 LAAKDQNATKPSA SEQIDNO:21 PSAKDQNATKPGQG SEQIDNO:22 PSAPPKDQNATKQG SEQIDNO:23 QGKDQNATKEVLR SEQIDNO:24 QGLEKDQNATKLR SEQIDNO:25 LRKDQNATKVLQAR SEQIDNO:26 VLGARKDQNATKQ SEQIDNO:27 VLGARRQKDQNATKGAQW SEQIDNO:28 VLQARRQPGKDQNATKQW SEQIDNO:29 QWKDQNATKLREFLVSAYF SEQIDNO:30 LREFLVSAYFSLKDQNATKG SEQIDNO:31 GKDQNATKLDEDVIGVYKD SEQIDNO:32 KDVLQTKDQNATKDGKRKAL SEQIDNO:33 KYDSVLRDILSAKDQNATK SEQIDNO:34 MSFKKIIKAFVIMAALVSVQAHA SEQIDNO:35 AXD/EXNXS/TXVRNLNAARELF SEQIDNO:36 VRNXD/EXNXS/TXNAARELF SEQIDNO:37 VRNLNAAXD/EXNXS/TXELF SEQIDNO:38 ELFXD/EXNXS/TXDELLAAS SEQIDNO:39 DELXD/EXNXS/TXAAS SEQIDNO:40 DELLAASXD/EXNXS/TXAP SEQIDNO:41 APXD/EXNXS/TXSAEQEEL SEQIDNO:42 ALLRSEXD/EXNXS/TXI SEQIDNO:43 ALLRSERIXD/EXNXS/TXLAH SEQIDNO:44 LAHXD/EXNXS/TXGQPL SEQIDNO:45 GQPLXD/EXNXS/TXEAQVLKA SEQIDNO:46 EAXD/EXNXS/TXVLKALA SEQIDNO:47 VLKALAXD/EXNXS/TXLLAA SEQIDNO:48 VLKALAWXD/EXNXS/TXLAA SEQIDNO:49 LAAXD/EXNXS/TXPSA SEQIDNO:50 PSAXD/EXNXS/TXPGQG SEQIDNO:51 PSAPPXD/EXNXS/TXQG SEQIDNO:52 QGXD/EXNXS/TXEVLR SEQIDNO:53 QGLEXD/EXNXS/TXLR SEQIDNO:54 LRXD/EXNXS/TXVLQAR SEQIDNO:55 VLGARXD/EXNXS/TXQ SEQIDNO:56 VLGARRQXD/EXNXS/TXGAQW SEQIDNO:57 VLQARRQPGXD/EXNXS/TXQW SEQIDNO:58 QWXD/EXNXS/TXLREFLVSAYF SEQIDNO:59 LREFLVSAYFSLXD/EXNXS/TXG SEQIDNO:60 GXD/EXNXS/TXLDEDVIGVYKD SEQIDNO:61 KDVLQTXD/EXNXS/TXDGKRKAL SEQIDNO:62 KYDSVLRDILSAKDQNATK SEQIDNO:63 MSFKKIIKAFVIMAALVSVQAHA D/E-X-N-X-S/T formyltransferase SEQIDNO:65 MetSerTrpGlnLeuPheSerGluLysCysArgPheLeuGlyAlaVal GluIleSerGlnHisPheTrpGlyPheIleValLeuGluAlaSerPhe GlyMetLysIleLysAlaAlaLeuIleValAspAspLeuSerLeuSer GluTrpGlnLysArgAlaIleGluAspSerSerGluTyrLeuAspIle GlnLeuValLeuSerCysArgAsnSerAlaThrLysLysSerValIle LysHisCysGlyTyrTyrPheLeuAsnIleLeuSerLeuLysAsnAsp MetThrArgArgValGlnLeuAspSerArgGlySerGluValIleHis PheAspSerAspTyrGluGlyAlaTrpGlnArgIleProGluAspVal CysAlaArgIleLeuAspLysGlyIleLysLeuValIleLysPheGly MetSerLeuLeuArgIleAspGlyGlyLeuGlnArgLeuAspIleLeu SerTyrHisHisGlyAspProGluTyrTyrArgGlyArgProAlaGly PheTyrGluIleTyrGluAsnAlaAspSerValGlyIleIleValGln LysLeuSerAsnLysLeuAspAlaGlyGluValLeuValArgGlyTyr SerLysValHisHisHisSerTyrLysLysThrSerArgAsnPheTyr LeuAsnSerValValLeuLeuArgLysAlaLeuValAsnTyrSerArg GlyGluGlnValValLeuGluLysLeuGlyLysAsnTyrArgLeuPro SerAsnPheThrValPheLysPhePheCysLysThrIlePheArgGly LeuAlaArgLeuSerTyrGlyAlaPhePheGluLysLysTrpAsnVal ValAlaLeuProTyrAsnAspIleProSerLeuGlnGluLeuSerVal SerAlaGlyLysIleProLysValGluLysGlyTyrThrPheTyrAla AspProPhePheSerAlaAspGlyLysLeuIleArgLeuGluAlaLeu AsnAlaSerAsnGlyLeuGlyGluIleIleGluLeuLysAlaGlnSer LeuAspPheSerArgValIleLeuLysGlyAsnHisPheSerTyrPro TyrSerPheGluAlaSerGlyValGluTyrLeuIleProGluValAla SerHisSerAlaProCysLeuLeuProProProPheAlaLeuGluSer LysLysLeuPheGlnGlyMetGluGlyGluArgIleLeuAspGlyThr LeuPheGluHisGlyGlyArgTyrTyrLeuPheCysGlyGlnAlaVal SerGlySerAspAsnLeuTyrLeuTyrValGlyGluSerLeuGluGly ProTyrThrSerHisProCysAsnProValValMetAsnProGlySer AlaArgMetGlyGlyArgIlePheLysGluGlyGlyLysLeuTyrArg PheGlyGlnAsnAsnSerTyrGlyTyrGlySerSerLeuAlaValAsn GluIleGluValLeuAspProGluHisTyrSerGluLysArgValAla AsnLeuAlaPheGlnAspAlaArgGlyProHisThrIleAspIleHis GlyGlnThrMetIleLeuAspPheTyrGlnAspArgPheSerLeuLeu AlaGlyTyrArgArgLeuValAlaArgLeuLeuSerArgGly wzypolymerase SEQIDNO:66 MetTyrAlaMetLeuThrGlyAlaThrLeuLeuIlePheAlaValAla AlaArgLeuLeuAlaArgSerAlaIleHisProSerValAlaMetPro IleThrTrpGlyLeuGlyLeuIleGlyValSerLeuAlaSerLeuIle GlyPheTyrArgValGluSerAspAlaLeuLeuIlePheLeuPheGly ValMetSerPheSerLeuSerAlaGlyCysPheSerPheLeuTyrAsn GlyTyrPheArgAlaProSerSerAsnPheLeuPheAspSerGluLeu ArgThrArgAlaLeuValIlePhePheCysLeuAlaHisIleValPhe LeuThrValIleTyrArgAspLeuSerSerIleAlaProThrLeuArg GluAlaAlaTyrMetAlaArgAlaGlnSerValSerGlyGluProVal LeuSerSerLeuSerMetAsnTyrLeuGlnLeuGlyGlnThrValIle ProLeuValValLeuLeuTyrLeuArgGlyLysCysGlyValLeuGly PheLeuAlaIleSerValProTrpMetGlyValIleLeuLeuAlaSer GlyArgAlaSerLeuMetGlnMetLeuValGlyLeuPhePheIleTyr IleLeuValLysGlySerProSerLeuLysSerLeuLeuValIleGly LeuAlaMetPheLeuValIleAlaValGlyAlaValAlaThrSerLys IleGlnPheHisGluGlyAspGlyIleSerThrLeuPheIleGluLeu TyrArgHisValAlaGlyTyrAlaLeuGlnGlyProValLeuPheAsp ArgTyrTyrGlnGlySerIleHisLeuGluProTyrTrpSerProLeu AsnGlyPheCysSerIleLeuAlaThrValGlyLeuCysGlnLysPro ProLeuHisLeuAspPheTyrGluTyrAlaProGlyGluLeuGlyAsn ValTyrSerMetPhePheSerMetTyrProHisTyrGlyAlaLeuGly ValIleGlyValMetAlaLeuTyrGlyMetLeuCysSerTyrAlaTyr CysLysAlaLysLysGlySerLeuTyrPheThrValLeuSerSerTyr LeuPheSerAlaIleValPheSerLeuPheSerAspGlnIleSerThr SerTrpTrpPheTyrValLysMetThrIleIleLeuGlyIleLeuCys PheValPheArgArgAspArgMetPheValIleArgLeuProGlnAla Gly nucleotidesequenceofPcrV SEQIDNO:67 ATGGAAGTCAGAAACCTTAATGCCGCTCGCGAGCTGTTCCTGGACGAGCTCCTGGC CGCGTCGGCGGCGCCTGCCAGTGCCGAGCAGGAGGAACTGCTGGCCCTGTTGCGC AGCGAGCGGATCGTGCTGGCCCACGCCGGCCAGCCGCTGAGCGAGGCGCAAGTG CTCAAGGCGCTCGCCTGGTTGCTCGCGGCCAATCCGTCCGCGCCTCCGGGGCAGG GCCTCGAGGTACTCCGCGAAGTCCTGCAGGCACGTCGGCAGCCCGGTGCGCAGTG GGATCTGCGCGAGTTCCTGGTGTCGGCCTATTTCAGCCTGCACGGGCGTCTCGACG AGGATGTCATCGGTGTCTACAAGGATGTCCTGCAGACCCAGGACGGCAAGCGCAAG GCGCTGCTCGACGAGCTCAAGGCGCTGACCGCGGAGTTGAAGGTCTACAGCGTGAT CCAGTCGCAGATCAACGCCGCGCTGTCGGCCAAGCAGGGCATCAGGATCGACGCT GGCGGTATCGATCTGGTCGACCCCACGCTATATGGCTATGCCGTCGGCGATCCCAG GTGGAAGGACAGCCCCGAGTATGCGCTGCTGAGCAATCTGGATACCTTCAGCGGCA AGCTGTCGATCAAGGATTTTCTCAGCGGCTCGCCGAAGCAGAGCGGGGAACTCAAG GGCCTCAGCGATGAGTACCCCTTCGAGAAGGACAACAACCCGGTCGGCAATTTCGC CACCACGGTGAGCGACCGCTCGCGTCCGCTGAACGACAAGGTCAACGAGAAGACC ACCCTGCTCAACGACACCAGCTCCCGCTACAACTCGGCGGTCGAGGCGCTCAACCG CTTCATTCAGAAATACGACAGCGTCCTGCGCGACATTCTCAGCGCGATCTAG X-S/T-X-N-X-D/E
EXAMPLES
Example 1: Bacterial Strains with an Inserted Oligosaccharyl Transferase and an Inserted Rfb Cluster are Stable and Produce Bioconjugates
[0212] This example demonstrates that bioconjugates can successfully be produced by a bacterial host strain that has been genetically modified by insertion of (i) a nucleic acid encoding an oligosaccharyl transferase and (ii) a nucleic acid encoding an rfb cluster.
[0213] Modified E. coli host cells were generated by inserting the following directly into the host cell genome: (i) a nucleic acid encoding the C. jejuni oligosaccharyl transferase (PgIB) and (ii) a nucleic acid encoding the rfb cluster from Pseudomonas aeruginosa strain PA103. This rfb cluster encodes genes necessary for O-antigen synthesis of the Pseudomonas aeruginosa serogroup O11 antigen. The insertions were performed using the novel insertion method described in PCT/EP2013/071328 (see Section 5.2, above) or the pUT mini system (Biomedal Lifescience). The insertion method described in PCT/EP2013/071328 is site-specific and utilizes homologous recombination, whereas the pUT mini system is a random, transposon-mediated approach that results in a nucleic acid sequence of interest being randomly inserted into a host cell genome. The E. coli host cells further were modified by introduction of a plasmid that expresses detoxified Pseudomonas extotoxin A (EPA) as a carrier protein into the host cells. Thus, the modified E. coli host cells described in this example express (i) the C. jejuni oligosaccharyl transferase (PgIB), by virtue of integration of a nucleic acid encoding the oligosaccharyl transferase into the host cell genome; (ii) genes of a Pseudomonas aeruginosa rfb cluster that produce the O11 antigen, by virtue of integration of a nucleic acid encoding the rfb cluster from Pseudomonas aeruginosa strain PA103 into the host cell genome; and (iii) the EPA carrier protein, by virtue of transforming the host cell with a plasmid comprising a nucleic acid encoding the carrier protein.
[0214] Additional modified E. coli host cells were generated to allow for comparison of the ability of the modified host cells comprising double integrations (integration of an oligosaccharyl transferase and integration of an rfb cluster) to produce bioconjugates (EPA-O11) with bioconjugate production by host cells having (i) only a single integration of the oligosaccharyl transferase or the rfb cluster and the remaining components (carrier protein and oligosaccharyl transferase or rfb cluster) plasmid expressed by the host cell; or (ii) no integrated components, with all components (carrier protein and oligosaccharyl transferase and rfb cluster) plasmid expressed.
[0215] Three different E. coli background strains were used in the analysis: (i) St4167 (W3110 ?waaL, ?rfbO16::rfbP.a.O11), which comprises a deletion of the E. coli waaL gene, a deletion of the E. coli O16 rfb cluster, and an insertion of the P. aeruginosa O11 rfb cluster (PCT/EP2013/071328); (ii) St1128 (W3110 ?waaL), which comprises a deletion of the E. coli waaL gene; and (iii) St1935 (W3110 ?waaL, ?wzzE-wecG, ?wbbIJK), which comprises deletion of the indicated genes. For insertion of the P. aeruginosa O11 rfb cluster in St4167, O11 rfb cluster was cloned into the pDOC plasmid and the method according to PCT/EP2013/071328 was employed. The St4167 strains represent the double integration strains.
[0216] The specific plasmids utilized to introduce EPA into the host cell strains are designated p1077 and p150. The latter is described in Ihssen, et al., (2010) Microbial cell factories 9, 61, and the plasmids are the same with the exception of the fact that p1077 replaces the Amp cassette of p150 with a Kan cassette.
[0217] The following St4167 variants were generated: (i) St4167 with pgIB inserted in place of the host cell yahL gene (by the method of PCT/EP2013/071328) and EPA expressed by plasmid p1077; (ii) St4167 with pgIB inserted in place of the host cell ompT gene (using the pUT mini system) and EPA expressed by plasmid p150; (iii) St4167 with pgIB expressed by plasmid p1769 (pgIB in pDOC) and EPA expressed by plasmid p1077; (iv) St4167 with pgIB expressed by plasmid p939 (pEXT21 based expression plasmid for PgIB with an HA tag, codon optimized) and EPA expressed by plasmid p1077; and (v) St4167 with pgIB expressed by plasmid p1762 (pgIB in pDOC) and EPA expressed by plasmid p1077.
[0218] The following St1128 variants were generated: (i) St1128 with pgIB expressed by plasmid p939, P. aeruginosa O11 rfb cluster expressed by plasmid p164 (pLAFR plasmid engineered to contain the P. aeruginosa O11 rfb cluster), and EPA expressed by plasmid p1077; and (ii) St1128 with pgIB inserted in place of the host cell yahL gene (by the method of PCT/EP2013/071328), P. aeruginosa O11 rfb cluster expressed by plasmid p164, and EPA expressed by plasmid p1077.
[0219] The following St1935 variants were generated: (i) St1935 with pgIB inserted in place of the host cell ompT gene (by the method of PCT/EP2013/071328), P. aeruginosa O11 rfb cluster expressed by plasmid p164, and EPA expressed by plasmid p1077; (ii) St1935 with pgIB inserted in place of the host cell yahL gene (by the method of PCT/EP2013/071328), P. aeruginosa O11 rfb cluster expressed by plasmid p164, and EPA expressed by plasmid p1077; and St1935 with pgIB expressed by plasmid p939, P. aeruginosa O11 rfb cluster expressed by plasmid p164, and EPA expressed by plasmid p1077.
[0220] As shown in
Example 2: Identification of a Formyltransferase Gene that Contributes to the Synthesis of a Native P. aeruginosa O6 O-Antigen Oligo/Polysaccharide
[0221] This example describes the identification of the Pseudomonas aeruginosa O6 formyltransferase.
[0222] Proteome data for the Pseudomonas aeruginosa O6 strain LESB58, the genome of which is known, was searched for domains containing homology to the prototype query domains Formyltransferase and FMT C-terminal domain-like domain using the algorithm provided at www.supfam.org/SUPERFAMILY/. The search identified 9 protein sequences with possible related domains.
[0223] To evaluate whether any of the 9 candidates identified were specific for O6 (and thereby for a formylated O antigen repreat unit) their absence in the proteome of another Pseudomonas aeruginosa serotype (O5, strain PAO1) was analyzed using a BLAST search (NCBI website). The Pseudomonas aeruginosa O5 O-antigen structure is unrelated that of Pseudomonas aeruginosa O6. Specifically, no formyl group is present in the O5 structure. 8 out of 9 candidates had homologues in Pseudomonas aeruginosa serotype O5 which indicated that these proteins were unspecific for Pseudomonas aeruginosa O6 strain LESB58. The remaining candidate (locus_tag=PLES_12061, GenBank: CAW25933.1; SEQ ID NO:2) had no obvious homologue in Pseudomonas aeruginosa serotype O5 and was therefore classified as specific for LESB58/Pseudomonas aeruginosa serotype O6.
[0224] To confirm O6 specificity, the presence of the discovered Pseudomonas aeruginosa serotype O6 formyltransferase (SEQ ID NO:2) in other Pseudomonas aeruginosa serotype O6 strains was verified. Proteins equivalent to the Pseudomonas aeruginosa serotype O6 formyltransferase (SEQ ID NO:2) were identified in four other Pseudomonas aeruginosa serotype O6 strains, including locus tag: PAK_01412 in strain PAK and locus tag: PAM18_1171 in strain M18.
[0225] Formyltransferases with low amino acid sequence identity to Pseudomonas aeruginosa serotype O6 formyltransferase (SEQ ID NO:2) also were identified in Methylobacterium sp. (33% identity, ACCESSION WP_020093860), Thiothrix nivea (30% identity, ACCESSION WP_002707142), Anaerophaga thermohalophila (28% identity, ACCESSION WP_010422313), Halorubrum californiense (27% identity, ACCESSION WP_008445073), Azorhizobium caulinodans (25% identity, ACCESSION WP_012170036) and Burkholderia glathei (24% identity, ACCESSION KDR39707). Taken together, these homology analyses indicated that the related genes encode an O6 specific activity related to formylation.
[0226] To test the functional activity of the Pseudomonas aeruginosa serotype O6 formyltransferase (SEQ ID NO:2) on the non formylated O6 repeat unit structure, the gene encoding SEQ ID NO:2 was cloned. The rare TTG START codon of the gene was replaced by ATG. A schematic representation of the cloning of the Pseudomonas aeruginosa serotype O6 formyltransferase (SEQ ID NO:2) into the Pseudomonas aeruginosa O6 rfb cluster and the relative organization of the genes is depicted in
[0227] Once identified, function of the Pseudomonas aeruginosa O6 formyltransferase was assessed. Pseudomonas aeruginosa serotype O6 formyltransferase (SEQ ID NO:2) was tested for functionality by co-expression with the rfb cluster genes of Pseudomonas aeruginosa O6 in E. coli strains that lack a functional ECA (wec) cluster. To show formylation, single antigen repeat units bound to lipid a core were analyzed (in a waaL positive strain). The formylated O6 O-antigen repeating unit was identified by immunodetection using an O6 specific antibody (
[0228] To show formylation on the molecular level, O6 repeat units were analyzed by MALDI MSMS. Purified and 2AB labelled repeat units showed that coexpression of Pseudomonas aeruginosa serotype O6 formyltransferase (SEQ ID NO:2) with the rfb cluster genes of Pseudomonas aeruginosa O6 gave rise to a fluorescence signal of the main peak which was shifted by 2-3 minutes (from 58 to 61,
[0229] MALDI-MSMS analysis of the material contained in the peaks at 58 resulted in a Y ion fragmentation series which is in agreement with the non formylated, N acetylated 2-AB labelled O6 repeat unit. The protonated precursor ion m/z=905, fragmented into a prominent ion series of 905.fwdarw.759.fwdarw.543.fwdarw.326, corresponding to losses of 146 (deoxyhexose), 216 (amidated N-acetylhexosaminuronic acid), 217 (N-acetylhexosaminuronic acid) units. Material collected at 61 obtained from cells expressing the Pseudomonas aeruginosa serotype O6 formyltransferase gene contained a prominent precursor ion of 891, which fragmented at 891.fwdarw.745.fwdarw.529.fwdarw.326, corresponding to losses of 146 (as above), 216 (as above), and 203 (amidated N-formylhexosaminuronic acid). This data proved that formylation is dependent on the expression of Pseudomonas aeruginosa serotype O6 formyltransferase and that accordingly the gene is encoding the formyltransferase. Thus, the gene that encodes the Pseudomonas aeruginosa serotype O6 formyltransferase was named fmtO6. The fact that the acetyl group of the amidated N-acetylhexosaminuronic acid is replaced by a formyl group suggests a two step mechanism wherein the acetyl group is first removed before the formyl group can be added. This model implies that a free amine group would be present at C2 as an intermediate before the formyltransferase domain attaches a formyl group to the monosaccharide. Thus, deacetylated and non formylated O antigen may be a substantial and immunologically relevant, substochiometrically present polysaccharide form of P. aeruginosa serotype O6.
Example 3: Identification and Testing of the Wzy Gene for Polymerization of the P. aeruginosa O6 O Antigen
[0230] This example describes the identification of the Pseudomonas aeruginosa O6 wzy polymerase.
[0231] O antigen polysaccharides constitute the outer cell surface of many Gram negative bacteria. The enzymatic machinery responsible for the biosynthesis of O antigen is often encoded in a single gene cluster called the rfb cluster. Pseudomonas aeruginosa serotype O6 strains express a polymeric O-antigen (
[0232] The O-antigen of Pseudomonas aeruginosa O19 shares structural similarities to that of Pseudomonas aeruginosa O6. It was speculated that the wzy proteins that recognize both structures might also share similar properties, e.g., structure, sequence, number of transmembrane domains. The sequence of the O19 Wzy protein of Pseudomonas aeruginosa O19 (ACCESSION AAM27560) is known and was used as a primary query in a Blast analysis using the Pseudomonas aeruginosa O6 PAK strain proteome as the subject for the homology search.
[0233] To evaluate whether the candidates identified were specific for Pseudomonas aeruginosa O6, their presence in the proteome of another Pseudomonas aeruginosa serotype (O5, strain PAO1) was analyzed. The O5 O-antigen structure is unrelated to that of O6 and O19. The Top 100 results were analyzed individually for the presence in the Pseudomonas aeruginosa O5 proteome using blast analysis. 97 out of 100 candidates from the PAK proteome had homologues in the Pseudomonas aeruginosa serotype O5 proteome which indicated that these proteins were generally present in Pseudomonas aeruginosa strains and possibly unrelated to O6 O antigen biosynthesis. Three out of the 100 candidates had no obvious homologue in the Pseudomonas aeruginosa O5 proteome, and were therefore determined to be Pseudomonas aeruginosa O6 specific.
[0234] To test whether one of the three identified candidate proteins was a Pseudomonas aeruginosa O6 wzy, the three proteins were used as query in a Blast analysis. One of the three candidates, PAK 01823 (O6wzy PAK_01823; SEQ ID NO:3), shared amino acid sequence identity to other, known oligosaccharide repeat unit polymerases, e.g, 25% identity to Streptococcus sanguinis oligosaccharide repeat unit polymerases (ACCESSION WP_004192559) and 22% identity to Escherichia coli 0139 oligosaccharide repeat unit polymerases (ACCESSION AAZ85718). Thus, PAK_01823 (O6wzy PAK_01823; SEQ ID NO:3) was identified as the Pseudomonas aeruginosa O6 wzy.
[0235] To further confirm SEQ ID NO:3 as the protein encoded by the Pseudomonas aeruginosa O6 wzy, the subcellular localization of the protein was predicted bioinformatically using PSORTb (www.psort.org/psortb/). The protein was predicted to be localized in the cytoplasmic membrane with 11 transmembrane domains, a feature that is common among O-antigen polymerases.
[0236] Proteins equivalent to PAK_01823 (O6wzy PAK_01823; SEQ ID NO:3) were found in other O6 positive P. aeruginosa strains, including the LESB58 strain (which had a Pseudomonas aeruginosa O6 wzy protein with only 1 aa difference compared to the PAK strain and a strain tested internally).
[0237] Next, functional testing of the Pseudomonas aeruginosa O6 wzy was carried out. The Pseudomonas aeruginosa O6 rfb cluster, the fmtO6 gene (i.e., the gene encoding SEQ ID NO:2, discussed in Example 2, above), and the gene encoding Pseudomonas aeruginosa O6 wzy (i.e., the gene encoding SEQ ID NO:3) were co-expressed in E. coli W3110 ?wec cells, and the lipopolysaccharide formed was analyzed by immunoblotting (
[0238] To generate a single gene cluster containing all genetic elements required to enable E. coli to recombinantly express the P. aeruginosa O6 O antigen, the fmtO6 and O6wzy genes (i.e., the genes encoding SEQ ID NOs: 2 and 3, respectively) were cloned downstream of the P. aeruginosa O6 rfb cluster. A schematic representation of the cloning of the codon usage optimized Pseudomonas aeruginosa O6 O-antigen polymerase O6wzy into the cloned Pseudomonas aeruginosa O6 rfb cluster along with the O6 formyltransferase and the relative organization of the genes is depicted in
Example 4: Bacterial Strains with an Inserted Oligosaccharyl Transferase and an Inserted Rfb, Completed rfbO6 Cluster are Stable and Produce Bioconjugates
[0239] Example 1 demonstrates that bioconjugates can successfully be produced by a bacterial host strain that has been genetically modified by insertion of (i) a nucleic acid encoding an oligosaccharyl transferase and (ii) a nucleic acid encoding an rfb cluster. In this Example, experiments similar to those described in Example 1 were performed, using the Pseudomonas protein PcrV as a carrier protein.
[0240] Naturally, the primary amino acid sequence of PcrV (see, e.g., UniProt O30527) does not comprise an N-glycosylation consensus sequence (glycosite). Using the methods described in WO 2006/119987, recombinant variants of PcrV comprising one, two, three, four, or five glycosites were engineered. In particular, by manipulation of the nucleic acid sequence encoduing PcrV, PcrV variants were created that expressed one, two, three, four, or five of the optimized N-glycosylation consensuss sequence Asp(Glu)-X-Asn-Z-Ser(Thr), wherein X and Z are independently selected from any natural amino acid except Pro.
[0241] Modified E. coli host cells were generated by inserting the following directly into the host cell genome: (i) a nucleic acid encoding the C. jejuni oligosaccharyl transferase (PgIB) and (ii) a nucleic acid encoding the rfb cluster from the Pseudomonas aeruginosa serotype O6 PAK strain. This rfb cluster encodes genes necessary for O-antigen synthesis of the Pseudomonas aeruginosa serogroup O6 antigen. The insertions were performed using the novel insertion method described in PCT/EP2013/071328 (see Section 5.2, above) or the pUT mini system (Biomedal Lifescience). The E. coli host cells further were modified by introduction of a plasmid that expresses PcrV comprising one to five glycosites, as described above. Thus, the modified E. coli host cells described in this example express (i) the C. jejuni oligosaccharyl transferase (PgIB), by virtue of integration of a nucleic acid encoding the oligosaccharyl transferase into the host cell genome; (ii) genes of a Pseudomonas aeruginosa rfb cluster that produce the O6 antigen, by virtue of integration of a nucleic acid encoding the rfb cluster from Pseudomonas aeruginosa PAK strain into the host cell genome; and (iii) the modified PcrV carrier protein, by virtue of transforming the host cell with a plasmid comprising a modified nucleic acid encoding the carrier protein (where the nucleic acid has been modified so that it encodes one to five glycosites, as described above).
[0242] Additional modified E. coli host cells were generated to allow for comparison of the ability of the modified host cells comprising double integrations (integration of an oligosaccharyl transferase and integration of an rfb cluster) to produce bioconjugates (PcrV-O6) with bioconjugate production by host cells having (i) only a single integration of the oligosaccharyl transferase or the rfb cluster and the remaining components (carrier protein and oligosaccharyl transferase or rfb cluster) plasmid expressed by the host cell; or (ii) no integrated components, with all components (carrier protein and oligosaccharyl transferase and rfb cluster) plasmid expressed.
[0243] Three different E. coli strains were used and compared in the analysis: (i) St7343, which comprises both pgIB and the completed O6 rfb cluster inserted into the host cell genome (i.e., is a double integrated strain), and a plasmid encoding a PcrV carrier protein (with one, two, three, four, or five glycosites); (ii) St7209, which comprises plasmid-expressed pgIB, the O6 rfb cluster inserted into the host cell genome, and a plasmid encoding a PcrV carrier protein (with one, two, three, four, or five glycosites); and (iii) St2182, which comprises plasmid-expressed pgIB, plasmid-expressed O6 rfb cluster, and a plasmid encoding a PcrV carrier protein (with one, two, three, four, or five glycosites).
[0244] As shown in
Example 5: Production and Purification of EPA-O6 Bioconjugates
[0245] This example describes the production of bioconjugates comprising the Pseudomonas aeruginosa O6 antigen.
[0246] E. coli W3110 ?waaL ?wec ?rfb was transformed with plasmids comprising the Pseudomonas aeruginosa O6 rfb cluster, the oligosaccharyl transferase pgIB from C. jejuni, the gene encoding the detoxified carrier protein EPA, and the QuiNAc biosynthesis/transferase genes wbpVLM (from a Pseudomonas aeruginosa O6 strain). Results of plasmid retention analysis are depicted in
[0247] EPA-O6 bioconjugates were purified from periplasmic extracts of modified host cells using Metal-chelate affinity chromatography (IMAC), anion exchange chromatography (Source Q) and size exclusion chromatography (SEC). Elution fractions containing glycoconjugates were pooled and subsequently submitted to the next chromatography step. The final SEC eluates were characterized by SDS-PAGE followed by Coomassie Blue staining or Western blot using the antibodies indicated in
[0248] The EPA-O6 bioconjugate was characterized using an array of analytical methods. The level of endotoxin was measured using the LAL assay (13 EU/ml). Purity was determined by SDS-PAGE and capillary gel electrophoresis (CGE, 86% purity). The amount of protein was measured using the BCA assay (1.75 mg/ml). The amount of polysaccharide was measured using the Anthrone assay (Dubois et al., 1956; 311.6 ug/ml). The average size of the O6-Polymer was determined using a high resolution degree-of-glycosylation (DOG) SDS-PAGE (average of 7.9 repeating units per polymer). Determination of electric isoforms of the bioconjugate was done by isoelectric focusing (IEF). Finally, the identity of the bioconjugate was confirmed by Immunoblotting using antibodies directed against the protein (EPA) or the polysaccharide (O6).
Example 6: Immunization Studies
[0249] This Example demonstrates that the P. aeruginosa O6-EPA bioconjugate is immunogenic.
[0250] Female, 6 week old BALB/c OlaHsd mice (in groups of 20) were immunized intramuscularly at days 0, 14 and 28 with 0.2 ?g or 2 ?g of O6-EPA conjugate (see Example 5) in a non adjuvanated or adjuvanated formulation (with an oil-in-water emulsion adjuvant). A control group of 10 mice was vaccinated with ajuvant (O/W) alone. Anti-O6 ELISA were determined in individual sera collected at day 42 (14 post Ill) and opsonic titres were determined on pooled Post-II and Post-Ill sera. Results are shown in
[0251]
[0252] The level of anti-O6 antibodies present in the sera was expressed in mid-point titers. A GMT of individual sera was calculated for the 20 samples in each treatment group (10 for the control group).
[0253] An immune response was observed in mice after injection of the bioconjugate formulated with the adjuvant. No difference was observed between doses. Similar observations were made regarding the percentage of seroconversion. No or very weak responses were observed with the non adjuvanted formulation.
[0254]
[0255] The opsonophagocytosis assay (OPA) was performed in round-bottom microplates with 15 ?l of HL-60 phagocytic cells (adjusted to 5 10e6 cells/ml), 15 ?l of P. aeruginosa bacteria (grown on TSA agar plate), 15 ?l of the test serum dilutions, and 15 ?l of piglet complement. The inactivated test pooled sera were first diluted (1/16 or 1/50 final dilution) in HBSS-BSA 1% and added to a P. aeruginosa O6 strain (strain ID: HNCMB 170009, obtained from Hungarian National Collection of Medical Bacteria) diluted in order to count 200-250 CFU/well at the end of the test.
[0256] The HL-60 cells (adjusted to 5.10e6/ml) and the piglet complement (12.5% final) were then added in each well. A control with inactivated complement was included for each test sample.
[0257] The reaction mixture was incubated at 37? C. for 90 minutes with agitation. After a 1/200 dilution, 50 ?l of the volume was then transferred into a flat-bottom microplate. 50 ?l of MH agar followed by PBS-0.9% agar was added. Automated colony counts were performed after an overnight incubation at 30? C.
[0258] The opsonophagocytic activity is expressed as the reciprocal of the serum dilution giving at least 50% killing.
[0259] The data demonstrate the functionality of the antibodies induced after injection with the adjuvanted group.
[0260] In conclusion, this example demonstrates that the P. aeruginosa O6-EPA bioconjugate is both immunogenic and functional (i.e. induces antibodies that kill P. aeruginosa O6 in vivo).
Example 7
[0261] This example demonstrates that the P. aeruginosa O6-PcrV bioconjugates are immunogenic.
[0262] Immunization
[0263] Groups of 20 Balb/c 6 week old mice and groups of 20 female 6 weeks old OFA SD rats were immunized IM at days 0, 14 and 28 with 0.2 ?g of O6-PcrV bioconjugate in a non-adjuvanted or oil in water emulsion adjuvanted formulation.
[0264] The IgG immune response was determined by ELISA (with an anti-O6 and anti-PcrV ELISA). The functionality of antibodies were evaluated in an opsonophagocytosis assay for O6 and in a hemolysis assay for PcrV. The immune response was evaluated in individual sera collected at day 42 (post Ill) and on pooled Post-II and post-Ill sera.
[0265] Conjuqates Tested
[0266] Three P. aeruginosa O6-PcrV conjugates were tested. In each case, three glycosylation sites had been engineered into PcrV and the short, medium or long O6 chains were added to the glycosylation sites.
TABLE-US-00002 No. of en- gineered Protein Sugar glyco- O6 concen- concen- Con- sylation polymer tration tration s/p endo- jugate sites length Mg/ml Mg/ml ratio toxin purity O6- 3 short 0.849 0.169 19.9% <5 97.2% PcrV short O6- 3 medium 0.154 0.072 46.8% 9.425 97.7% PcrV Medium O6- 3 long 0.531 0.450 84.7% <5 100% PcrV long
[0267] Anti-O6 ELISA (on Rat Sera)
[0268] Purified O6-LPS was coated at 8 ?g/ml in phosphate buffered saline (PBS) on high-binding microtitre plates (Nunc Maxisorp), overnight at 4? C. The plates were blocked with PBS-BSA 1% for 30 minutes at RT with agitation. The rat antisera were prediluted 1/100 or 1/10 and then, further twofold dilutions were made in microplates and incubated at RT for 30 minutes with agitation. After washing, bound rat antibodies were detected using Jackson ImmunoLaboratories Inc. peroxidase-conjugated AffiniPure Goat Anti-rat IgG (H+L) (ref: 112-035-003) diluted 1/2500 in PBS-tween 0.05%. The detection antibodies were incubated for 30 minutes at room temperature with agitation. The color was developed using 4 mg OPD+5 ?l H2O2 per 10 ml pH 4.5 0.1M citrate buffer for 15 minutes in the dark at room temperature. The reaction was stopped with 50 ?l HCl, and the optical density (OD) was read at 490 nm relative to 620 nm. The level of anti-O6 antibodies present in the sera was expressed in mid-point titers. A GMT was calculated for the 20 individual samples in each treatment group.
[0269] Anti-PcrV ELISA (on Rat Sera)
[0270] Purified PcrV His-tagged was coated at 1 ?g/ml in phosphate buffered saline (PBS) on high-binding microtitre plates (Nunc Maxisorp), overnight at 4? C. The plates were blocked with PBS-BSA 1% for 30 minutes at RT with agitation. The rat antisera were prediluted 1/400 and then, further twofold dilutions were made in microplates and incubated at RT for 30 minutes with agitation. After washing, bound rat antibodies were detected using Jackson ImmunoLaboratories Inc. peroxidase-conjugated AffiniPure Goat Anti-rat IgG (H+L) (ref: 112-035-003) diluted 1/5000 in PBS-tween 0.05%. The detection antibodies were incubated for 30 minutes at room temperature with agitation. The color was developed using 4 mg OPD+5 ?l H.sub.2O.sub.2 per 10 ml pH 4.5 0.1M citrate buffer for 15 minutes in the dark at room temperature. The reaction was stopped with 50 ?l HCl, and the optical density (OD) was read at 490 nm relative to 620 nm.
[0271] The level of anti-PcrV antibodies present in the sera was expressed in mid-point titers. A GMT was calculated for the 20 samples in each treatment group.
[0272] Anti-O6 ELISA (on Mouse Sera)
[0273] Purified O6-LPS was coated at 8 ?g/ml in phosphate buffered saline (PBS) on high-binding microtitre plates (Nunc Maxisorp), overnight at 4? C. The plates were blocked with PBS-BSA 1% for 30 minutes at RT with agitation. The mouse antisera were prediluted 1/100 or 1/10 and then, further twofold dilutions were made in microplates and incubated at RT for 30 minutes with agitation. After washing, bound mouse antibodies were detected using Jackson ImmunoLaboratories Inc. peroxidase-conjugated AffiniPure Goat Anti-mouse IgG (H+L) (ref: 115-035-003) diluted 1/2500 in PBS-tween 0.05%. The detection antibodies were incubated for 30 minutes at room temperature with agitation. The color was developed using 4 mg OPD+5 ?l H.sub.2O.sub.2 per 10 ml pH 4.5 0.1M citrate buffer for 15 minutes in the dark at room temperature. The reaction was stopped with 50 ?l HCl, and the optical density (OD) was read at 490 nm relative to 620 nm. The level of anti-O6 antibodies present in the sera was expressed in mid-point titers. A GMT was calculated for the 20 individual samples in each treatment group.
[0274] Anti-PcrV ELISA (on Mouse Sera)
[0275] Purified PcrV His-tagged was coated at 1 ?g/ml in phosphate buffered saline (PBS) on high-binding microtitre plates (Nunc Maxisorp), overnight at 4? C. The plates were blocked with PBS-BSA 1% for 30 minutes at RT with agitation. The mouse antisera were prediluted 1/400 and then, further twofold dilutions were made in microplates and incubated at RT for 30 minutes with agitation. After washing, bound mouse antibodies were detected using Jackson ImmunoLaboratories Inc. peroxidase-conjugated AffiniPure Goat Anti-mouse IgG (H+L) (ref: 115-035-003) diluted 1/5000 in PBS-tween 0.05%. The detection antibodies were incubated for 30 minutes at room temperature with agitation. The color was developed using 4 mg OPD+5 ?l H.sub.2O.sub.2 per 10 ml pH 4.5 0.1M citrate buffer for 15 minutes in the dark at room temperature. The reaction was stopped with 50 ?l HCl, and the optical density (OD) was read at 490 nm relative to 620 nm.
[0276] The level of anti-PcrV antibodies present in the sera was expressed in mid-point titers. A GMT was calculated for the 20 samples in each treatment group.
[0277] Anti-O6 OPA Response
[0278] The osponophagocytosis assay (OPA) was performed in round-bottom microplates with 15 ?l of HL-60 phagocytic cells (adjusted to 5 10e.sup.6 cells/ml), 15 ?l of P. aeruginosa bacteria (grown on TSA agar plate), 15 ?l of the test serum dilutions and 15 ?l of piglet complement.
[0279] The inactivated test sera were first diluted (1/4) in HBSS-BSA 1% and added to P. aeruginosa strain (GVXN 5871 diluted in order to obtain 200-250 CFU/well at the end of the test).
[0280] The HL-60 cells (adjusted to 5.10e6/ml) and the piglet complement (12.5% final) were then added in each well. A control with inactivated complement was also included for each test sample.
[0281] The reaction mixture was incubated at 37? C. for 90 minutes with agitation. After a 1/200 dilution, 50 ?l of the volume was then transferred into a flat-bottom microplate. 50 ?l of MH agar followed by PBS-0.9% agar was added (and additional 50 ?l for safety reason). Automated colony counts were performed after an overnight incubation at 30? C. The opsonophagocytic activity was expressed as the reciprocal of the serum dilution giving at least 50% killing.
[0282] Anti-PcrV Haemolysis Inhibition Response
[0283] ATCC 29260 (PCRV+) was cultured over night at 37? C. with 5% C02, on TSA Agar plate and harvested with 5 ml of MinS liquid media. A few ?l were seeded in Wyame Fiole and grown during 4 hours.
[0284] Serial twofold dilutions of test sera were performed in 80 ?l phosphate buffer saline (DPBS) in 96-well U-bottom microplates.
[0285] 80 ?l of 3? diluted ATCC 29260 were then added (dilution which lyses 100% of rabbit erythrocytes). 80 ?l of purified and diluted rabbit erythrocytes were then added to each well. The dilution of the rabbit erythrocytes was determined for each assay in order to obtain an identical haemolysis and a standardized haemolysis inhibition. The plates were centrifugated at 1000 rpm, at 4? C. for 10 min and incubated at 37C for 2 hours.
[0286] The plates were then centrifuged at 1000 rpm for 10 minutes at 4? C. 150 ?l (Supernatant) of each well were transferred to a flat bottom plate and read at 405 nm with a microtitre plate reader.
[0287] The haemolysis inhibition activity was expressed by mid-point titers (50% inhibition) of pooled sera.
[0288] Anti-O6 IgG ELISA
[0289] 5 pools of 4 rats post II and individual sera post Ill were evaluated by ELISA on all the groups of the experiment. Results are shown on
[0290] A boost effect is observed from Post I to post Ill pooled sera. The non-adjuvanted O6 bioconjugate has low immunogenicity in comparison with all the O6 bioconjugates formulated in an oil in water emulsion adjuvant, which are more immunogenic.
[0291] Anti-PcrV Immune Response
[0292] 5 pools of 4 rats post II and individual sera post III were evaluated by ELISA on all the PcrV groups of the experiment (G5 to G9).
[0293] The geometric mean of mid-point titers obtained for both the Post II and Post III rat sera are presented in
[0294] A boost effect was observed between Post II and post III pooled sera. No or a very weak immune response anti-PcrV was observed with O6-PcrV non-adjuvanted. By contrast, a good immune response was observed against PcrV protein carrier for the three O6 bio conjugates formulated in an oil in water adjuvant.
[0295] The highest antibody response was observed with the Group 5 O6-PcrV bioconjugate including 20% sugar/protein ratio (the higher protein concentration).
[0296] PcrV Haemolysis Inhibition Assay:
[0297] Results of the PcrV haemolysis inhibition assays are shown in
[0298] In both mice and rats, the presence of an oil in water emulsion enhanced the immune response against PcrV.
[0299] Opsonophagocytosis Results
[0300] Results of the opsonophagocytosis assays are shown in
[0301] The present disclosure is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the subject matter provided herein, in addition to those described, will become apparent to those skilled in the art from the foregoing description and accompanying figures. Such modifications are intended to fall within the scope of the appended claims.
[0302] Various publications, patents and patent applications are cited herein, the disclosures of which are incorporated by reference in their entireties.