METHODS OF TREATING CANCER

20240139353 ยท 2024-05-02

    Inventors

    Cpc classification

    International classification

    Abstract

    Methods of treatment for conditions, e.g., cancer, using a cold FGFR3-targeting molecule and a radioimmunoconjugate comprising a chelating moiety or a metal complex thereof, a linker, and an FGFR3 targeting moiety.

    Claims

    1. A method of treating cancer, the method comprising administering to a subject in need thereof a pharmaceutical composition comprising an effective amount of a radioimmunoconjugate or a pharmaceutically acceptable salt thereof, wherein the radioimmunoconjugate comprises the following structure:
    A-L-B Formula I-a wherein A is a metal complex of a chelating moiety, B is an FGFR3 targeting moiety, and L is a linker, wherein the subject is being co-administered a cold FGFR3-targeting molecule.

    2. The method of claim 1, wherein the metal complex comprises a radionuclide.

    3. The method of claim 2, wherein the radionuclide is an alpha emitter selected from the group consisting of Astatine-211 (.sup.211At), Bismuth-212 (.sup.212Bi) , Bismuth-213 (.sup.213Bi), Actinium-225 (.sup.225Ac), Radium-223 (.sup.223Ra), Lead-212 (.sup.212Pb), Thorium-227 (.sup.227Th), and Terbium-149 (.sup.149Tb), or a progeny thereof.

    4. The method of claim 3, wherein the radionuclide is .sup.225Ac or a progeny thereof.

    5. The method of claim 1, wherein L has the structure L.sup.1-(L.sup.2).sub.n, as shown within Formula I-b:
    A-L.sup.1-(L.sup.2).sub.n-B Formula I-b wherein A is a metal complex of a chelating moiety; B is an FGFR3 targeting moiety; L.sup.1 is a bond, optionally substituted C.sub.1-C.sub.6 alkyl, optionally substituted C.sub.1-C.sub.6 heteroalkyl, or optionally substituted aryl or heteroaryl; n is an integer between 1 and 5 (inclusive); and each L.sup.2, independently, has the structure:
    X.sup.1-L.sup.3-Z.sup.1Formula III wherein X.sup.1 is C(O)NR.sup.1*, NR.sup.1C(O)*, C(S)NR.sup.1*, NR.sup.1C(S)*, OC(O)NR.sup.1*, NR.sup.1C(O)O*, NR.sup.1C(O)NR.sup.1, CH.sub.2PhC(O)NR.sup.1*, NR.sup.1C(O)PhCH.sub.2*, CH.sub.2PhNHC(S)NR.sup.1*, NR.sup.1C(S)NHPhCH.sub.2*, O, or NR.sup.1, wherein * indicates the attachment point to L.sup.3, and each R.sup.1 is independently hydrogen, C.sub.1-C.sub.6 alkyl optionally substituted with oxo, heteroaryl, or a combination thereof, optionally substituted C.sub.1-C.sub.6 heteroalkyl, or optionally substituted aryl or heteroaryl; L.sup.3 is optionally substituted C.sub.1-C.sub.50 alkyl or optionally substituted C.sub.1-C.sub.50 heteroalkyl; and Z.sup.1 is CH.sub.2, C(O), C(S), OC(O)#, C(O)O#, NR.sup.2C(O)#, C(O)NR.sup.2#, or NR.sup.2, wherein # indicates the attachment point to B, and each R.sup.2 is independently hydrogen, optionally substituted C.sub.1-C.sub.6 alkyl, or pyrrolidine-2,5-dione.

    6. The method of claim 5, wherein L.sup.3 comprises (CH.sub.2CH.sub.2O).sub.2-20 or (CH.sub.2CH.sub.2O).sub.m(CH.sub.2).sub.w, wherein m and w are each independently an integer between 0 and 10 (inclusive), and at least one of m and w is not 0.

    7. The method of any one of claims 1-6, wherein the chelating moiety is selected from the group consisting of DOTA (1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid), DOTMA (1R,4R,7R,10R)-?,?,?,?-tetramethyl-1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid, DOTAM (1,4,7,10-tetrakis(carbamoylmethyl)-1,4,7,10-tetraazacyclododecane), DOTPA (1,4,7,10-tetraazacyclododecane-1,4,7,10-tetra propionic acid), DO3AM-acetic acid (2-(4,7,10-tris(2-amino-2-oxoethyl)-1,4,7,10-tetraazacyclododecan-1-yl)acetic acid), DOTA-GA anhydride (2,2,2-(10-(2,6-dioxotetrahydro-2H-pyran-3-yl)-1,4,7,10-tetraazacyclododecane-1,4,7-triyl)triacetic acid, DOTP (1,4,7,10-tetraazacyclododecane-1,4,7,10-tetra(methylene phosphonic acid)), DOTMP (1,4,6,10-tetraazacyclodecane-1,4,7,10-tetramethylene phosphonic acid, DOTA-4AMP (1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakis(acetamido-methylenephosphonic acid), CB-TE2A (1,4,8,11-tetraazabicyclo[6.6.2]hexadecane-4,11-diacetic acid), NOTA (1,4,7-triazacyclononane-1,4,7-triacetic acid), NOTP (1,4,7-triazacyclononane-1,4,7-tri(methylene phosphonic acid), TETPA (1,4,8,11-tetraazacyclotetradecane-1,4,8,11-tetrapropionic acid), TETA (1,4,8,11-tetraazacyclotetradecane-1,4,8,11-tetra acetic acid), HEHA (1,4,7,10,13,16-hexaazacyclohexadecane-1,4,7,10,13,16-hexaacetic acid), PEPA (1,4,7,10,13-pentaazacyclopentadecane-N,N,N,N, N-pentaacetic acid), H.sub.4Octapa (N,N-bis(6-carboxy-2-pyridylmethyl)-ethylenediamine-N,N-diacetic acid), H.sub.2Dedpa (1,2-[[6-(carboxy)-pyridin-2-yl]-methylamino]ethane), H.sub.6phospa (N,N-(methylenephosphonate)-N,N-[6-(methoxycarbonyl)pyridin-2-yl]-methyl-1,2-diaminoethane), TTHA (triethylenetetramine-N,N,N,N,N,N-hexaacetic acid), DO2P (tetraazacyclododecane dimethanephosphonic acid), HP-DO3A (hydroxypropyltetraazacyclododecanetriacetic acid), EDTA (ethylenediaminetetraacetic acid), Deferoxamine, DTPA (diethylenetriaminepentaacetic acid), DTPA-BMA (diethylenetriaminepentaacetic acid-bismethylamide), HOPO (octadentate hydroxypyridinones), and porphyrin.

    8. The method of claim 1, wherein L has the structure L.sup.1-(L.sup.2).sub.n, as shown within Formula I-b:
    A-L.sup.1-(L.sup.2).sub.n-B Formula I-b wherein: A is a metal complex of DOTA; B is an FGFR3 targeting moiety; L.sup.1 is a bond or C.sub.1-C.sub.6 alkyl; n is 1; and L.sup.2 has the structure:
    X.sup.1-L.sup.3-Z.sup.1Formula III wherein: X.sup.1 is C(O)NR.sup.1*, * indicating the attachment point to L.sup.3, and R.sup.1 is H or C.sub.1-C.sub.6 alkyl; L.sup.3 is (CH.sub.2CH.sub.2O).sub.m(CH.sub.2).sub.w, and m and w are independently an integral between 0 and 10 (inclusive), and at least one of m and w is not 0; and Z.sup.1 is C(O).

    9. The method of claim 8, wherein the radioimmunoconjugate comprises the following structure: ##STR00015## wherein B is an FGFR3 targeting moiety.

    10. The method of any one of claims 1-9, wherein the FGFR3 targeting moiety is at least 100 kDa in size.

    11. The method of any one of claims 1-10, wherein the FGFR3 targeting moiety is capable of binding to wild type FGFR3, a mutant FGFR3, or both.

    12. The method of claim 11, wherein the FGFR3 targeting moiety is capable of binding to a mutant FGFR3 comprising a point mutation selected from the group consisting of FGFR3.sup.Y375C, FGFR3.sup.R248C, FGFR3.sup.S249C, FGFR3.sup.G372C, FGFR3.sup.K652E, FGFR3.sup.K652Q, FGFR3.sup.K652M, and combinations thereof.

    13. The method of claim 11, wherein the FGFR3 targeting moiety is capable of binding to a mutant FGFR3 comprising an FGFR3 fusion selected from the group consisting of FGFR3-TACC3, FGFR3-CAMK2A, FGFR3-JAKMOP1, FGFR3-TNIP2, FGFR3-WHSC1, FGFR3-BAIAP2L1, and combinations thereof.

    14. The method of any one of claims 1-13, wherein the FGFR3 targeting moiety comprises an antibody or antigen-binding fragment thereof.

    15. The method of claim 14, wherein the antibody or antigen-binding fragment thereof is a human or humanized FGFR3 antibody.

    16. The method of claim 14 or 15, wherein the antibody or antigen-binding fragment thereof comprises at least one complementarity determining region (CDR) selected from the group consisting of: CDR-H1 comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence differing in 1 or 2 amino acids therefrom; CDR-H2 comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence differing in 1 or 2 amino acids therefrom; CDR-H3 comprising the amino acid sequence of SEQ ID NO: 3 or 4, or an amino acid sequence differing in 1 or 2 amino acids from SEQ ID NO: 3 or 4; CDR-L1 comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence differing in 1 or 2 amino acids therefrom; CDR-L2 comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence differing in 1 or 2 amino acids therefrom; and CDR-L3 comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence differing in 1 or 2 amino acids therefrom.

    17. The method of claim 14 or 15, wherein the antibody or antigen-binding fragment thereof comprises (i) a heavy chain variable domain comprising at least one CDR selected from the group consisting of: CDR-H1 comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence differing in 1 or 2 amino acids therefrom; CDR-H2 comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence differing in 1 or 2 amino acids therefrom; and CDR-H3 comprising the amino acid sequence of SEQ ID NO: 3 or 4, or an amino acid sequence differing in 1 or 2 amino acids from SEQ ID NO: 3 or 4; and (ii) a light chain variable domain comprising at least one CDR selected from the group consisting of: CDR-L1 comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence differing in 1 or 2 amino acids therefrom; CDR-L2 comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence differing in 1 or 2 amino acids therefrom; and CDR-L3 comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence differing in 1 or 2 amino acids therefrom.

    18. The method of claim 17, wherein the antibody or antigen-binding fragment thereof comprises (i) a heavy chain variable domain comprising: CDR-H1 comprising the amino acid sequence of SEQ ID NO: 1; CDR-H2 comprising the amino acid sequence of SEQ ID NO: 2; and CDR-H3 comprising the amino acid sequence of SEQ ID NO: 3 or 4; and (ii) a light chain variable domain comprising: CDR-L1 comprising the amino acid sequence of SEQ ID NO: 5; CDR-L2 comprising the amino acid sequence of SEQ ID NO: 6; and CDR-L3 comprising the amino acid sequence of SEQ ID NO: 7.

    19. The method of any one of claims 16-18, wherein the antibody or antigen-binding fragment thereof comprises (i) a heavy chain variable domain having an amino acid sequence with at least 85% identity with the amino acid sequence of SEQ ID NO: 8; and (ii) a light chain variable domain having an amino acid sequence with at least 85% identity with the amino acid sequence of SEQ ID NO: 9.

    20. The method of claim 19, wherein the antibody or antigen-binding fragment thereof comprises (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 8; and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 9.

    21. The method of any one of claims 14-20, wherein the antibody is MFGR1877S (vofatamab).

    22. The method of any one of claims 1-7, wherein A-L is a metal complex of a moiety selected from the group consisting of: ##STR00016##

    23. The method of any one of claims 1-22, wherein the radioimmunoconjugate comprises the following structure: ##STR00017##

    24. The method of any one of claims 1-23, wherein the cancer is a solid tumor cancer selected from the group consisting of adrenocortical carcinoma, bladder cancer, breast cancer, cervical cancer, colorectal cancer, endometrial adenocarcinoma, Ewing's sarcoma, gallbladder carcinoma, glioma, head and neck cancer, liver cancer, lung cancer, neuroblastoma, neuroendocrine cancer, pancreatic cancer, prostate cancer, renal cell carcinoma, salivary adenoid cystic cancer, and spermatocytic seminoma.

    25. The method of any one of claims 1-23, wherein the cancer is a hematologic cancer selected from the group consisting of myeloma, leukemia, and lymphoma.

    26. The method of any one of claims 1-25, wherein the FGFR3 targeting moiety within the radioimmunoconjugate, and the cold FGFR3-targeting molecule are capable of binding the same epitope on FGFR3.

    27. The method of any one of claims 1-26, wherein the subject is administered an amount of cold FGFR3-targeting molecule that is at least 5-fold and at most 125-fold greater than the amount of FGFR3 targeting moiety within the radioimmunoconjugate administered to the subject.

    28. The method of any one of claims 1-27, wherein the subject is administered at least 2.5 mg/kg of cold FGFR3 targeting molecule.

    29. The method of any one of claims 1-28, wherein the radioimmunoconjugate is administered at a dosage of about 50 nCi to about 200 nCi.

    30. The method of any one of claims 1-29, wherein the cold FGFR3-targeting molecule comprises vofatamab or an antigen-binding fragment thereof.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0173] FIG. 1A is a schematic depicting the general structure of bifunctional chelate comprising a chelate, a linker, and a cross-linking group.

    [0174] FIG. 1B is a schematic depicting the general structure of a bifunctional conjugate comprising a chelate, a linker, and a targeting moiety.

    [0175] FIG. 1C is a schematic depicting the structure of [.sup.225Ac]-DOTA-anti-FGFR3, an exemplary radioimmunoconjugate disclosed herein.

    [0176] FIG. 2 is a schematic depicting the synthesis of the bifunctional chelate, 4-{[11-oxo-11-(2,3,5,6-tetrafluorophenoxy)undecyl]carbamoyl}-2-[4,7,10-tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]butanoic acid (Compound B). Synthesis of Compound B is described in Example 2.

    [0177] FIG. 3 is a schematic depicting the synthesis of the bifunctional chelate, 4-{[2-(2-{2-[3-oxo-3-(2,3,5,6-tetrafluorophenoxy)propoxy]ethoxy}ethoxy)ethyl]carbamoyl}-2-[4,7,10-tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]butanoic acid (Compound C). Synthesis of Compound C is described in Example 4.

    [0178] FIGS. 4A-4C are binding curves for unlabeled DOTA-anti-FGFR3 binding to RT4 (FIG. 4A), RT112 (FIG. 4B), and HepG2 (FIG. 4C) FGFR3-positive tumor cells. See Example 18.

    [0179] FIG. 5 shows a plot representing the results of biodistribution studies in mice bearing RT4 (bladder cancer) xenograft tumors and injected with [.sup.177Lu]-DOTA-anti-FGFR3. Percentage injected dose per gram of tissue (% ID/g) is plotted on the x-axis and is shown for blood, kidney, liver, lung, spleen, skin, tumor, and tail at 4, 24, 48, 96, and 168 hours. See Example 19.

    [0180] FIG. 6A shows a plot representing the results of biodistribution studies in mice bearing RT112 (bladder cancer) xenograft tumors and injected with [.sup.177Lu]-DOTA-anti-FGFR3. % ID/g is plotted on the x-and is shown for blood, intestine, kidney and adrenal glands, liver and gall bladder, lung, spleen, skin, bladder, urine, and tumor at 4, 24, 48, and 96 hours. See Example 20.

    [0181] FIG. 6B shows a plot representing the results of biodistribution studies in mice bearing RT112 (bladder cancer) xenograft tumors and injected with [.sup.177Lu]-DOTA-anti-FGFR3 after a pre-dose with cold anti-FGFR3. % ID/g is plotted on the x-axis and is shown for blood, intestine, kidney and adrenal glands, liver and gall bladder, lung, spleen, skin, bladder, urine, and tumor at 4, 24, 48, and 96 hours. Mice received a pre-dose of 100 ?g cold (non-radioactive, un-conjugated) anti-FGFR3 antibody 3 hours before receiving [.sup.177Lu]-DOTA-anti-FGFR3. See Example 20.

    [0182] FIGS. 7A-7C show plots representing the results of biodistribution studies in mice bearing RT112 (bladder cancer) xenograft tumors and co-dosed with cold anti-FGFR3 and [.sup.177Lu]-DOTA-anti-FGFR3. % ID/g is plotted on the x-axis and is shown for blood, intestine, kidney, liver, lung, spleen, skin, bladder, urine, and tumor at 24 and 96 hours. Mice were co-administered 50 ?g (FIG. 7A), 100 ?g (FIG. 7B), or 200 ?g (FIG. 7C) cold anti-FGFR3; cold anti-FGFR3 was administered at the same time as [.sup.177Lu]-DOTA-anti-FGFR3. See Example 21.

    [0183] FIGS. 8A-8B show plots representing the results of biodistribution studies in mice bearing RT112 (bladder cancer) xenograft tumors and co-dosed with cold anti-FGFR3 and either [.sup.177Lu]-DOTA-anti-FGFR3 (FIG. 8A) or [.sup.111In]-DOTA-anti-FGFR3 (FIG. 8B). % ID/g is plotted on the x-axis and is shown for blood, intestine, kidney, liver, lung, spleen, skin, bladder, and tumor at 4, 24, 48, 96, and 168 hours. Mice were co-administered 100 ?g cold anti-FGFR3 together with [.sup.177Lu]-DOTA-anti-FGFR3. See Example 21.

    [0184] FIGS. 9A-9B are plots showing relative tumor volumes (FIG. 9A) and relative body weights (FIG. 9B) in mice who, at the beginning of the experiment, bore RT112 xenograft tumors. Relative tumor volumes (FIG. 9A) and relative body weights (FIG. 9B) are shown at various timepoints after treatment with [.sup.225Ac]-DOTA-anti-FGFR3. Mice were administered a pre-dose of 100 ?g cold anti-FGFR3 3 h before dosing with the [.sup.225Ac]-DOTA-anti-FGFR3. See Example 22.

    [0185] FIGS. 10A-10B are plots showing relative tumor volumes (FIG. 10A) and relative body weights (FIG. 10B) in mice who, at the beginning of the experiment, bore RT112 xenograft tumors. Relative tumor volumes (FIG. 10A) and relative body weights (FIG. 10B) are shown at various timepoints after treatment with [.sup.225Ac]-DOTA-anti-FGFR3. Mice were co-administered 100 ?g cold anti-FGFR3. See Example 23.

    [0186] FIG. 11 shows plots representing the results of biodistribution studies in mice bearing UM-UC-1 (bladder cancer) xenograft tumors co-dosed with cold anti-FGFR3 and [.sup.177Lu]-DOTA-anti-FGFR3. Percentage injected dose per gram of tissue (% ID/g) is plotted on the x-axis and is shown for blood, intestines, kidneys and adrenals, liver and gall bladder, lungs, spleen, skin, and tumor at 4, 24, 48, 96, and 168 hours. See Example 24.

    [0187] FIG. 12 is a plot showing relative tumor volumes in mice who, at the beginning of the experiment, bore UM-UC-1 xenograft tumors. Relative tumor volumes are shown at various timepoints after treatment with [.sup.225Ac]-DOTA-anti-FGFR3 co-dosed with 200 ?g cold anti-FGFR3 antibody. See Example 25.

    [0188] FIG. 13 shows plots representing the results of biodistribution studies in mice bearing RT112 (bladder cancer) xenograft tumors co-dosed with cold anti-FGFR3 and [.sup.177Lu]-DOTA-anti-FGFR3. Percentage injected dose per gram of tissue (% ID/g) is plotted on the x-axis and is shown for blood, intestines, kidneys and adrenals, liver and gall bladder, lungs, spleen, skin, and tumor at 4, 24, 48, 96, and 168 hours. See Example 26.

    [0189] FIG. 14 is a plot showing relative tumor volumes in mice who, at the beginning of the experiment, bore RT112 xenograft tumors. Relative tumor volumes are shown at various timepoints after treatment with [.sup.225Ac]-DOTA-anti-FGFR3 co-dosed with 200 ?g cold anti-FGFR3 antibody. See Example 27.

    [0190] FIGS. 15A-15B are plots showing relative tumor volumes in mice who, at the beginning of the experiment, bore RT112 xenograft tumors. Relative tumor volumes are shown at various timepoints after treatment with [.sup.225Ac]-DOTA-anti-FGFR3, [.sup.225Ac]-DOTA-anti-FGFR3-I, and [.sup.225Ac]-DOTA-anti-FGFR3-II co-dosed with 200 ?g cold anti-FGFR3 antibody. See Example 28.

    DETAILED DESCRIPTION

    [0191] Radioimmunoconjugates are designed to target a protein or receptor that is upregulated in a disease state to deliver a radioactive payload to damage and kill cells of interest (radioimmunotherapy). The process of delivering such a payload, via radioactive decay, produces an alpha, beta, or gamma particle or Auger electron that can cause direct effects to DNA (such as single or double stranded DNA breaks) or indirect effects such as by-stander or crossfire effects.

    [0192] Radioimmunoconjugates typically contain a biological targeting moiety (e.g., an antibody or antigen binding fragment thereof that is capable of specifically binding to human FGFR3), a radioisotope, and a molecule that links the two. Conjugates are formed when a bifunctional chelate is appended to the biological targeting molecule so that structural alterations are minimal while maintaining target affinity. Once radiolabelled, the final radioimmunoconjugate is formed.

    [0193] Bifunctional chelates structurally contain a chelate, a linker, and a cross-linking group (FIG. 1A). When developing new bifunctional chelates, most efforts focus around the chelating portion of the molecule. Several examples of bifunctional chelates have been described with various cyclic and acyclic structures conjugated to a targeted moiety. [Bioconjugate Chem. 2000, 11, 510-519; Bioconjugate Chem. 2012, 23, 1029-1039; Mol Imaging Biol. 2011, 13, 215-221, Bioconjugate Chem. 2002, 13, 110-115.]

    [0194] One of the key factors of developing safe and effective radioimmunoconjugates is maximizing efficacy while minimizing off-target toxicity in normal tissue. While this statement is one of the core tenets of developing new drugs, the application to radioimmunotherapeutics presents new challenges. Radioimmunoconjugates do not need to block a receptor, as needed with a therapeutic antibody, or release the cytotoxic payload intracellularly, as required with an antibody drug conjugate, in order to have therapeutic efficacy. However, the emission of the toxic particle is an event that occurs as a result of first-order (radioactive) decay and can occur at random anywhere inside the body after administration. Once the emission occurs, damage could occur to surrounding cells within the range of the emission leading to the potential of off-target toxicity. Therefore, limiting exposure of these emissions to normal tissue is the key to developing new drugs.

    [0195] One potential method for reducing off-target exposure is to remove the radioactivity more effectively from the body (e.g., from normal tissue in the body). One mechanism is to increase the rate of clearance of the biological targeting agent. This approach likely requires identifying ways to shorten the half-life of the biological targeting agent, which is not well described for biological targeting agents. Regardless of the mechanism, increasing drug clearance will also negatively impact the pharmacodynamics/efficacy in that the more rapid removal of drug from the body will lower the effective concentration at the site of action, which, in turn, would require a higher total dose and would not achieve the desired results of reducing total radioactive dose to normal tissue.

    [0196] Other efforts have focused on accelerating the metabolism of the portion of the molecule that contains the radioactive moiety. To this end, some efforts have been made to increase the rate of cleavage of the radioactivity from the biological targeting agents using what have been termed cleavable linkers. Cleavable linkers, however, have been taken on different meaning as it relates to radioimmunoconjugates. Cornelissen, et al. has described cleavable linkers as those by which the bifunctional chelate attaches to the biologic targeting agent through a reduced cysteine, whereas others have described the use of enzyme-cleavable systems that require the co-administration of the radioimmunoconjugate with a cleaving agent/enzyme to release [Mol Cancer Ther. 2013, 12(11), 2472-2482; Methods Mol Biol. 2009, 539, 191-211; Bioconjug Chem. 2003, 14(5), 927-33]. These methods either change the nature of the biological targeting moiety, in the case of the cysteine linkage, or are not practical from a drug development perspective (enzyme cleavable systems) since, in the case of the citations provided, require the administration of two agents.

    [0197] The present disclosure provides, among other things, methods of treating cancer using radioimmunoconjugates that, in various embodiments, result in increased tumor uptake, reduced uptake in normal tissue(s), and/or result in decreased toxicity. Methods disclosed herein may, in some embodiments, allow a subject to tolerate a higher radioactive dose than other methods using radioimmunoconjugates.

    Definitions

    [0198] As used herein, the term about or approximately, when used in reference to a quantitative value, includes the recited quantitative value itself, unless specifically stated otherwise. As used herein, the term about or approximately refers to a ?10% variation from the recited quantitative value unless otherwise indicated or inferred from the context.

    [0199] As used herein, antibody refers to a polypeptide whose amino acid sequence includes immunoglobulins and fragments thereof which specifically bind to a designated antigen, or fragments thereof. Antibodies in accordance with the present invention may be of any type (e.g., IgA, IgD, IgE, IgG, or IgM) or subtype (e.g., IgA1, IgA2, IgG1, IgG2, IgG3, or IgG4). Those of ordinary skill in the art will appreciate that a characteristic sequence or portion of an antibody may include amino acids found in one or more regions of an antibody (e.g., variable region, hypervariable region, constant region, heavy chain, light chain, and combinations thereof). Moreover, those of ordinary skill in the art will appreciate that a characteristic sequence or portion of an antibody may include one or more polypeptide chains, and may include sequence elements found in the same polypeptide chain or in different polypeptide chains.

    [0200] As used herein, antigen-binding fragment refers to a portion of an antibody that retains the binding characteristics of the parent antibody.

    [0201] As used herein, the term bind or binding of a targeting moiety means an at least temporary interaction or association with or to a target molecule, e.g., to human FGFR3 and/or mutant FGFR3, e.g., as described herein.

    [0202] The term bifunctional chelate, as used herein, refers to a compound that comprises a chelate, a linker, and a cross-linking group. See, e.g., FIG. 1A. A cross-linking group is a reactive group that is capable of joining two or more molecules, e.g., joining a bifunctional chelate and a targeting moiety, by a covalent bond.

    [0203] The term bifunctional conjugate, as used herein, refers to a compound that comprises a chelate or metal complex thereof, a linker, and a targeting moiety, e.g., an antibody or antigen-binding fragment thereof. See, e.g., Formula I-a or FIG. 1B.

    [0204] The term cancer refers to any cancer caused by the proliferation of malignant neoplastic cells, such as tumors, neoplasms, carcinomas, sarcomas, leukemias, and lymphomas. A solid tumor cancer is a cancer comprising an abnormal mass of tissue, e.g., sarcomas, carcinomas, and lymphomas. A hematological cancer or liquid cancer, as used interchangeably herein, is a cancer present in a body fluid, e.g., lymphomas and leukemias.

    [0205] As used herein, the phrases co-administer, administer in combination, or combined administration means that two or more agents are administered to a subject at the same time or within an interval such that there may be an overlap of an effect of each agent on the subject. Thus, two or more agents that are administered in combination need not be administered together. In some embodiments, the two or more agents are administered within 24 hours (e.g., 12, 6, 5, 4, 3, 2, or 1 hour(s) of one another, or within about 60, 30, 15, 10, 5, or 1 minute(s) of one another. In some embodiments, the two or more agents are administered together, e.g.., in the same formulation or, e.g., in different formulations but at the same time.

    [0206] As used herein, the term cold, when used to describe an agent (e.g., a targeting moiety, such as an antibody or antigen-binding fragment thereof) means that the agent is not radioactive, e.g., not labeled with a radionuclide. A cold agent may or may not be conjugated to another moiety or modified in some way, so long as the cold agent is not radioactive.

    [0207] The term chelate, as used herein, refers to an organic compound or portion thereof that can be bonded to a central metal or radiometal atom at two or more points.

    [0208] The term conjugate, as used herein, refers to a molecule that contains a chelating group or metal complex thereof, a linker group, and which optionally contains a targeting moiety, e.g., an antibody or antigen-binding fragment thereof.

    [0209] As used herein, the term compound, is meant to include all stereoisomers, geometric isomers, and tautomers of the structures depicted.

    [0210] The compounds recited or described herein can be asymmetric (e.g., having one or more stereocenters). All stereoisomers, such as enantiomers and diastereomers, are intended unless otherwise indicated. Compounds discussed in the present disclosure that contain asymmetrically substituted carbon atoms can be isolated in optically active or racemic forms. Methods on how to prepare optically active forms from optically active starting materials are known in the art, such as by resolution of racemic mixtures or by stereoselective synthesis.

    [0211] As used herein, detection agent refers to a molecule or atom which is useful in diagnosing a disease by locating the cells containing the antigen. Various methods of labeling polypeptides with detection agents are known in the art. Examples of detection agents include, but are not limited to, radioisotopes and radionuclides, dyes (such as with the biotin-streptavidin complex), contrast agents, luminescent agents (e.g., fluorescein isothiocyanate or FITC, rhodamine, lanthanide phosphors, cyanine, and near IR dyes), and magnetic agents, such as gadolinium chelates. As used herein, the term radionuclide refers to an atom capable of undergoing radioactive decay (e.g., .sup.3H, .sup.14C, .sup.15N, .sup.18F, .sup.35S, .sup.47Sc, .sup.55Co, .sup.60Cu, .sup.61Cu, .sup.62 Cu, .sup.64 Cu, .sup.67Cu, .sup.75Br, .sup.76Br , .sup.77Br , .sup.89Zr, .sup.86Y, .sup.87Y, .sup.90Y, .sup.97Ru, .sup.99Tc, .sup.99mTc, .sup.105Rh, .sup.109Pd, .sup.111In, .sup.123I, .sup.124I, .sup.125I, .sup.131I, .sup.149Pm, .sup.149Tb, .sup.153Sm, .sup.166Ho, .sup.177Lu, .sup.186Re, .sup.188Re, .sup.198Au, .sup.199Au, .sup.203Pb, .sup.211At, .sup.212Pb, .sup.212Bi, .sup.213Bi, .sup.223Ra, .sup.225Ac, .sup.227Th, .sup.229Th, .sup.66Ga, .sup.67Ga, .sup.68Ga, .sup.82Rb, .sup.117mSn, .sup.201Tl). The terms radioactive nuclide, radioisotope, or radioactive isotope may also be used to describe a radionuclide. Radionuclides may be used as detection agents, as described herein. In some embodiments, the radionuclide may be an alpha-emitting radionuclide.

    [0212] The term an effective amount of an agent (e.g., any of the foregoing conjugates), as used herein, is that amount sufficient to effect beneficial or desired results, such as clinical results, and, as such, an effective amount depends upon the context in which it is being applied. For example, in therapeutic applications, an effective amount may be an amount sufficient to cure or at least partially arrest the symptoms of the disorder and its complications, and/or to substantially improve at least one symptom associated with the disease or a medical condition. For example, in the treatment of cancer, an agent or compound that decreases, prevents, delays, suppresses, or arrests any symptom of the disease or condition would be therapeutically effective. A therapeutically effective amount of an agent or compound is not required to cure a disease or condition but may, for example, provide a treatment for a disease or condition such that the onset of the disease or condition is delayed, hindered, or prevented, such that the disease or condition symptoms are ameliorated, or such that the term of the disease or condition is changed. For example, the disease or condition may become less severe and/or recovery is accelerated in an individual. An effective amount may be administered by administering a single dose or multiple (e.g., at least two, at least three, at least four, at least five, or at least six) doses.

    [0213] The term immunoconjugate, as used herein, refers to a conjugate that includes a targeting moiety, such as an antibody (or antigen-binding fragment thereof), nanobody, affibody, or a consensus sequence from Fibronectin type III domain. In some embodiments, the immunoconjugate comprises an average of at least 0.10 conjugates per targeting moiety (e.g., an average of at least 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 2, 4, 5, or 8 conjugates per targeting moiety).

    [0214] The term radioconjugate, as used herein, refers to any conjugate that includes a radioisotope or radionuclide, such as any of the radioisotopes or radionuclides described herein.

    [0215] The term radioimmunoconjugate, as used herein, refers to any immunoconjugate that includes a radioisotope or radionuclide, such as any of the radioisotopes or radionuclides described herein. A radioimmunoconjugate provided in the present disclosure typically refers to a bifunctional conjugate that comprises a metal complex formed from a radioisotope or radionuclide.

    [0216] The term radioimmunotherapy, as used herein, refers a method of using a radioimmunoconjugate to produce a therapeutic effect. In some embodiments, radioimmunotherapy may include administration of a radioimmunoconjugate to a subject in need thereof, wherein administration of the radioimmunoconjugate produces a therapeutic effect in the subject. In some embodiments, radioimmunotherapy may include administration of a radioimmunoconjugate to a cell, wherein administration of the radioimmunoconjugate kills the cell. Wherein radioimmunotherapy involves the selective killing of a cell, in some embodiments the cell is a cancer cell in a subject having cancer.

    [0217] The term pharmaceutical composition, as used herein, represents a composition containing a radioimunoconjugate described herein formulated with a pharmaceutically acceptable excipient. In some embodiments, the pharmaceutical composition is manufactured or sold with the approval of a governmental regulatory agency as part of a therapeutic regimen for the treatment of disease in a mammal. Pharmaceutical compositions can be formulated, for example, for oral administration in unit dosage form (e.g., a tablet, capsule, caplet, gelcap, or syrup); for topical administration (e.g., as a cream, gel, lotion, or ointment); for intravenous administration (e.g., as a sterile solution free of particulate emboli and in a solvent system suitable for intravenous use); or in any other formulation described herein.

    [0218] A pharmaceutically acceptable excipient, as used herein, refers any ingredient other than the compounds described herein (for example, a vehicle capable of suspending or dissolving the active compound) and having the properties of being nontoxic and non-inflammatory in a patient. Excipients may include, for example: antiadherents, antioxidants, binders, coatings, compression aids, disintegrants, dyes (colors), emollients, emulsifiers, fillers (diluents), film formers or coatings, flavors, fragrances, glidants (flow enhancers), lubricants, preservatives, printing inks, radioprotectants, sorbents, suspending or dispersing agents, sweeteners, or waters of hydration. Exemplary excipients include, but are not limited to: ascorbic acid, histidine, phosphate buffer, butylated hydroxytoluene (BHT), calcium carbonate, calcium phosphate (dibasic), calcium stearate, croscarmellose, crosslinked polyvinyl pyrrolidone, citric acid, crospovidone, cysteine, ethylcellulose, gelatin, hydroxypropyl cellulose, hydroxypropyl methylcellulose, lactose, magnesium stearate, maltitol, mannitol, methionine, methylcellulose, methyl paraben, microcrystalline cellulose, polyethylene glycol, polyvinyl pyrrolidone, povidone, pregelatinized starch, propyl paraben, retinyl palmitate, shellac, silicon dioxide, sodium carboxymethyl cellulose, sodium citrate, sodium starch glycolate, sorbitol, starch (corn), stearic acid, stearic acid, sucrose, talc, titanium dioxide, vitamin A, vitamin E, vitamin C, and xylitol.

    [0219] The term pharmaceutically acceptable salt, as use herein, represents those salts of the compounds described here that are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and animals without undue toxicity, irritation, or allergic response. Pharmaceutically acceptable salts are well known in the art. For example, pharmaceutically acceptable salts are described in: Berge et al., J. Pharmaceutical Sciences 66:1-19, 1977 and in Pharmaceutical Salts: Properties, Selection, and Use, (Eds. P.H. Stahl and C.G. Wermuth), Wiley-VCH, 2008. Salts can be prepared in situ during the final isolation and purification of the compounds described herein or separately by reacting the free base group with a suitable organic acid.

    [0220] The compounds of the invention may have ionizable groups so as to be capable of preparation as pharmaceutically acceptable salts. These salts may be acid addition salts involving inorganic or organic acids or the salts may, in the case of acidic forms of the compounds of the invention be prepared from inorganic or organic bases. Frequently, the compounds are prepared or used as pharmaceutically acceptable salts prepared as addition products of pharmaceutically acceptable acids or bases. Suitable pharmaceutically acceptable acids and bases are well-known in the art, such as hydrochloric, sulphuric, hydrobromic, acetic, lactic, citric, or tartaric acids for forming acid addition salts, and potassium hydroxide, sodium hydroxide, ammonium hydroxide, caffeine, various amines for forming basic salts. Methods for preparation of the appropriate salts are well-established in the art.

    [0221] Representative acid addition salts include acetate, adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, fumarate, glucoheptonate, glycerophosphate, hemisulfate, heptonate, hexanoate, hydrobromide, hydrochloride, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate, persulfate, 3-phenylpropionate, phosphate, picrate, pivalate, propionate, stearate, succinate, sulfate, tartrate, thiocyanate, toluenesulfonate, undecanoate, valerate salts, among others. Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, and magnesium, as well as nontoxic ammonium, quaternary ammonium, and amine cations, including, but not limited to ammonium, tetramethylammonium, tetraethylammonium, methylamine, dimethylamine, trimethylamine, triethylamine, and ethylamine.

    [0222] The term polypeptide, as used herein, refers to a string of at least two amino acids attached to one another by a peptide bond. In some embodiments, a polypeptide may include at least 3-5 amino acids, each of which is attached to others by way of at least one peptide bond. Those of ordinary skill in the art will appreciate that polypeptides can include one or more non-natural amino acids or other entities that nonetheless are capable of integrating into a polypeptide chain. In some embodiments, a polypeptide may be glycosylated, e.g., a polypeptide may contain one or more covalently linked sugar moieties. In some embodiments, a single polypeptide (e.g., an antibody polypeptide) may comprise two or more individual polypeptide chains, which may in some cases be linked to one another, for example by one or more disulfide bonds or other means.

    [0223] By subject is meant a human or non-human animal (e.g., a mammal).

    [0224] By substantial identity or substantially identical is meant a polypeptide sequence that has the same polypeptide sequence, respectively, as a reference sequence, or has a specified percentage of amino acid residues, respectively, that are the same at the corresponding location within a reference sequence when the two sequences are optimally aligned. For example, an amino acid sequence that is substantially identical to a reference sequence has at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the reference amino acid sequence. For polypeptides, the length of comparison sequences will generally be at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 50, 75, 90, 100, 150, 200, 250, 300, or 350 contiguous amino acids (e.g., a full-length sequence). Sequence identity may be measured using sequence analysis software on the default setting (e.g., Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, WI 53705). Such software may match similar sequences by assigning degrees of homology to various substitutions, deletions, and other modifications.

    [0225] As used herein, the term targeting moiety refers to any molecule or any part of a molecule that is capable of binding to a given target. The term, FGFR3 targeting moiety refers to a targeting moiety that is capable of binding to an FGFR3 molecule, e.g., a human FGFR3, e.g. a wild type or mutant FGFR3.

    [0226] As used herein, and as well understood in the art, to treat a condition or treatment of the condition (e.g., the conditions described herein such as cancer) is an approach for obtaining beneficial or desired results, such as clinical results. Beneficial or desired results can include, but are not limited to, alleviation or amelioration of one or more symptoms or conditions; diminishment of extent of disease, disorder, or condition; stabilized (i.e., not worsening) state of disease, disorder, or condition; preventing spread of disease, disorder, or condition; delay or slowing the progress of the disease, disorder, or condition; amelioration or palliation of the disease, disorder, or condition; and remission (whether partial or total), whether detectable or undetectable. Palliating a disease, disorder, or condition means that the extent and/or undesirable clinical manifestations of the disease, disorder, or condition are lessened and/or time course of the progression is slowed or lengthened, as compared to the extent or time course in the absence of treatment.

    Methods of Treatment

    [0227] In one aspect, provided are methods of treating cancer comprise a step of administering to a subject in need thereof a pharmaceutical composition comprising an effective amount of a radioimmunoconjugate as described further herein (e.g., a radioimmunoconjugate comprising an FGFR3-targeting moiety), and wherein the subject is being co-administered a cold FGFR3-targeting molecule.

    [0228] By cold it is meant that the FGFR3 targeting molecule is not radioactive, e.g., not labeled with a radionuclide. An FGFR3-targeting molecule as used herein refers to a molecule comprising an FGFR3-targeting moiety, e.g., any FGFR3-targeting moiety as described herein. For example, in some embodiments, the cold FGFR3-targeting molecule is an antibody or antigen-binding fragment thereof that is capable of binding to FGFR3. In some embodiments, the radioimmunoconjugate and the cold FGFR3-targeting molecule are capable of binding the same epitope on FGFR3.

    Co-Administration

    [0229] By co-administered, it is meant that the radioimmunoconjugate and the cold FGFR3-targeting molecule are administered to a subject at the same time or within an interval such that there may be an overlap of an effect of each agent in the subject. The radioimmunoconjugate and the cold FGFR3-targeting molecule need not be administered together. For example, in some embodiments, a radioimmunoconjugate and a cold FGFR3-targeting moiety are administered within 24 hours (e.g., 12, 6, 5, 4, 3, 2, or 1 hour(s) of one another, or within about 60, 30, 15, 10, 5, or 1 minute(s) of one another. In some embodiments, the FGFR3-targeting moiety together, e.g.., in the same formulation or, e.g., in different formulations but at the same time.

    [0230] In some embodiments, the cold FGFR3-targeting molecule is administered before the radioimmunoconjugate is administered. For example, in some embodiments, the FGFR3-targeting molecule is administered less than 12 hours, less than 11 hours, less than 10 hours, less than 9 hours, less than 8 hours, less than 7 hours, less than 6 hours, less than 5 hours, less than 4 hours, less than 3 hours, less than 2 hours, less than 1 hour, or less than 30 minutes before the radioimmunoconjugate is administered.

    [0231] In some embodiments, the cold FGFR3-targeting molecule is administered at the same time the radioimmunoconjugate is administered.

    Relative Amounts

    [0232] In some embodiments, the subject is administered an amount of cold FGFR3-targeting molecule that is greater than the amount of FGFR3-targeting moiety within the radioimmunoconjugate administered to the subject, e.g., at least 5-fold, at least 6.25-fold, at least 7.5-fold, at least 10-fold, at least 12.5-fold, at least 25-fold, at least 50-fold, or at least 100-fold greater than the amount of FGFR3-targeting moiety within the radioimmunoconjugate administered to the subject.

    [0233] In some embodiments, the subject is administered an amount of cold FGFR3-targeting molecule that is at most 125-fold, at most 100-fold, or at most 50-fold greater than the amount of FGFR3-targeting moiety within the radioimmunoconjugate administered to the subject.

    [0234] In some embodiments, the subject is administered an amount of cold FGFR3-targeting molecule that is at least 5-fold and at most 125-fold (e.g., 5-fold to 100-fold, or 5-fold to 50-fold) greater than the amount of FGFR3-targeting moiety within the radioimmunoconjugate administered to the subject.

    [0235] In some embodiments, the subject is administered an amount of cold FGFR3-targeting molecule that is between 5-fold greater and 125-fold greater, between 5-fold greater and 100-fold greater, between 5-fold and 50-fold greater, between 5-fold and 25-fold greater, between 10-fold and 100-fold greater, between 10-fold and 50-fold greater, between 10-fold and 25-fold greater, between 12.5-fold and 100-fold greater, between 12.5-fold and 50-fold greater, or between 12.5-fold and 25-fold greater than the amount of FGFR3-targeting moiety within the radioimmunoconjugate administered to the subject.

    [0236] In some embodiments, the subject is administered at least 2.5 mg/kg, at least 5 mg/kg, or at least 10 mg/kg of cold FGFR3-targeting molecule. In some embodiments, the subject is administered about 2.5 mg/kg, about 5 mg/kg, or about 10 mg/kg of cold FGFR3-targeting molecule.

    [0237] In some embodiments, the subject is administered between about 50 nCi to about 400 nCi, between about 50 nCi to about 300 nCi, between about 50 nCi to about 500 nCi, between about 50 nCi to about 200 nCi, between about 50 nCi to about 150 nCi, between about 50 nCi to about 100 nCi, between about 50 nCi to about 75 nCi, between about 75 nCi to about 500 nCi, between about 75 nCi to about 400 nCi, between about 75 nCi to about 300 nCi, between about 75 nCi to about 500 nCi, between about 75 nCi to about 200 nCi, between about 75 nCi to about 150 nCi, between about 75 nCi to about 100 nCi, between about 100 nCi to about 400 nCi, between about 100 nCi to about 300 nCi, between about 100 nCi to about 400 nCi, between about 100 nCi to about 200 nCi, between about 100 nCi to about 150 nCi, between about 150 nCi to about 500 nCi, between about 150 nCi to about 400 nCi, between about 150 nCi to about 300 nCi, between about 150 nCi to about 200 nCi, between about 200 nCi to about 500 nCi, between about 200 nCi to about 400 nCi, between about 200 nCi to about 300 nCi, or between about 300 nCi to about 400 nCi of the radioimmunoconjugate.

    [0238] In some embodiments, the subject is administered between about 50 nCi to about 200 nCi of the radioimmunoconjugate.

    Functional Outputs

    [0239] In some embodiments, a subject who has been treated with a method disclosed herein exhibits one or more improved characteristics as measured relative to a reference level. As used herein, the term reference level is a level as determined by the use of a control method in an experimental animal model or clinical trial. In some embodiments, the reference level refers to a level observed in a subject administered the same radioimmunoconjugate (and in some embodiments, with the same dosing protocol, including radioactive dose) but without co-administration of a cold FGFR3-targeting moiety.

    [0240] In some embodiments, a subject who has been treated with a method disclosed herein exhibits increased tumor uptake of the radioimmunoconjugate relative to a reference level, e.g., at least 1.2 times greater, at least 1.5 times greater, at least 2.0 times greater, at least 2.5 times greater, or at least 3 times greater levels in a tumor than a reference level at 24 h after administration of the radioimmunoconjugate. In some embodiments, a subject who has been treated with a method disclosed herein exhibits at least 1.2 times greater, at least 1.5 times greater, at least 2.0 times greater, at least 2.5 times greater, or at least 3 times greater levels in a tumor than a reference level at 48 h after administration of the radioimmunoconjugate. In some embodiments, a subject who has been treated with a method disclosed herein exhibits at least 1.2 times greater, at least 1.5 times greater, at least 2.0 times greater, at least 2.5 times greater, or at least 3 times greater in a tumor than a reference level at 96 h after administration of the radioimmunoconjugate.

    [0241] In some embodiments, the subject exhibits a % ID/g of greater than 10%, greater than 15%, or greater than 20% in a tumor at 24 h after administration of the radioimmunoconjugate. In some embodiments, the subject exhibits a % ID/g of greater than 10%, greater than 15%, greater than 20%, greater than 25%, greater than 30%, greater than 35%, greater than 40%, or greater than 45% in a tumor at 96 h after administration of the radioimmunoconjugate.

    [0242] In some embodiments, a subject who has been treated with a method disclosed herein exhibits reduced uptake of the radioimmunoconjugate in one or more normal (non-tumor) tissues relative to a reference level, e.g., 90% or less, 85% or less, 80% or less, 75% or less, 70% or less, 65% or less, 60% or less, 65% or less, or 50% or less of a reference level in one or more normal tissues at 24 h after administration of the radioimmunoconjugate. In some embodiments, the subject exhibits 90% or less, 85% or less, 80% or less, 75% or less, 70% or less, 65% or less, 60% or less, 65% or less, or 50% or less of a reference level in one or more normal tissues at 48 h after administration of the radioimmunoconjugate. In some embodiments, the subject exhibits 90% or less, 85% or less, 80% or less, 75% or less, 70% or less, 65% or less, 60% or less, 65% or less, or 50% or less of a reference level in one or more normal tissues at 96 h after administration of the radioimmunoconjugate.

    [0243] In some embodiments, the subject exhibits a % ID/g of less than 10% in an internal organ (e.g., intestines, kidneys, adrenals, liver, gall bladder, lungs, spleen, skin, and/or bladder) at 4 h after administration of the radioimmunoconjugate. In some embodiments, the subject exhibits a % ID/g of less than 10% in an internal organ (e.g., intestines, kidneys, adrenals, liver, gall bladder, lungs, spleen, skin, and/or bladder) at 24 h after administration of the radioimmunoconjugate. In some embodiments, the subject exhibits a % ID/g of less than 10% in an internal organ (e.g., intestines, kidneys, adrenals, liver, gall bladder, lungs, spleen, skin, and/or bladder) at 48 h after administration of the radioimmunoconjugate. In some embodiments, the subject exhibits a % ID/g of less than 10% in an internal organ (e.g., intestines, kidneys, adrenals, liver, gall bladder, lungs, spleen, skin, and/or bladder) at 96 h after administration of the radioimmunoconjugate.

    [0244] In some embodiments, a subject who has been treated with a method disclosed herein exhibits reduced clearance of the radioimmunoconjugate from the blood relative to a reference level, e.g., as evidenced by a higher % ID/g in the blood.

    [0245] In some embodiments, a subject who has been treated with a method disclosed herein exhibits at least 5-fold, at least 10-fold, at least 20-fold, or at least 30-fold greater levels of radioactivity in the blood than a reference level at 24 h after administration of the radioimmunoconjugate. In some embodiments, a subject who has been treated with a method disclosed herein exhibits at least 5-fold, at least 10-fold, at least 20-fold, at least 30-fold greater levels of radioactivity in the blood than a reference level at 48 h after administration of the radioimmunoconjugate. In some embodiments, a subject who has been treated with a method disclosed herein exhibits at least 5-fold, at least 10-fold, at least 20-fold, at least 30-fold greater levels of radioactivity in the blood than a reference level at 96 h after administration of the radioimmunoconjugate.

    [0246] In some embodiments, the subject exhibits a % ID/g of greater than 10%, greater than 15%, greater than 20%, or greater than 25% in the blood at 24 h after administration of the radioimmunoconjugate. In some embodiments, the subject exhibits a % ID/g of greater than 10%, greater than 12.5%, greater than 15%, or greater than 17.5% in the blood at 48 h after administration of the radioimmunoconjugate. In some embodiments, the subject exhibits a % ID/g of greater than 10%, greater than 12.5%, or greater than 15% in the blood at 96 h after administration of the radioimmunoconjugate.

    [0247] In some embodiments, a subject who has been treated with a method disclosed herein exhibits reduced excretion of the radioimmunoconjugate in urine relative to a reference level, e.g., as evidenced by a lower % ID/g in the urine.

    [0248] In some embodiments, a subject who has been treated with a method disclosed herein exhibits less than 75%, less than 70%, less than 65%, less than 60%, less than 55%, less than 50%, less than 45%, less than 40%, less than 35%, less than 30%, or less than 25% of levels of radioactivity in the urine as compared to a reference level at 24 h after administration of the radioimmunoconjugate. In some embodiments, a subject who has been treated with a method disclosed herein exhibits less than 75%, less than 70%, less than 65%, less than 60%, less than 55%, less than 50%, less than 45%, less than 40%, less than 35%, less than 30%, or less than 25% of levels of radioactivity in the urine as compared to a reference level at 48 h after administration of the radioimmunoconjugate. In some embodiments, a subject who has been treated with a method disclosed herein exhibits less than 75%, less than 70%, less than 65%, less than 60%, less than 55%, less than 50%, less than 45%, less than 40%, less than 35%, less than 30%, or less than 25% of levels of radioactivity in the urine as compared to a reference level at 96 h after administration of the radioimmunoconjugate.

    [0249] In some embodiments, the subject exhibits a % ID/g of less than 10%, less than 8%, or less than 6% in urine at 24 h after administration of the radioimmunoconjugate. In some embodiments, the subject exhibits a % ID/g of less than 10% in urine at 96 h after administration of the radioimmunoconjugate.

    [0250] In some embodiments, a subject who has been treated with a method disclosed herein exhibits reduced toxicity as compared to a reference level. In some embodiments, toxicity is assessed based on one or more of clinical observations (e.g., severity and/or frequency of side effects), food consumption, body weight, ophthalmologic examination, hematology, clinical chemistry, urinalysis, and examination of biopsy tissue.

    [0251] In some embodiments, use of a method as disclosed herein allows a subject to tolerate a higher radioactive dose than a method in which the subject is not co-administered a cold FGFR3-targeting molecule.

    Subjects

    [0252] In some disclosed methods, a therapy (e.g., comprising a therapeutic agent) is administered to a subject. In some embodiments, the subject is a mammal, e.g., a human.

    [0253] In some embodiments, the subject has cancer or is at risk of developing cancer. For example, the subject may have been diagnosed with cancer. For example, the cancer may be a primary cancer or a metastatic cancer. Subjects may have any stage of cancer, e.g., stage I, stage II, stage III, or stage IV with or without lymph node involvement and with or without metastases. Provided radioimmunoconjugates and compositions may prevent or reduce further growth of the cancer and/or otherwise ameliorate the cancer (e.g., prevent or reduce metastases). In some embodiments, the subject does not have cancer but has been determined to be at risk of developing cancer, e.g., because of the presence of one or more risk factors such as environmental exposure, presence of one or more genetic mutations or variants, family history, etc. In some embodiments, the subject has not been diagnosed with cancer.

    [0254] In some embodiments, the cancer is a solid tumor cancer, e.g., a sarcoma or carcinoma.

    [0255] In some embodiments, the solid tumor cancer is adrenocortical carcinoma, bladder cancer (e.g., urothelial carcinoma), breast cancer, cervical cancer, colorectal cancer, endometrial adenocarcinoma, Ewing's sarcoma, gallbladder carcinoma, glioma (e.g., glioblastoma mutiforme), head and neck cancer, liver cancer, lung cancer (e.g., small cell lung cancer or non-small cell lung cancer, or adenocarcinoma of the lung), neuroblastoma, neuroendocrine cancer, pancreatic cancer (e.g., pancreatic exocrine carcinoma), prostate cancer, renal cell carcinoma, salivary adenoid cystic cancer, or spermatocytic seminoma.

    [0256] In some embodiments, the cancer is selected from the group consisting of bladder cancer, breast cancer, head and neck cancer, liver cancer, and lung cancer. In some embodiments, the cancer is bladder cancer. In some embodiments, the cancer is head and neck cancer. In some embodiments, the cancer is liver cancer.

    [0257] In some embodiments, the cancer is a non-solid tumor cancer, e.g., a liquid cancer or hematologic cancer. In some embodiments, the cancer is a myeloma, e.g., multiple myeloma. In some embodiments, the cancer is a leukemia, e.g., acute myeloid leukemia. In some embodiments, the cancer is a lymphoma.

    Administration and Dosage

    [0258] Radioimmunoconjugates and pharmaceutical compositions thereof disclosed herein may be administered by any of a variety of routes of administration, including systemic and local routes of administration.

    [0259] Systemic routes of administration include parenteral routes and enteral routes. In some embodiments, radioimmunoconjugates or pharmaceutical compositions thereof are administered by a parenteral route, for example, intravenously, intraarterially, intraperitoneally, subcutaneously, or intradermally. In some embodiments, radioimmunoconjugates or pharmaceutical compositions thereof are administered intravenously. In some embodiments, radioimmunoconjugates or pharmaceutical compositions thereof are administered by an enteral route of administration, for example, trans-gastrointestinal, or orally.

    [0260] Local routes of administration include, but are not limited to, peritumoral injections and intratumoral injections.

    [0261] Pharmaceutical compositions can be administered for radiation treatment planning, diagnostic, and/or therapeutic treatments. When administered for radiation treatment planning or diagnostic purposes, the radioimmunoconjugate may be administered to a subject in a diagnostically effective dose and/or an amount effective to determine the therapeutically effective dose. In therapeutic applications, pharmaceutical compositions may be administered to a subject (e.g., a human) already suffering from a condition (e.g., cancer) in an amount sufficient to cure or at least partially arrest the symptoms of the disorder and its complications. An amount adequate to accomplish this purpose is defined as a therapeutically effective amount, an amount of a compound sufficient to substantially improve at least one symptom associated with the disease or a medical condition. For example, in the treatment of cancer, an agent or compound that decreases, prevents, delays, suppresses, or arrests any symptom of the disease or condition would be therapeutically effective. A therapeutically effective amount of an agent or compound is not required to cure a disease or condition but may, for example, provide a treatment for a disease or condition such that the onset of the disease or condition is delayed, hindered, or prevented, such that the disease or condition symptoms are ameliorated, or such that the term of the disease or condition is changed. For example, the disease or condition may become less severe and/or recovery is accelerated in an individual. In some embodiments, a subject is administered a first dose of a radioimmunoconjugate or composition in an amount effective for radiation treatment planning, then administered a second dose or set of doses of the radioimmunoconjugate or composition in a therapeutically effective amount.

    [0262] Effective amounts may depend on the severity of the disease or condition and other characteristics of the subject (e.g., weight). Therapeutically effective amounts of disclosed radioimmunoconjugates and compositions for subjects (e.g., mammals such as humans) can be determined by the ordinarily-skilled artisan with consideration of individual differences (e.g., differences in age, weight, and the condition of the subject.

    [0263] In some embodiments, disclosed radioimmunoconjugates exhibit an enhanced ability to target cancer cells. In some embodiments, effective amount of disclosed radioimmunoconjugates are lower than (e.g., less than or equal to about 90%, 75%, 50%, 40%, 30%, 20%, 15%, 12%, 10%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, or 0.1% of) the equivalent dose for a therapeutic effect of the unconjugated, and/or non-radiolabeled targeting moiety.

    [0264] Single or multiple administrations of pharmaceutical compositions disclosed herein including an effective amount can be carried out with dose levels and pattern being selected by the treating physician. Dose and administration schedule can be determined and adjusted based on the severity of the disease or condition in the subject, which may be monitored throughout the course of treatment according to the methods commonly practiced by clinicians or those described herein. With respect to radioactive doses, by way of non-limiting example, in some embodiments, subjects (e.g., human subjects) may be administered doses of at least about 37 kBq/kg, at least about 75 kBq/kg, and at least about 150 kBq/kg. In some embodiments, subjects (e.g., human subjects) may be administered a total dose of about 37 kBq/kg, about 75 kBq/kg, and about 150 kBq/kg, respectively.

    Radioimmunoconjugates

    [0265] Radioimmunoconjugates used in accordance with methods disclosed herein generally have the structure of Formula I-a:


    A-L-B Formula I-a [0266] wherein A is a chelating moiety or metal complex thereof, [0267] wherein B is a FGFR3 targeting moiety, and [0268] wherein L is a linker.

    [0269] In some embodiments, the radioimmunoconjugate has or comprises the structure shown in Formula II:

    ##STR00005##

    wherein B is the FGFR3 targeting moiety.

    [0270] In some embodiments, A-L is a metal complex of a moiety selected from the group consisting of

    ##STR00006##

    [0271] In some embodiments, as further described herein, the radioimmunoconjugate comprises a chelating moiety or metal complex thereof, which metal complex may comprise a radionuclide. In some such radiommunoconjugates, the average ratio or median ratio of the chelating moiety to the FGFR3 targeting moiety is eight or less, seven or less, six or less, five or less, four or less, three or less, two or less, or about one. In some radioimmunoconjugates, the average ratio or median ratio of the chelating moiety to the FGFR3 targeting moiety is about one.

    [0272] In some embodiments, after the radioimmunoconjugate is administered to a mammal, the proportion of radiation (of the total amount of radiation that is administered) that is excreted by the intestinal route, the renal route, or both is greater than the proportion of radiation excreted by a comparable mammal that has been administered a reference radioimmunoconjugate. By reference immunoconjugate it is meant a known radioimmunoconjugate that differs from a radioimmunoconjugate described herein at least by (1) having a different linker; (2) having a targeting moiety of a different size and/or (3) lacking a targeting moiety. In some embodiments, the reference radioimmunoconjugate is selected from the group consisting of [.sup.90Y]-ibritumomab tiuxetan (Zevalin (.sup.90Y)) and [.sup.111In]-ibritumomab tiuxetan (Zevalin (.sup.111In)).

    [0273] In some embodiments, the proportion of radiation excreted by a given route or set of routes) is at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% greater than the proportion of radiation excreted by the same route(s) by a comparable mammal that has been administered a reference radioimmunoconjugate. In some embodiments, the proportion of radiation excreted is at least 1.5-fold, at least 2-fold, at least 2.5-fold, at least 3-fold, at least 3.5 fold, at least 4-fold, at least 4.5 fold, at least 5 fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9-fold, or at least 10-fold greater than proportion of radiation excreted by a comparable mammal that has been administered a reference radioimmunoconjugate. The extent of excretion can be measured by methods known in the art, e.g., by measuring radioactivity in urine and/or feces and/or by measuring total body radioactivity over a period time. See also, e.g., International Patent Publication WO 2018/024869.

    [0274] In some embodiments, the extent of excretion is measured at a time period of at least or about 12 hours after administration, at least or about 24 hours after administration, at least or about 2 days after administration, at least or about 3 days after administration, at least or about 4 days after administration, at least or about 5 days after administration, at least or about 6 days after administration, or at least or about 7 days, after administration.

    [0275] In some embodiments, after a radioimmunoconjugate has been administered to a mammal, the radioimmunoconjugate exhibits decreased off-target binding effects (e.g., toxicities) as compared to a reference conjugate (e.g., a reference immunoconjugate such as a reference radioimmunoconjugate). In some embodiments, this decreased off-target binding effect is a feature of a radioimmunoconjugate that also exhibits a greater excretion rate as described herein.

    Targeting Moieties

    [0276] Targeting moieties include any molecule or any part of a molecule that is capable of binding to a given target, e.g., FGFR3. In some embodiments, the targeting moiety comprises a protein or polypeptide. In some embodiments, the targeting moiety is selected from the group consisting of antibodies or antigen binding fragments thereof, nanobodies, affibodies, and consensus sequences from Fibronectin type III domains (e.g., Centyrins or Adnectins). In some embodiments, a moiety is both a targeting and a therapeutic moiety, i.e., the moiety is capable of binding to a given target and also confers a therapeutic benefit. In some embodiments, the targeting moiety comprises a small molecule.

    [0277] In some embodiments, the targeting moiety has a molecular weight of at least 50 kDa, at least 75 kDa, at least 100 kDa, at least 125 kDa, at least 150 kDa, at least 175 kDa, at least 200 kDa, at least 225 kDa, at least 250 kDa, at least 275 kDa, or at least 300 kDa.

    [0278] Typically, the targeting moiety is capable of binding to FGFR3, e.g., wild type and/or mutant FGFR3. In some embodiments, the targeting moiety is capable of binding to human FGFR3, e.g., wild type and/or mutant human FGFR3.

    [0279] In some embodiments, the targeting moiety is capable of binding specifically to FGFR3 (e.g., is capable of binding to FGFR3 while exhibiting comparatively little or no binding to other kinases such as other FGFR proteins).

    [0280] In some embodiments, the targeting moiety is capable of binding to an extracellular region of FGFR3, e.g., the IgD1 region, the IgD2 region, the IgD3 region, the linker region between IgD1 and IgD2, the linker region between IgD2 and IgD3, or the extracellular juxtamembrane domain. In some embodiments, the targeting moiety is capable of binding to the linker region between IgD2 and IgD3. In some embodiments, the targeting moiety is capable of binding to the extracellular juxtamembrane domain.

    [0281] In some embodiments, the targeting moiety is capable of binding to the IIIb isoform of FGFR3. In some embodiments, the targeting moiety is capable of binding to the IIIc isoform of FGFR3. In some embodiments, the targeting moiety is capable of binding to both the IIIb and IIIc isoforms of FGFR3.

    [0282] In some embodiments, the targeting moiety is capable of binding to a mutant FGFR3, e.g., a mutant human FGFR3. Some FGFR3 mutations give rise to an unpaired cysteine, which may lead to ligand-independent receptor dimerization and/or constitutive activation. In some embodiments, the mutant FGFR3 is an activated mutant and/or is associated with cancer.

    [0283] In some embodiments, the targeting moiety is capable of binding to wild type FGFR3 and at least one mutant FGFR3 associated with cancer.

    [0284] In some embodiments, the mutant FGFR3 comprises a mutation in an extracellular region of FGFR3. For example, in some embodiments, the mutant FGFR3 comprises a mutation in the linker region between IgD2 and IgD3 and/or in the extracellular juxtamembrane region of FGFR3.

    [0285] In some embodiments, the mutant FGFR3 comprises a mutation in an intracellular region of FGFR3, e.g., a kinase domain, of FGFR3.

    [0286] In some embodiments, the mutant FGFR3 comprises a point mutation. Non-limiting examples of FGFR3 point mutants associated with cancer include FGFR3.sup.Y375C, FGFR3.sup.R248C, FGFR3.sup.S249C, FGFR3.sup.G372C, FGFR3.sup.K652E, FGFR3.sup.K652Q, FGFR3.sup.K652M, and combinations thereof.

    [0287] In some embodiments, the mutant FGFR3 is ligand-dependent (e.g., FGFR3.sup.G372C or FGFR3.sup.Y375C). In some embodiments, the mutant FGFR3 is constitutively active (e.g., FGFR3.sup.R248C or FGFR3.sup.S249C). In some embodiments, the mutant FGFR3 is both ligand-dependent and constitutively active (e.g., FGFR3.sup.K652E).

    [0288] In some embodiments, the mutant FGFR3 comprises an FGFR3 fusion, e.g., a constitutively activated and/or oncogenic fusion, such as a fusion that arises from a translocation. For example, FGFR3-TACC3, FGFR3-CAMK2A, FGFR3-JAKMOP1, FGFR3-TNIP2, FGFR3-WHSC1, and FGFR3-BAIAP2L 1 (also known as FGFR3-IRTKS) fusions have been associated with cancer.

    [0289] In some embodiments, the mutant FGFR3 is an amplifying mutation, e.g., comprising increased copy numbers and/or resulting in higher expression relative to a wild type FGFR3.

    [0290] In some embodiments, the targeting moiety inhibits FGFR3. By inhibits, it is meant that the targeting moiety at least partially inhibits one or more functions of FGFR3 (e.g., human FGFR3). In some embodiments, the targeting moiety at least partially inhibits one or more functions of wild type FGFR3, e.g., wild type human FGFR3. In some embodiments, the targeting moiety at least partially inhibits one or more functions of a mutant FGFR3, e.g., mutant human FGFR3.

    [0291] In some embodiments, targeting moiety blocks ligand binding to FGFR3 and/or receptor dimerization of FGFR3. For example, in some embodiments, a targeting moiety that blocks ligand binding competes with FGF ligands for interaction with the IIIb and/or the IIIc isoforms of FGFR3.

    [0292] In some embodiments, the targeting moiety impairs signaling downstream of the FGFR3 receptor, e.g., results in decreased phosphorylation and/or protein or transcript levels of one or more downstream mediators of FGFR3 such as FRS2?, AKT, and p44/42 MAPK.

    Antibodies and Antigen-Binding Moieties

    [0293] Antibodies typically comprise two identical light polypeptide chains and two identical heavy polypeptide chains linked together by disulfide bonds. The first domain located at the amino terminus of each chain is variable in amino acid sequence, providing the antibody-binding specificities of each individual antibody. These are known as variable heavy (VH) and variable light (VL) regions. The other domains of each chain are relatively invariant in amino acid sequence and are known as constant heavy (CH) and constant light (CL) regions. Light chains typically comprise one variable region (VL) and one constant region (CL). An IgG heavy chain includes a variable region (VH), a first constant region (CH1), a hinge region, a second constant region (CH2), and a third constant region (CH3). In IgE and IgM antibodies, the heavy chain includes an additional constant region (CH4).

    [0294] Antibodies suitable for use with the present disclosure can include, for example, monoclonal antibodies, polyclonal antibodies, multispecific antibodies, human antibodies, humanized antibodies, camelid antibodies, chimeric antibodies, single-chain Fvs (scFv), disulfide-linked Fvs (sdFv), and anti-idiotypic (anti-Id) antibodies, and antigen-binding fragments of any of the above. In some embodiments, the antibody or antigen-binding fragment thereof is humanized. In some embodiments, the antibody or antigen-binding fragment thereof is chimeric. Antibodies can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2) or subclass.

    [0295] The term antigen binding fragment of an antibody, as used herein, refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen. Examples of binding fragments encompassed within the term antigen binding fragment of an antibody include a Fab fragment, a F(ab)2 fragment, a Fd fragment, a Fv fragment, a scFv fragment, a dAb fragment (Ward et al., (1989) Nature 341:544-546), and an isolated complementarity determining region (CDR). In some embodiments, an antigen binding fragment comprises a heavy chain variable region and a light chain variable region. These antibody fragments can be obtained using conventional techniques known to those with skill in the art, and the fragments can be screened for utility in the same manner as are intact antibodies.

    [0296] Antibodies or antigen-binding fragments described herein can be produced by any method known in the art for the synthesis of antibodies (See, e.g., Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988); Brinkman et al., 1995, J. Immunol. Methods 182:41-50; WO 92/22324; WO 98/46645). Chimeric antibodies can be produced using the methods described in, e.g., Morrison, 1985, Science 229:1202, and humanized antibodies by methods described in, e.g., U.S. Pat. No. 6,180,370.

    [0297] Additional antibodies described herein are bispecific antibodies and multivalent antibodies, as described in, e.g., Segal et al., J. Immunol. Methods 248:1-6 (2001); and Tutt et al., J. Immunol. 147: 60 (1991), or any of the molecules described herein.

    [0298] Avimer relates to a multimeric binding protein or peptide engineered using, for example, in vitro exon shuffling and phage display. Multiple binding domains are linked, resulting in greater affinity and specificity compared to single epitope immunoglobin domains.

    [0299] Nanobodies are antibody fragments consisting of a single monomeric variable antibody domain. Nanobodies may also be referred to as single-domain antibodies. Like antibodies, nanobodies are capable of binding selectively to a specific antigen. Nanobodies may be heavy-chain variable domains or light chain domains. Nanobodies may occur naturally or be the product of biological engineering. Nanobodies may be biologically engineered by site-directed mutagenesis or mutagenic screening (e.g., phage display, yeast display, bacterial display, mRNA display, ribosome display). Affibodies are polypeptides or proteins engineered to bind to a specific antigen. As such, affibodies may be considered to mimic certain functions of antibodies.

    [0300] Affibodies may be engineered variants of the B-domain in the immunoglobulin-binding region of staphylococcal protein A. Affibodies may be engineered variants of the Z-domain, a B-domain that has lower affinity for the Fab region. Affibodies may be biologically engineered by site-directed mutagenesis or mutagenic screening (e.g., phage display, yeast display, bacterial display, mRNA display, ribosome display).

    [0301] Affibody molecules showing specific binding to a variety of different proteins (e.g. insulin, fibrinogen, transferrin, tumor necrosis factor-a, IL-8, gp120, CD28, human serum albumin, IgA, IgE, IgM, HER2 and EGFR) have been generated, demonstrating affinities (Kd) in the ?M to pM range. Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific. See for example Hudson et al., (2003). Single-chain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all, or a portion of the light chain variable domain of an antibody. Antibody fragments can be made by various techniques including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant hosts (e.g., E. coli or phage) as described herein.

    [0302] In certain embodiments, the antibody or antigen-binding fragment thereof is a multispecific, e.g. bispecific. Multispecific antibodies (or antigen-binding fragments thereof) include monoclonal antibodies (or antigen-binding fragments thereof) that have binding specificities for at least two different sites.

    [0303] In certain embodiments, amino acid sequence variants of antibodies or antigen-binding fragments thereof are contemplated; e.g., variants that are capable of binding to human FGFR3 and/or a mutant FGFR3 (such as a mutant FGFR3 associated with cancer). For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody or antigen-binding fragment thereof. Amino acid sequence variants of an antibody or antigen-binding fragment thereof may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody or antigen-binding fragment thereof, or by peptide synthesis. Such modifications include, for example, deletions from and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody or antigen-binding fragment thereof. Any combination of deletion, insertion and substitution can be made to arrive at the final construct, provided that the final construct possesses desired characteristics, e.g. antigen binding.

    [0304] In some embodiments, the antibody or antigen binding fragment thereof is an inhibitory antibody (also called antagonistic antibody) or antigen-binding fragment thereof, e.g., the antibody or antigen binding fragment thereof at least partially inhibits one or more functions of the target molecule (e.g., FGFR3) as explained further herein.

    [0305] Non-limiting examples of inhibitory antibodies include humanized monoclonal antibodies such as MFGR1877S (CAS No. 1312305-12-6; Genentech) (a human monoclonal antibody also known as vofatamab, and whose lyophilized form is also known as B-701 or R3Mab); PRO-001 (Prochon); PRO-007 (Fibron); IMC-D11 (Imclone); and AV-370 (Aveo Pharmaceuticals). (See, e.g., U.S. Pat. Nos. 8,410,250; 10,208,120; and International Patent Publication Nos. WO2002102972A2, WO2002102973A2, WO2007144893A2, WO2010002862A2, and WO2010048026A2.)

    [0306] In some embodiments, the antibody or antigen binding fragment thereof is an agonistic antibody (also known as stimulatory antibody).

    [0307] In some embodiments, the antibody or antigen biding fragment thereof is neither agonistic or antagonistic, or has not been characterized as either agonistic or antagonistic.

    [0308] Additional known FGFR3 antibodies include, for example, mouse monoclonal antibodies such as, for example, 1G6, 6G1, and 15B2 from Genentech (See, e.g., U.S. Pat. No. 8,410,250), B9 (Sc-13121) (Santa Cruz Biotechnology), MAB766 (clone 136334) (R&D systems), MAB7661 (clone 136318) (R&D systems), and OTI1B10 (OriGene); rabbit polyclonal antibodies such as, for example, ab10651 (Abcam); and rabbit monoclonal antibodies such as C51F2 (catalog number 4574) (Cell Signaling Technology).

    [0309] In certain embodiments of the present disclosure, the antibody or antigen-binding fragment thereof comprises specific heavy chain complementarity determining regions CDR-H1, CDR-H2 and/or CDR-H3 as described herein. In some embodiments, the complementarity determining regions (CDRs) of the antibody or antigen-binding fragment thereof are flanked by framework regions. A heavy or light chain of an antibody or antigen-binding fragment thereof containing three CDRs typically contains four framework regions.

    [0310] In some embodiments, the heavy chain variable region of the FGFR3 antibody or antibody-binding fragment thereof comprises one, two, or three complementarity determining regions (CDRs) CDR-H1, CDR-H2, and/or CDR-H3, with amino acid sequences shown below, or CDR region(s) having an amino acid sequence(s) differing in 1 or 2 amino acids therefrom:

    TABLE-US-00001 CDR-H1: (SEQIDNO:1) TSTGIS CDR-H2: (SEQIDNO:2) GRIYPTSGSTNYADSV CDR-H3: (SEQIDNO:3) TYGIYDLYVDYTEYVMDY or (SEQIDNO:4) ARTYGIYDLYVDYTEYVMDY

    [0311] In some embodiments, the light chain variable region of the FGFR3 antibody or antibody-binding fragment thereof comprises one, two, or three complementarity determining regions (CDRs) CDR-L1, CDR-L2, and/or CDR-L3. with amino acid sequences as shown below, or CDR region(s) having an amino acid sequence(s) differing in 1 or 2 amino acids therefrom:

    TABLE-US-00002 CDR-L1: (SEQIDNO:5) RASQDVDTSLA CDR-L2: (SEQIDNO:6) SASFLYS CDR-L3: (SEQIDNO:7) QQSTGHPQT

    [0312] In some embodiments, the antibody or antigen-binding fragment thereof comprises: [0313] (i) a heavy chain comprising: [0314] a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence as shown in SEQ ID NO: 1 or an amino acid sequence differing in 1 or 2 amino acids therefrom, [0315] a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence as shown in SEQ ID NO: 2 or an amino acid sequence differing in 1 or 2 amino acids therefrom, and [0316] a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence as shown in SEQ ID NO: 3 or 4 or an amino acid sequence differing in 1 or 2 amino acids therefrom, and [0317] (ii) a light chain comprising: [0318] a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence as shown in SEQ ID NO: 5 or an amino acid sequence differing in 1 or 2 amino acids therefrom, [0319] a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence as shown in SEQ ID NO: 6 or an amino acid sequence differing in 1 or 2 amino acids therefrom, and [0320] a light chain complementarity determining region 3 (CDR-L3) having the amino acid sequence as shown in SEQ ID NO: 7 or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0321] or a monoclonal antibody recognizing the same epitope on FGFR3.

    [0322] In some embodiments, the antibody or antigen-binding fragment thereof has CDR sequences having amino acid sequences of SEQ ID NOs: 1, 2, 3, 5, 6, and 7 without any variation. For example, in some embodiments, the antibody or antigen-binding fragment thereof comprises heavy chain complementary determining regions CDR-H1, CDR-H2, and CDR-H3 having the amino acid sequences of SEQ ID NOs: 1, 2, and 3, and the chain complementarity determining regions CDR-L1, CDR-L2, and CDR-L3 having the amino acid sequences of SEQ ID NOs: 5, 6, and 7.

    [0323] In some embodiments, the antibody or antigen-binding fragment thereof has CDR sequences having amino acid sequences of SEQ ID NOs: 1, 2, 4, 5, 6, and 7 without any variation. For example, in some embodiments, the antibody or antigen-binding fragment thereof comprises heavy chain complementary determining regions CDR-H1, CDR-H2, and CDR-H3 having the amino acid sequences of SEQ ID NOs: 1, 2, and 4, and the chain complementarity determining regions CDR-L1, CDR-L2, and CDR-L3 having the amino acid sequences of SEQ ID NOs: 5, 6, and 7.

    [0324] In some embodiments, the heavy chain variable region of the FGFR3 antibody or antigen-binding fragment thereof comprises an amino acid sequence of SEQ ID NO: 9 or an amino acid sequence differing in 1, 2, 3, or 4 amino acids therefrom, or an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 97%, or at least 99% identical to SEQ ID NO: 8:

    TABLE-US-00003 (SEQIDNO:8) EVQLVESGGGLVQPGGSLRLSCAASGFTFTSTGISWVRQ APGKGLEWVGRIYPTSGSTNYADSVKGRFTISADTSKNTAY LQMNSLRAEDTAVYYCARTYGIYDLYVDYTEYVMDYWGQG TLVTVSSASTKGPSVEPLAPSSKSTSGGTAALGCLVKDYF PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS SSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK

    [0325] In some embodiments, the light chain variable region of the FGFR3 antibody or antigen-binding fragment thereof comprises an amino acid sequence of SEQ ID NO: 9 or an amino acid sequence differing in 1, 2, 3, or 4 amino acids therefrom, or an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 97%, or at least 99% identical to SEQ ID NO: 9:

    TABLE-US-00004 (SEQIDNO:9) DIQMTQSPSSLSASVGDRVTITCRASQDVDTSLAWYKQKP GKAPKLLIYSASFLYSGVPSRFSGSGSGTDFTLTISSLQP EDFATYYCQQSTGHPQTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG LSSPVTKSENRGEC

    [0326] In some embodiments, the FGFR3 targeting moiety is MFGR1877S (vofatamab) or an antigen-binding fragment thereof.

    [0327] In some embodiments, the FGFR3 antibody or antigen-binding fragment thereof is a humanized antibody or antigen-binding fragment thereof. In certain embodiments, the antibody or antigen-binding fragment thereof has a dissociation constant (Kd) of ?1 ?M, ?100 nM, ?10 nM, ?1 nM, ?0.1 nM, ?0.01 nM, or ?0.001 nM. In some embodiments, the antibody or antigen-binding fragment thereof has a dissociation constant (Kd) of between 1 nM and 10 nM (inclusive of endpoints) or between 0.1 nM and 1 nM (inclusive of endpoints).

    [0328] In one embodiment, Kd is measured by a radio-labeled antigen binding assay (Radioimmunoassay, RIA) performed with the Fab version of an antibody or antigen-binding fragment thereof of interest and its antigen.

    [0329] According to another embodiment, Kd is measured using surface plasmon resonance assays with immobilized antigen. In some embodiments, the antibodies or antigen-binding fragments thereof are human monoclonal antibodies directed against an epitope of human FGFR3 as described herein.

    [0330] The antibody or antigen-binding fragment thereof may be any antibody or antigen-binding fragment thereof of natural and/or synthetic origin, e.g. an antibody of mammalian origin. In some embodiments, the constant domain, if present, is a human constant domain. In some embodiments, the variable domain is a mammalian variable domain, e.g., a humanized or a human variable domain.

    [0331] In some embodiments, antibodies used in accordance with this disclosure are monoclonal antibodies. In some embodiments, antibodies are recombinant murine antibodies, chimeric, humanized or fully human antibodies, multispecific antibodies(e.g., bispecific antibodies), or antigen-binding fragments thereof.

    [0332] In some embodiments, are further coupled to other moieties for, e.g., drug targeting and imaging applications.

    [0333] In some embodiments, e.g., for diagnostic purposes, the antibody or antigen-binding fragment thereof is labelled, i.e. coupled to a labelling group. Non-limiting examples of suitable labels include radioactive labels, fluorescent labels, suitable dye groups, enzyme labels, chromogenes, chemiluminescent groups, biotinyl groups, predetermined polypeptide epitopes recognized by a secondary reporter etc. In some embodiments, one or more labels are covalently bound to the antibody or antigen-binding fragment thereof.

    [0334] Those labelled antibodies or antigen-binding fragments thereof (also referred to as antibody conjugates) may in particular be used in immunohistochemistry assays or for molecular imaging in vivo.

    [0335] In some embodiments, e.g., for therapeutic purposes, the antibody or antigen-binding fragment thereof is further conjugated with an effector group, in particular, a therapeutic effector group such as a cytotoxic agent or a radioactive group agent.

    Polypeptides

    [0336] Polypeptides include, for example, any of a variety of hematologic agents (including, for instance, erythropoietin, blood-dotting factors, etc.), interferons, colony stimulating factors, antibodies, enzymes, and hormones. The identity of a particular polypeptide is not intended to limit the present disclosure, and any polypeptide of interest can be a polypeptide in the present methods.

    [0337] A reference polypeptide described herein can include a target-binding domain that is capable of binding to a target of interest (e.g., is capable of binding to an antigen, e.g., FGFR3). For example, a polypeptide, such as an antibody, can bind to a transmembrane polypeptide (e.g., receptor) or ligand (e.g., a growth factor).

    Modified Polypeptides

    [0338] Polypeptides suitable for use with compositions and methods of the present disclosure may have a modified amino acid sequence. Modified polypeptides may be substantially identical to the corresponding reference polypeptide (e.g., the amino acid sequence of the modified polypeptide may have at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the amino acid sequence of the reference polypeptide). In certain embodiments, the modification does not destroy significantly a desired biological activity (e.g., binding to FGFR3). The modification may reduce (e.g., by at least 5%, 10%, 20%, 25%, 35%, 50%, 60%, 70%, 75%, 80%, 90%, or 95%), may have no effect, or may increase (e.g., by at least 5%, 10%, 25%, 50%, 100%, 200%, 500%, or 1000%) the biological activity of the original polypeptide. The modified polypeptide may have or may optimize a characteristic of a polypeptide, such as in vivo stability, bioavailability, toxicity, immunological activity, immunological identity, and conjugation properties.

    [0339] Modifications include those by natural processes, such as post-translational processing, or by chemical modification techniques known in the art. Modifications may occur anywhere in a polypeptide including the polypeptide backbone, the amino acid side chains and the amino- or carboxy-terminus. The same type of modification may be present in the same or varying degrees at several sites in a given polypeptide, and a polypeptide may contain more than one type of modification. Polypeptides may be branched as a result of ubiquitination, and they may be cyclic, with or without branching. Cyclic, branched, and branched cyclic polypeptides may result from post-translational natural processes or may be made synthetically. Other modifications include pegylation, acetylation, acylation, addition of acetomidomethyl (Acm) group, ADP-ribosylation, alkylation, amidation, biotinylation, carbamoylation, carboxyethylation, esterification, covalent attachment to flavin, covalent attachment to a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of drug, covalent attachment of a marker (e.g., fluorescent or radioactive), covalent attachment of a lipid or lipid derivative, covalent attachment of phosphatidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent crosslinks, formation of cystine, formation of pyroglutamate, formylation, gamma-carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristoylation, oxidation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylation and ubiquitination.

    [0340] A modified polypeptide can also include an amino acid insertion, deletion, or substitution, either conservative or non-conservative (e.g., D-amino acids, desamino acids) in the polypeptide sequence (e.g., where such changes do not substantially alter the biological activity of the polypeptide). In particular, the addition of one or more cysteine residues to the amino or carboxy-terminus of a polypeptide herein can facilitate conjugation of these polypeptides by, e.g., disulfide bonding. For example, a polypeptide can be modified to include a single cysteine residue at the amino-terminus or a single cysteine residue at the carboxy-terminus. Amino acid substitutions can be conservative (i.e., wherein a residue is replaced by another of the same general type or group) or non-conservative (i.e., wherein a residue is replaced by an amino acid of another type). In addition, a naturally occurring amino acid can be substituted for a non-naturally occurring amino acid (i.e., non-naturally occurring conservative amino acid substitution or a non-naturally occurring non-conservative amino acid substitution).

    [0341] Polypeptides made synthetically can include substitutions of amino acids not naturally encoded by DNA (e.g., non-naturally occurring or unnatural amino acid). Examples of non-naturally occurring amino acids include D-amino acids, N-protected amino acids, an amino acid having an acetylaminomethyl group attached to a sulfur atom of a cysteine, a pegylated amino acid, the omega amino acids of the formula NH.sub.2(CH.sub.2).sub.nCOOH wherein n is 2-6, neutral nonpolar amino acids, such as sarcosine, t-butyl alanine, t-butyl glycine, N-methyl isoleucine, and norleucine. Phenylglycine may substitute for Trp, Tyr, or Phe; citrulline and methionine sulfoxide are neutral nonpolar, cysteic acid is acidic, and ornithine is basic. Proline may be substituted with hydroxyproline and retain the conformation conferring properties.

    [0342] Analogs may be generated by substitutional mutagenesis and retain the biological activity of the original polypeptide. Examples of substitutions identified as conservative substitutions are shown in Table 1. If such substitutions result in a change not desired, then other type of substitutions, denominated exemplary substitutions in Table 1, or as further described herein in reference to amino acid classes, are introduced and the products screened.

    TABLE-US-00005 TABLE 1 Amino acid substitutions Conservative Original residue Exemplary substitution substitution Ala (A) Val, Leu, Ile Val Arg (R) Lys, Gln, Asn Lys Asn (N) Gln, His, Lys, Arg Gln Asp (D) Glu Glu Cys (C) Ser Ser Gln (Q) Asn Asn Glu (E) Asp Asp Gly (G) Pro Pro His (H) Asn, Gln, Lys, Arg Arg Ile (I) Leu, Val, Met, Ala, Phe, norleucine Leu Leu (L) Norleucine, Ile, Val, Met, Ala, Phe Ile Lys (K) Arg, Gln, Asn Arg Met (M) Leu, Phe, Ile Leu Phe (F) Leu, Val, Ile, Ala Leu Pro (P) Gly Gly Ser (S) Thr Thr Thr (T) Ser Ser Trp (W) Tyr Tyr Tyr (Y) Trp, Phe, Thr, Ser Phe Val (V) Ile, Leu, Met, Phe, Ala, norleucine Leu

    [0343] Substantial modifications in function or immunological identity are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, and/or (c) the bulk of the side chain.

    Chelating Moiety or Metal Complex Thereof

    Chelating Moieties

    [0344] Examples of suitable chelating moieties include, but are not limited to, DOTA (1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid), DOTMA (1R,4R,7R,10R)-?,?,?, ?-tetramethyl-1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid, DOTAM (1,4,7,10-tetrakis(carbamoylmethyl)-1,4,7,10-tetraazacyclododecane), DOTPA (1,4,7,10-tetraazacyclododecane-1,4,7,10-tetra propionic acid), DO3AM-acetic acid (2-(4,7,10-tris(2-amino-2-oxoethyl)-1,4,7,10-tetraazacyclododecan-1-yl)acetic acid), DOTA-GA anhydride (2,2,2-(10-(2,6-dioxotetrahydro-2H-pyran-3-yl)-1,4,7,10-tetraazacyclododecane-1,4,7-triyl)triacetic acid, DOTP (1,4,7,10-tetraazacyclododecane-1,4,7,10-tetra(methylene phosphonic acid)), DOTMP (1,4,6,10-tetraazacyclodecane-1,4,7,10-tetramethylene phosphonic acid, DOTA-4AMP (1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakis(acetamido-methylenephophonic acid) CB-TE2A (1,4,8,11-tetraazabicyclo[6.6.2]hexadecane-4,11-diacetic acid), NOTA (1,4,7-triazacyclononane-1,4,7-triacetic acid), NOTP (1,4,7-triazacyclononane-1,4,7-tri(methylene phosphonic acid), TETPA (1,4,8,11-tetraazacyclotetradecane-1,4,8,11-tetrapropionic acid), TETA (1,4,8,11-tetraazacyclotetradecane-1,4,8,11-tetra acetic acid), HEHA (1,4,7,10,13,16-hexaazacyclohexadecane-1,4,7,10,13,16-hexaacetic acid), PEPA (1,4,7,10,13-pentaazacyclopentadecane-N,N,N,N, N-pentaacetic acid), H.sub.4octapa (N,N-bis(6-carboxy-2-pyridylmethyl)-ethylenediamine-N,N-diacetic acid), H.sub.2dedpa (1,2-[[6-(carboxy)-pyridin-2-yl]-methylamino]ethane), H.sub.6phospa (N,N-(methylenephosphonate)-N,N-[6-(methoxycarbonyl)pyridin-2-yl]-methyl-1,2-diaminoethane), TTHA (triethylenetetramine-N,N,N,N,N,N-hexaacetic acid), DO2P (tetraazacyclododecane dimethanephosphonic acid), HP-DO3A (hydroxypropyltetraazacyclododecanetriacetic acid), EDTA (ethylenediaminetetraacetic acid), Deferoxamine, DTPA (diethylenetriaminepentaacetic acid), DTPA-BMA (diethylenetriaminepentaacetic acid-bismethylamide), HOPO (octadentate hydroxypyridinones), or porphyrins.

    [0345] Preferably, the chelating moiety is selected from DOTA (1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid), DOTMA (1R,4R,7R,10R)-?,?,?,?-tetramethyl-1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid, DOTAM (1,4,7,10-tetrakis(carbamoylmethyl)-1,4,7,10-tetraazacyclododecane), DO3AM-acetic acid (2-(4,7,10-tris(2-amino-2-oxoethyl)-1,4,7,10-tetraazacyclododecan-1-yl)acetic acid), DOTP (1,4,7,10-tetraazacyclododecane-1,4,7,10-tetra(methylene phosphonic acid)), DOTA-4AMP (1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakis(acetamido-methylenephosphonic acid), NOTA (1,4,7-triazacyclononane-1,4,7-triacetic acid), and HP-DO3A (10-(2-hydroxypropyl)-1,4,7-tetraazacyclododecane-1,4,7-triacetic acid).

    [0346] In some embodiments, the chelating moiety is DOTA.

    [0347] In some embodiments, radioimmunoconjugates comprise a metal complex of a chelating moiety. For example, chelating groups may be used in metal chelate combinations with metals, such as manganese, iron, and gadolinium and isotopes (e.g., isotopes in the general energy range of 60 to 10,000 keV), such as any of the radioisotopes and radionuclides discussed herein.

    [0348] In some embodiments, chelating moieties are useful as detection agents, and radioimmunoconjugates comprising such detectable chelating moieties can therefore be used as diagnostic or theranostic agents.

    Radioisotopes and Radionuclides

    [0349] In some embodiments, the metal complex comprises a radionuclide. Examples of suitable radioisotopes and radionuclides include, but are not limited to, .sup.3H, .sup.14C, .sup.15N, .sup.18F, .sup.35S, .sup.47Sc, .sup.55Co, .sup.60Cu, .sup.61Cu, .sup.62Cu, .sup.64Cu, .sup.66Ga, .sup.67Ga, .sup.67Cu, .sup.68Ga, .sup.75Br, .sup.76Br, .sup.77Br, .sup.82Rb, .sup.89Zr, .sup.86Y, .sup.87Y, .sup.90Y, .sup.97Ru, .sup.99Tc, .sup.99mTc, .sup.105Rh, .sup.109Pd, .sup.111In, .sup.123I, .sup.124I, .sup.125I, .sup.131I, .sup.149Pm, .sup.149Tb, .sup.153Sm, .sup.166Ho, .sup.177Lu, .sup.117mSn, .sup.186Re, .sup.188Re, .sup.198Au, .sup.199Au, .sup.201Tl, .sup.203Pb, .sup.211At, .sup.212Pb, .sup.212Bi, .sup.213Bi, .sup.223Ra, .sup.225Ac, .sup.227Th, and .sup.229Th.

    [0350] In some embodiments, the radionuclide is an alpha emitter, e.g., Astatine-211 (.sup.211At) Bismuth-212 (.sup.212Bi), Bismuth-213 (.sup.213Bi), Actinium-225 (.sup.225Ac), Radium-223 (.sup.223Ra), Lead-212 (.sup.212Pb), Thorium-227 (.sup.227Th), or Terbium-149 (.sup.149Tb), or a progeny thereof. In some embodiments, the alpha-emitter is Actinium-225 (.sup.225Ac), or a progeny thereof.

    Linker

    [0351] In some embodiments, the linker is as shown within the structure of Formula I-b, as that part of Formula I-b absent A and B:


    A-L.sup.1-(L.sup.2).sub.n-B Formula I-b

    (A and B are as defined in Formula I-a.)

    [0352] Thus, in some embodiments, the linker is L.sup.1-(L.sup.2).sub.n, wherein: [0353] L.sup.1 is a bond, optionally substituted C.sub.1-C.sub.6 alkyl, optionally substituted C.sub.1-C.sub.6 heteroalkyl, or optionally substituted aryl or heteroaryl; [0354] n is an integer between 1 and 5 (inclusive); and [0355] each L.sup.2, independently, has the structure:


    X.sup.1-L.sup.3-Z.sup.1Formula III [0356] wherein: [0357] X.sup.1 is C(O)NR.sup.1*, NR.sup.1C(O)*, C(S)NR.sup.1*, NR.sup.1C(S)*, OC(O)NR.sup.1*, NR.sup.1C(O)O*, NR.sup.1C(O)NR.sup.1, CH.sub.2PhC(O)NR.sup.1*, NR.sup.1C(O)PhCH.sub.2*, CH.sub.2PhNHC(S)NR.sup.1*, NR.sup.1C(S)NHPhCH.sub.2*, O, or NR.sup.1, wherein * indicates the attachment point to L.sup.3, and each R.sup.1 is independently hydrogen, C.sub.1-C.sub.6 alkyl optionally substituted with oxo, heteroaryl, or a combination thereof, optionally substituted C.sub.1-C.sub.6 heteroalkyl, or optionally substituted aryl or heteroaryl; [0358] L.sup.3 is optionally substituted C.sub.1-C.sub.50 alkyl or optionally substituted C.sub.1-C.sub.50 heteroalkyl (e.g., (CH.sub.2CH.sub.2O).sub.2-20); [0359] Z.sup.1 is CH.sub.2, C(O), C(S), OC(O)#, C(O)O#, NR.sup.2C(O)#, C(O)NR.sup.2#, or NR.sup.2, wherein # indicates the attachment point to B, and each R.sup.2 is independently hydrogen, optionally substituted C.sub.1-C.sub.6 alkyl, or pyrrolidine-2,5-dione.

    [0360] In some embodiments, L.sup.1 is substituted C.sub.1-C.sub.6 alkyl or substituted C.sub.1-C.sub.6 heteroalkyl, the substituent comprising a heteroaryl group (e.g., six-membered nitrogen-containing heteroaryl). In some embodiments, L.sup.1 is C.sub.1-C.sub.6 alky. For example, L.sup.1 is CH.sub.2CH.sub.2. In some embodiments, L.sup.1 is a bond.

    [0361] In some embodiments, X.sup.1 is C(O)NR.sup.1*, * indicating the attachment point to L.sup.3, and R.sup.1 is H.

    [0362] In some embodiments, L.sup.3 is optionally substituted C.sub.1-C.sub.50 alkyl (e.g., C.sub.1-C.sub.40 alkyl, C.sub.1-C.sub.30 alkyl, C.sub.1-C.sub.20 alkyl, C.sub.2-C.sub.18 alkyl, C.sub.3-C.sub.16 alkyl, C.sub.4-C.sub.14 alkyl, C.sub.5-C.sub.12 alkyl, C.sub.6-C.sub.10 alkyl, C.sub.8-C.sub.10 alkyl, or C.sub.10 alkyl).

    [0363] In some embodiments, L.sup.3 is optionally substituted C.sub.1-C.sub.50 heteroalkyl (e.g., C.sub.1-C.sub.40 heteroalkyl, C.sub.1-C.sub.30 heteroalkyl, C.sub.1-C.sub.20 heteroalkyl, C.sub.2-C.sub.18 heteroalkyl, C.sub.3-C.sub.16 heteroalkyl, C.sub.4-C.sub.14 heteroalkyl, C.sub.5-C.sub.12 heteroalkyl, C.sub.6-C.sub.10 heteroalkyl, C.sub.8-C.sub.10 heteroalkyl, C.sub.4 heteroalkyl, C.sub.6 heteroalkyl, C.sub.8 heteroalkyl, C.sub.10 heteroalkyl, C.sub.12 heteroalkyl, C.sub.16 heteroalkyl, C.sub.20 heteroalkyl, or C.sub.24 heteroalkyl).

    [0364] In some embodiments, L.sup.3 is optionally substituted C.sub.1-C.sub.50 heteroalkyl comprising a polyethylene glycol (PEG) moiety comprising 1-20 oxyethylene (OCH.sub.2CH.sub.2) units, e.g., 2 oxyethylene units (PEG2), 3 oxyethylene units (PEG3), 4 oxyethylene units (PEG4), 5 oxyethylene units (PEG5), 6 oxyethylene units (PEG6), 7 oxyethylene units (PEG7), 8 oxyethylene units (PEG8), 9 oxyethylene units (PEG9), 10 oxyethylene units (PEG10), 12 oxyethylene units (PEG12), 14 oxyethylene units (PEG14), 16 oxyethylene units (PEG16), or 18 oxyethylene units (PEG18).

    [0365] In certain embodiments, L.sup.3 is optionally substituted C.sub.1-50 heteroalkyl comprising a polyethylene glycol (PEG) moiety comprising 1-20 oxyethylene (OCH.sub.2CH.sub.2) units or portions thereof. For example, L.sup.3 comprises PEG3 as shown below:

    ##STR00007##

    [0366] In some embodiments, L.sup.3 is (CH.sub.2CH.sub.2O).sub.m(CH.sub.2).sub.w, and m and w are each independently an integer between 0 and 10 (inclusive), and at least one of m and w is not 0.

    [0367] In some embodiments, L.sup.3 is substituted C.sub.1-C.sub.50 alkyl or substituted C.sub.1-C.sub.50 heteroalkyl, the substituent comprising a heteroaryl group (e.g., six-membered nitrogen-containing heteroaryl).

    [0368] In some embodiments, A is a macrocyclic chelating moiety comprising one or more heteroaryl groups (e.g., six-membered nitrogen-containing heteroaryl).

    Cross-Linking Groups

    [0369] In some embodiments, radioimmunoconjugates are synthesized using bifunctional chelates that comprise a chelate, a linker, and a cross-linking group. Once the radioimmunoconjugate is formed, the cross-linking group may be absent from the radioimmunoconjugate.

    [0370] In some embodiments, radioimmunoconjugates comprise a cross-linking group instead of or in addition to the targeting moiety (e.g., in some embodiments, B in Formula I comprises a cross-linking group).

    [0371] A cross-linking group is a reactive group that is able to join two or more molecules by a covalent bond. Cross-linking groups may be used to attach the linker and chelating moiety to a therapeutic or targeting moiety. Cross-linking groups may also be used to attach the linker and chelating moiety to a target in vivo. In some embodiments, the cross-linking group is an amino-reactive, methionine reactive or thiol-reactive cross-linking group, or comprises a sortase recognition sequence. In some embodiments, the amino-reactive or thiol-reactive cross-linking group comprises an activated ester such as a hydroxysuccinimide ester, 2,3,5,6-tetrafluorophenol ester, 4-nitrophenol ester or an imidate, anhydride, thiol, disulfide, maleimide, azide, alkyne, strained alkyne, strained alkene, halogen, sulfonate, haloacetyl, amine, hydrazide, diazirine, phosphine, tetrazine, isothiocyanate, or oxaziridine. In some embodiments, the sortase recognition sequence may comprise of a terminal glycine-glycine-glycine (GGG) and/or LPTXG amino acid sequence, where X is any amino acid. A person having ordinary skill in the art will understand that the use of cross-linking groups is not limited to the specific constructs disclosed herein, but rather may include other known cross-linking groups.

    Pharmaceutical Compositions

    [0372] Pharmaceutical compositions comprising radioimmunoconjugates for use in methods disclosed herein can be formulated for use in a variety of drug delivery systems. One or more physiologically acceptable excipients or carriers can also be included in a pharmaceutical composition for proper formulation. Non-limiting examples of suitable formulations compatible for use with the present disclosure include those described in Remington's Pharmaceutical Sciences, Mack Publishing Company, Philadelphia, PA, 17th ed., 1985. For a brief review of methods for drug delivery, See, e.g., Langer (Science. 249:1527-1533, 1990).

    [0373] Pharmaceutical compositions may be formulated for any of a variety of routes of administration discussed herein (See, e.g., the Administration and Dosage subsection herein), Sustained release administration is contemplated, by such means as depot injections or erodible implants or components. Thus, the present disclosure provides pharmaceutical compositions that include agents disclosed herein (e.g., radioimmunoconjugates) dissolved or suspended in an acceptable carrier, preferably an aqueous carrier, e.g., water, buffered water, saline, or PBS, among others. In some embodiments, pharmaceutical compositions contain pharmaceutically acceptable auxiliary substances to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents, or detergents, among others. In some embodiments, pharmaceutical compositions are formulated for oral delivery and may optionally contain inert ingredients such as binders or fillers for the formulation of a unit dosage form, such as a tablet or a capsule. In some embodiments, pharmaceutical compositions are formulated for local administration and may optionally contain inert ingredients such as solvents or emulsifiers for the formulation of a cream, an ointment, a gel, a paste, or an eye drop.

    [0374] In some embodiments, provided pharmaceutical compositions are sterilized by conventional sterilization techniques, e.g., may be sterile filtered. Resulting aqueous solutions may be packaged for use as is, or lyophilized. Lyophilized preparations can be, for example, combined with a sterile aqueous carrier prior to administration. The pH of preparations typically will be between 3 and 11, more preferably between 5 and 9 or between 6 and 8, and most preferably between 6 and 7, such as 6 to 6.5. Resulting compositions in solid form may be packaged, for example, in multiple single dose units, each containing a fixed amount of the above-mentioned agent or agents, such as in a sealed package of tablets or capsules. Pharmaceutical compositions in solid form can also be packaged in a container for a flexible quantity, such as in a squeezable tube designed for a topically applicable cream or ointment.

    [0375] The following specific examples are to be construed as merely illustrative, and not limitative of the remainder of the disclosure in any way whatsoever.

    Listing of Exemplary Embodiments

    [0376] The invention is further described by the following non-limiting exemplary embodiments:

    Embodiment 1. A method of treating cancer, the method comprising: (a) administering to a subject in need thereof a pharmaceutical composition comprising an effective amount of a radioimmunoconjugate or a pharmaceutically acceptable salt thereof, wherein the radioimmunoconjugate comprises the following structure:


    A-L-B Formula I-a [0377] wherein A is a chelating moiety or metal complex thereof, [0378] wherein B is an FGFR3 targeting moiety, [0379] wherein L is a linker, and [0380] wherein the subject is being co-administered a cold FGFR3-targeting molecule.
    Embodiment 2. The method of embodiment 1, wherein A is a metal complex of a chelating moiety.
    Embodiment 3. The method of embodiment 2, wherein the metal complex comprises a radionuclide.
    Embodiment 4. The method of embodiment 3, wherein the radionuclide is an alpha emitter.
    Embodiment 5. The method of embodiment 4, wherein the radionuclide is an alpha emitter selected from the group consisting of Astatine-211 (.sup.211At), Bismuth-212 (.sup.212Bi), Bismuth-213 (.sup.213Bi), Actinium-225 (.sup.225Ac), Radium-223 (.sup.223Ra), Lead-212 (.sup.212Pb), Thorium-227 (.sup.227Th), and Terbium-149 (.sup.149Tb), or a progeny thereof.
    Embodiment 6. The method of embodiment 5, wherein the radionuclide is .sup.225AC or a progeny thereof.
    Embodiment 7. The method of embodiment 1, wherein L has the structure L.sup.1-(L.sup.2).sub.n, as shown within Formula I-b:


    A-L.sup.1-(L.sup.2).sub.n-B Formula I-b

    wherein [0381] A is a chelating moiety or metal complex thereof; [0382] B is an FGFR3 targeting moiety; [0383] L.sup.1 is a bond, optionally substituted C.sub.1-C.sub.6 alkyl, optionally substituted C.sub.1-C.sub.6 heteroalkyl, or optionally substituted aryl or heteroaryl; [0384] n is an integer between 1 and 5 (inclusive); and [0385] each L.sup.2, independently, has the structure:


    X.sup.1-L.sup.3-Z.sup.1Formula III [0386] wherein [0387] X.sup.1 is C(O)NR.sup.1*, NR.sup.1C(O)*, C(S)NR.sup.1*, NR.sup.1C(S)*, OC(O)NR.sup.1*, NR.sup.1C(O)O*, NR.sup.1C(O)NR.sup.1, CH.sub.2PhC(O)NR.sup.1*, NR.sup.1C(O)PhCH.sub.2*, CH.sub.2PhNHC(S)NR.sup.1*, NR.sup.1C(S)NHPhCH.sub.2*, O, or NR.sup.1, wherein * indicates the attachment point to L.sup.3, and each R.sup.1 is independently hydrogen, C.sub.1-C.sub.6 alkyl optionally substituted with oxo, heteroaryl, or a combination thereof, optionally substituted C.sub.1-C.sub.6 heteroalkyl, or optionally substituted aryl or heteroaryl; [0388] L.sup.3 is optionally substituted C.sub.1-C.sub.50 alkyl or optionally substituted C.sub.1-C.sub.50 heteroalkyl; and [0389] Z.sup.1 is CH.sub.2, C(O), C(S), OC(O)#, C(O)O#, NR.sup.2C(O)#, C(O)NR.sup.2#, or NR.sup.2, wherein # indicates the attachment point to B, and each R.sup.2 is independently hydrogen, optionally substituted C.sub.1-C.sub.6 alkyl, or pyrrolidine-2,5-dione.
    Embodiment 8. The method of embodiment 7, wherein L.sup.3 comprises (CH.sub.2CH.sub.2O).sub.2-20.
    Embodiment 9. The method of embodiment 7, wherein L.sup.3 is (CH.sub.2CH.sub.2O).sub.m(CH.sub.2).sub.w, and m and w are each independently an integer between 0 and 10 (inclusive), and at least one of m and w is not 0.
    Embodiment 10. The method of embodiment 7, wherein the radioimmunoconjugate comprises the following structure:

    ##STR00008##

    wherein B is an FGFR3 targeting moiety.
    Embodiment 11. The method of embodiment 1, wherein L has the structure L.sup.1-(L.sup.2).sub.n, as shown within Formula I-b:


    A-L.sup.1-(L.sup.2).sub.n-B Formula I-b

    wherein: [0390] A is DOTA, or a metal complex thereof; [0391] B is an FGFR3 targeting moiety; [0392] L.sup.1 is a bond or C.sub.1-C.sub.6 alkyl; [0393] n is 1; and [0394] L.sup.2 has the structure:


    X.sup.1-L.sup.3-Z.sup.1Formula III [0395] wherein: [0396] X.sup.1 is C(O)NR.sup.1*, * indicating the attachment point to L.sup.3, and R.sup.1 is H or C.sub.1-C.sub.6 alkyl; [0397] L.sup.3 is (CH.sub.2CH.sub.2O).sub.m(CH.sub.2).sub.w, and m and w are independently an integral between 0 and 10 (inclusive), and at least one of m and w is not 0; and [0398] Z.sup.1 is C(O).
    Embodiment 12. The method of any one of embodiments 1-11, wherein the FGFR3 targeting moiety is at least 100 kDa in size.
    Embodiment 13. The method of embodiment 12, wherein the FGFR3 targeting moiety is at least 150 kDa in size.
    Embodiment 14. The method of embodiment 13, wherein the FGFR3 targeting moiety is at least 200 kDa in size.
    Embodiment 15. The method of embodiment 14, wherein the FGFR3 targeting moiety is at least 250 kDa in size.
    Embodiment 16. The method of embodiment 15, wherein the FGFR3 targeting moiety is at least 300 kDa in size.
    Embodiment 17. The method of any one of embodiments 1-16, wherein the FGFR3 targeting moiety is capable of binding to human FGFR3.
    Embodiment 18. The method of any one of embodiments 1-17, wherein the FGFR3 targeting moiety is capable of binding to wild type FGFR3.
    Embodiment 19. The method of any one of embodiments 1-17, wherein the FGFR3 targeting moiety is capable of binding to a mutant FGFR3.
    Embodiment 20. The method of any one of embodiments 19, wherein the FGFR3 targeting moiety is capable of binding to both wild type and a mutant FGFR3.
    Embodiment 21. The method of embodiment 19 or 20, wherein the mutant FGFR3 comprises a point mutation.
    Embodiment 22. The method of embodiment 21, wherein the point mutation is associated with cancer.
    Embodiment 23. The method of embodiment 22, wherein the point mutant is selected from the group consisting of FGFR3.sup.Y375C, FGFR3.sup.R248C, FGFR3.sup.S249C, FGFR3.sup.G372C, FGFR3.sup.K652E, FGFR3.sup.K652Q, FGFR3.sup.K652M, and combinations thereof.
    Embodiment 24. The method of any one of embodiments 18-23, wherein the mutant FGFR3 comprises an FGFR3 fusion.
    Embodiment 25. The method of embodiment 24, wherein the FGFR3 fusion is selected from the group consisting of FGFR3-TACC3, FGFR3-CAMK2A, FGFR3-JAKMOP1, FGFR3-TNIP2, FGFR3-WHSC1, FGFR3-BAIAP2L1, and combinations thereof.
    Embodiment 26. The method of any one of embodiments 1-25, wherein the FGFR3 targeting moiety comprises an antibody or antigen-binding fragment thereof.
    Embodiment 27. The method of embodiment 26, wherein the antibody or antigen-binding fragment thereof is humanized.
    Embodiment 28. The method of embodiment 26 or 27, wherein the antibody or antigen-binding fragment thereof comprises at least one complementarity determining region (CDR) selected from the group consisting of: [0399] CDR-H1 comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0400] CDR-H2 comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0401] CDR-H3 comprising the amino acid sequence of SEQ ID NO: 3 or 4, or an amino acid sequence differing in 1 or 2 amino acids from SEQ ID NO: 3 or 4; [0402] CDR-L1 comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0403] CDR-L2 comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence differing in 1 or 2 amino acids therefrom; or [0404] CDR-L3 comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence differing in 1 or 2 amino acids therefrom.
    Embodiment 29. The method of embodiment 28, wherein the antibody or antigen-binding fragment thereof comprises at least two CDRs selected from the group consisting of: [0405] CDR-H1 comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0406] CDR-H2 comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0407] CDR-H3 comprising the amino acid sequence of SEQ ID NO: 3 or 4, or an amino acid sequence differing in 1 or 2 amino acids from SEQ ID NO: 3 or 4; [0408] CDR-L1 comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0409] CDR-L2 comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence differing in 1 or 2 amino acids therefrom; or [0410] CDR-L3 comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence differing in 1 or 2 amino acids therefrom.
    Embodiment 30. The method of embodiment 29, wherein the antibody or antigen-binding fragment thereof comprises at least three CDRs selected from the group consisting of: CDR-H1 comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0411] CDR-H2 comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0412] CDR-H3 comprising the amino acid sequence of SEQ ID NO: 3 or 4, or an amino acid sequence differing in 1 or 2 amino acids from SEQ ID NO: 3 or 4; [0413] CDR-L1 comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0414] CDR-L2 comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence differing in 1 or 2 amino acids therefrom; or [0415] CDR-L3 comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence differing in 1 or 2 amino acids therefrom.
    Embodiment 31. The method of embodiment 29, wherein the antibody or antigen-binding fragment thereof comprises at least four CDRs selected from the group consisting of: [0416] CDR-H1 comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0417] CDR-H2 comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0418] CDR-H3 comprising the amino acid sequence of SEQ ID NO: 3 or 4, or an amino acid sequence differing in 1 or 2 amino acids from SEQ ID NO: 3 or 4; [0419] CDR-L1 comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0420] CDR-L2 comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence differing in 1 or 2 amino acids therefrom; or [0421] CDR-L3 comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence differing in 1 or 2 amino acids therefrom.
    Embodiment 32. The method of embodiment 30, wherein the antibody or antigen-binding fragment thereof comprises at least five CDRs selected from the group consisting of: [0422] CDR-H1 comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0423] CDR-H2 comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0424] CDR-H3 comprising the amino acid sequence of SEQ ID NO: 3 or 4, or an amino acid sequence differing in 1 or 2 amino acids from SEQ ID NO: 3 or 4; [0425] CDR-L1 comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0426] CDR-L2 comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence differing in 1 or 2 amino acids therefrom; or [0427] CDR-L3 comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence differing in 1 or 2 amino acids therefrom.
    Embodiment 33. The method of embodiment 31, wherein the antibody or antigen-binding fragment thereof comprises: [0428] CDR-H1 comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0429] CDR-H2 comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0430] CDR-H3 comprising the amino acid sequence of SEQ ID NO: 3 or 4, or an amino acid sequence differing in 1 or 2 amino acids from SEQ ID NO: 3 or 4; [0431] CDR-L1 comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0432] CDR-L2 comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence differing in 1 or 2 amino acids therefrom; and [0433] CDR-L3 comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence differing in 1 or 2 amino acids therefrom.
    Embodiment 34. The method of embodiment 26 or 27, wherein the antibody or antigen-binding fragment thereof comprises [0434] (i) a heavy chain variable domain comprising at least one CDR selected from the group consisting of: [0435] CDR-H1 comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0436] CDR-H2 comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence differing in 1 or 2 amino acids therefrom; and [0437] CDR-H3 comprising the amino acid sequence of SEQ ID NO: 3 or 4, or an amino acid sequence differing in 1 or 2 amino acids from SEQ ID NO: 3 or 4; and [0438] (ii) a light chain variable domain comprising at least one CDR selected from the group consisting of: [0439] CDR-L1 comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0440] CDR-L2 comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence differing in 1 or 2 amino acids therefrom; and [0441] CDR-L3 comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence differing in 1 or 2 amino acids therefrom.
    Embodiment 35. The method of embodiment 34, wherein the antibody or antigen-binding fragment thereof comprises [0442] (i) a heavy chain variable domain comprising at least one CDR selected from the group consisting of: [0443] CDR-H1 comprising the amino acid sequence of SEQ ID NO: 1; [0444] CDR-H2 comprising the amino acid sequence of SEQ ID NO: 2; and [0445] CDR-H3 comprising the amino acid sequence of SEQ ID NO: 3 or 4; and [0446] (ii) a light chain variable domain comprising at least one CDR selected from the group consisting of: [0447] CDR-L1 comprising the amino acid sequence of SEQ ID NO: 5; [0448] CDR-L2 comprising the amino acid sequence of SEQ ID NO: 6; and [0449] CDR-L3 comprising the amino acid sequence of SEQ ID NO: 7.
    Embodiment 36. The method of embodiment 34 or 35, wherein the antibody or antigen-binding fragment thereof comprises [0450] (i) a heavy chain variable domain comprising at least two CDRs selected from the group consisting of: [0451] CDR-H1 comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0452] CDR-H2 comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence differing in 1 or 2 amino acids therefrom; and [0453] CDR-H3 comprising the amino acid sequence of SEQ ID NO: 3 or 4, or an amino acid sequence differing in 1 or 2 amino acids from SEQ ID NO: 3 or 4; and [0454] (ii) a light chain variable domain comprising at least two CDRs selected from the group consisting of: [0455] CDR-L1 comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0456] CDR-L2 comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence differing in 1 or 2 amino acids therefrom; and [0457] CDR-L3 comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence differing in 1 or 2 amino acids therefrom.
    Embodiment 37. The method of embodiment 36, wherein the antibody or antigen-binding fragment thereof comprises [0458] (i) a heavy chain variable domain comprising at least two CDRs selected from the group consisting of: [0459] CDR-H1 comprising the amino acid sequence of SEQ ID NO: 1; [0460] CDR-H2 comprising the amino acid sequence of SEQ ID NO: 2; and [0461] CDR-H3 comprising the amino acid sequence of SEQ ID NO: 3 or 4; and [0462] (ii) a light chain variable domain comprising at least two CDRs selected from the group consisting of: [0463] CDR-L1 comprising the amino acid sequence of SEQ ID NO: 5; [0464] CDR-L2 comprising the amino acid sequence of SEQ ID NO: 6; and [0465] CDR-L3 comprising the amino acid sequence of SEQ ID NO: 7.
    Embodiment 38. The method of embodiment 37, wherein the antibody or antigen-binding fragment thereof comprises [0466] (i) a heavy chain variable domain comprising: [0467] CDR-H1 comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0468] CDR-H2 comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence differing in 1 or 2 amino acids therefrom; and [0469] CDR-H3 comprising the amino acid sequence of SEQ ID NO: 3 or 4, or an amino acid sequence differing in 1 or 2 amino acids from SEQ ID NO: 3 or 4; and [0470] (ii) a light chain variable domain comprising: [0471] CDR-L1 comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence differing in 1 or 2 amino acids therefrom; [0472] CDR-L2 comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence differing in 1 or 2 amino acids therefrom; and [0473] CDR-L3 comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence differing in 1 or 2 amino acids therefrom.
    Embodiment 39. The method of embodiment 38, wherein the antibody or antigen-binding fragment thereof comprises [0474] (i) a heavy chain variable domain comprising: [0475] CDR-H1 comprising the amino acid sequence of SEQ ID NO: 1; [0476] CDR-H2 comprising the amino acid sequence of SEQ ID NO: 2; and [0477] CDR-H3 comprising the amino acid sequence of SEQ ID NO: 3 or 4; and [0478] (ii) a light chain variable domain comprising: [0479] CDR-L1 comprising the amino acid sequence of SEQ ID NO: 5; [0480] CDR-L2 comprising the amino acid sequence of SEQ ID NO: 6; and [0481] CDR-L3 comprising the amino acid sequence of SEQ ID NO: 7.
    Embodiment 40. The method of any one of embodiments 29-39, wherein the antibody or antigen-binding fragment thereof comprises [0482] (i) a heavy chain variable domain having an amino acid sequence with at least 85% identity with the amino acid sequence of SEQ ID NO: 8; and [0483] (ii) a light chain variable domain having an amino acid sequence with at least 85% identity with the amino acid sequence of SEQ ID NO: 9.
    Embodiment 41. The method of embodiment 40, wherein the antibody or antigen-binding fragment thereof comprises [0484] (i) a heavy chain variable domain having an amino acid sequence with at least 90% identity with the amino acid sequence of SEQ ID NO: 8; and [0485] (ii) a light chain variable domain having an amino acid sequence with at least 90% identity with the amino acid sequence of SEQ ID NO: 9.
    Embodiment 42. The method of embodiment 41, wherein the antibody or antigen-binding fragment thereof comprises [0486] (i) a heavy chain variable domain having an amino acid sequence with at least 95% identity with the amino acid sequence of SEQ ID NO: 8; and [0487] (ii) a light chain variable domain having an amino acid sequence with at least 95% identity with the amino acid sequence of SEQ ID NO: 9.
    Embodiment 43. The method of embodiment 40, wherein the antibody or antigen-binding fragment thereof comprises [0488] (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 8; and [0489] (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 9.
    Embodiment 44. The method of embodiment 43, wherein the antibody is MFGR1877S (vofatamab).
    Embodiment 45. The method of any one of embodiments 1-44, wherein, after administration of the radioimmunoconjugate or a composition thereof to a mammal, the proportion of radiation excreted by the intestinal routes, renal route, or both routes is at least 2-fold greater than the proportion of radiation excreted by the same route(s) by a comparable mammal that has been administered a reference radioimmunoconjugate.
    Embodiment 46. The method of embodiment 45, wherein, after administration of the radioimmunoconjugate or a composition thereof to a mammal, the proportion of radiation excreted by the intestinal routes, renal route, or both routes is at least 3-fold greater than the proportion of radiation excreted by the same route(s) by a comparable mammal that has been administered a reference radioimmunoconjugate.
    Embodiment 47. The method of embodiment 1, wherein A-L is a metal complex of a moiety selected from the group consisting of:

    ##STR00009##

    Embodiment 48. The method of embodiment 47, wherein A-L is a metal complex of Moiety 1:

    ##STR00010##

    Embodiment 49. The method of embodiment 48, wherein the metal complex comprises a radionuclide.
    Embodiment 50. The method of embodiment 49, wherein the radionuclide is an alpha emitter.
    Embodiment 51. The method of embodiment 50, wherein the radionuclide is an alpha emitter selected from the group consisting of Astatine-211 (.sup.211At), Bismuth-212 (.sup.212Bi), Bismuth-213 (.sup.213Bi), Actinium-225 (.sup.225Ac), Radium-223 (.sup.223Ra), Lead-212 (.sup.212Pb), Thorium-227 (.sup.227Th), and Terbium-149 (.sup.149Tb), or a progeny thereof.
    Embodiment 52. The method of embodiment 51, wherein the radionuclide is .sup.225AC or a progeny thereof.
    Embodiment 53. The method of embodiment 52, wherein the FGFR3 targeting moiety comprises an antibody or antigen-binding fragment thereof.
    Embodiment 54. The method of embodiment 53, wherein the antibody or antigen-binding fragment thereof is humanized.
    Embodiment 55. The method of embodiment 54, wherein the antibody or antigen-binding fragment thereof comprises [0490] (i) a heavy chain variable domain comprising: [0491] CDR-H1 comprising the amino acid sequence of SEQ ID NO: 1; [0492] CDR-H2 comprising the amino acid sequence of SEQ ID NO: 2; and [0493] CDR-H3 comprising the amino acid sequence of SEQ ID NO: 3 or 4; and [0494] (ii) a light chain variable domain comprising: [0495] CDR-L1 comprising the amino acid sequence of SEQ ID NO: 5; [0496] CDR-L2 comprising the amino acid sequence of SEQ ID NO: 6; and [0497] CDR-L3 comprising the amino acid sequence of SEQ ID NO: 7.
    Embodiment 56. The method of embodiment 54, wherein the antibody or antigen-binding fragment thereof comprises (i) a heavy chain variable domain having an amino acid sequence with at least 95% identity with the amino acid sequence of SEQ ID NO: 8; and (ii) a light chain variable domain having an amino acid sequence with at least 95% identity with the amino acid sequence of SEQ ID NO: 9.
    Embodiment 57. The method of embodiment 56, wherein the antibody or antigen-binding fragment thereof comprises (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 8; and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 9.
    Embodiment 58. The method of embodiment 57, wherein the antibody or antigen-binding fragment thereof is MFGR1877S (vofatamab) or an antigen-binding fragment thereof.
    Embodiment 59. The method of embodiment 58, wherein the antibody or antigen-binding fragment thereof is MFGR1877S (vofatamab).
    Embodiment 60. The method of embodiment 48, wherein the radioimmunoconjugate comprises the following structure:

    ##STR00011##

    Embodiment 61. The method of embodiment 60, wherein MFGR1877S is linked to A-L via the side-chain amino group of a lysine residue.
    Embodiment 62. The method of any one of embodiments 1-61, wherein the subject is a mammal.
    Embodiment 63. The method of embodiment 62, wherein the mammal is a human.
    Embodiment 64. The method of any one of embodiments 1-63, wherein the cancer is a solid tumor cancer.
    Embodiment 65. The method of embodiment 64, wherein the solid tumor cancer is adrenocortical carcinoma, bladder cancer, breast cancer, cervical cancer, colorectal cancer, endometrial adenocarcinoma, Ewing's sarcoma, gallbladder carcinoma, glioma, head and neck cancer, liver cancer, lung cancer, neuroblastoma, neuroendocrine cancer, pancreatic cancer, prostate cancer, renal cell carcinoma, salivary adenoid cystic cancer, or spermatocytic seminoma.
    Embodiment 66. The method of embodiment 65, wherein the solid tumor cancer is bladder cancer.
    Embodiment 67. The method of embodiment 65, wherein the solid tumor cancer is glioma.
    Embodiment 68. The method of embodiment 65, wherein the solid tumor cancer is neuroblastoma.
    Embodiment 69. The method of embodiment 65, wherein the solid tumor cancer is pancreatic cancer.
    Embodiment 70. The method of embodiment 65, wherein the solid tumor cancer is breast cancer.
    Embodiment 71. The method of embodiment 65, wherein the solid tumor cancer is head and neck cancer.
    Embodiment 72. The method of embodiment 65, wherein the solid tumor cancer is liver cancer.
    Embodiment 73. The method of embodiment 65, wherein the solid tumor cancer is lung cancer.
    Embodiment 74. The method of any one of embodiments 1-63, wherein the cancer is a non-solid tumor cancer.
    Embodiment 75. The method of embodiment 74, wherein the cancer is a liquid cancer or hematologic cancer.
    Embodiment 76. The method of embodiment 75, wherein the cancer is a myeloma.
    Embodiment 77. The method of embodiment 76, wherein the myeloma is multiple myeloma.
    Embodiment 78. The method of embodiment 75, wherein the cancer is a leukemia.
    Embodiment 79. The method of embodiment 75, wherein the cancer is lymphoma.
    Embodiment 80. The method of any one of embodiments 1-79, wherein the pharmaceutical composition is administered systemically.
    Embodiment 81. The method of embodiment 80, wherein the pharmaceutical composition is administered parenterally.
    Embodiment 82. The method of embodiment 81, wherein the pharmaceutical composition is administered intravenously.
    Embodiment 83. The method of embodiment 81, wherein the pharmaceutical composition is administered intraarterially.
    Embodiment 84. The method of embodiment 81, wherein the pharmaceutical composition is administered intraperitoneally.
    Embodiment 85. The method of embodiment 81, wherein the pharmaceutical composition is administered subcutaneously.
    Embodiment 86. The method of embodiment 81, wherein the pharmaceutical composition is administered intradermally.
    Embodiment 87. The method of embodiment 80, wherein the pharmaceutical composition is administered enterically.
    Embodiment 88. The method of embodiment 87, wherein the pharmaceutical composition is administered trans-gastrointestinally.
    Embodiment 89. The method of embodiment 87, wherein the pharmaceutical composition is administered orally.
    Embodiment 90. The method of any one of embodiment 1-79, wherein the pharmaceutical composition is administered locally.
    Embodiment 91. The method of embodiment 90, wherein the pharmaceutical composition is administered by peritumoral injection.
    Embodiment 92. The method of embodiment 90, wherein the pharmaceutical composition is administered by intratumoral injection.
    Embodiment 93. The method of any one of embodiments 1-92, wherein the FGFR3 targeting moiety within the radioimmunoconjugate and the cold FGFR3-targeting molecule are capable of binding the same epitope on FGFR3.
    Embodiment 94. The method of any one of embodiments 1-93, wherein the subject is administered an amount of cold FGFR3-targeting molecule that is at least 5-fold, at least 6.25-fold, at least 7.5-fold, at least 10-fold, at least 12.5-fold, at least 25-fold, at least 50-fold, or at least 100-fold greater than the amount of FGFR3 targeting moiety within the radioimmunoconjugate administered to the subject.
    Embodiment 95. The method of any one of embodiments 1-93, wherein the subject is administered an amount of cold FGFR3-targeting molecule that is at most 125-fold, at most 100-fold, or at most 50-fold greater than the amount of FGFR3 targeting moiety within the radioimmunoconjugate administered to the subject.
    Embodiment 96. The method of any one of embodiments 1-93, wherein the subject is administered an amount of cold FGFR3-targeting molecule that is between 5-fold greater and 100-fold greater, between 5-fold and 50-fold greater, between 5-fold and 25-fold greater, between 10-fold and 100-fold greater, between 10-fold and 50-fold greater, between 10-fold and 25-fold greater, between 12.5-fold and 100-fold greater, between 12.5-fold and 50-fold greater, or between 12.5-fold and 25-fold greater than the amount of FGFR3 targeting moiety within the radioimmunoconjugate administered to the subject.
    Embodiment 97. The method of any one of embodiments 1-96, wherein the subject is administered at least 2.5 mg/kg, at least 5 mg/kg, or at least 10 mg/kg of cold FGFR3 targeting molecule.
    Embodiment 98. The method of any one of embodiments 1-96, wherein the subject is administered about 2.5 mg/kg, about 5 mg/kg, or about 10 mg/kg of cold FGFR3-targeting molecule.
    Embodiment 99. The method of any one of embodiments 1-96, wherein the subject is administered about 10 mg/kg of cold FGFR3-targeting molecule.
    Embodiment 100. The method of any one of embodiments 1-99, wherein, after the step of administering, the subject exhibits increased tumor uptake of the radioimmunoconjugate relative to a reference level.
    Embodiment 101. The method of any one of embodiments 1-100, wherein, after the step of administering, the subject exhibits reduced uptake of the radioimmunoconjugate in one or more normal tissues relative to a reference level.
    Embodiment 102. The method of any one of embodiments 1-101, wherein, after the step of administering, the subject exhibits reduced clearance of the radioimmunoconjugate from the blood relative to a reference level.
    Embodiment 103. The method of any one of embodiments 1-102, wherein, after the step of administering, the subject exhibits reduced excretion of the radioimmunoconjugate in urine relative to a reference level.
    Embodiment 104. The method of any one of embodiments 1-103, wherein, after the step of administering, the subject exhibits reduced toxicity as compared to a reference level.
    Embodiment 105. The method of any one of embodiments 1-104, wherein after the step of administering, [0498] (i) the proportion of radiation excreted by the intestinal routes, renal route, or both routes is at least 2-fold greater than the proportion of radiation excreted by the same route(s) by a comparable subject that has been administered a reference radioimmunoconjugate; [0499] (ii) the subject exhibits increased tumor uptake of the radioimmunoconjugate relative to a reference level; [0500] (iii) the subject exhibits reduced uptake of the radioimmunoconjugate in one or more normal tissues relative to a reference level; [0501] (iv) the subject exhibits reduced clearance of the radioimmunoconjugate from the blood relative to a reference level; [0502] (v) the subject exhibits reduced excretion of the radioimmunoconjugate in urine relative to a reference level; and/or [0503] (vi) the subject exhibits reduced toxicity as compared to a reference level.
    Embodiment 106. The method of any one of embodiments 1-105, wherein the cold FGFR3-targeting molecule is an anti-FGFR3 antibody or antigen-binding fragment thereof administered at a dosage of about 10 mg/kg.
    Embodiment 107. The method of any one of embodiments 1-106, wherein the radioimmunoconjugate is administered with a multi-dosing regimen.
    Embodiment 108. The method of any one of embodiments 1-107, wherein the radioimmunoconjugate is administered at a dosage of about 50 to about 200 nCi.
    Embodiment 109. The method of any one of embodiments 1-108, wherein the cold FGFR3-targeting molecule comprises vofatamab or an antigen-binding fragment thereof.

    EXAMPLES

    Example 1. General Materials and Methods

    [0504] Lutetium-177 can be obtained from Perkin Elmer as lutetium trichloride in a 0.05 N hydrochloric acid solution; indium-111, as a trichloride salt, can be obtained from Nordion; and actinium-225 can be obtained as actinium-225 trinitrate from Oak Ridge National Laboratories.

    [0505] Analytical HPLC-MS can be performed using a Waters Acquity HPLC-MS system comprised of a Waters Acquity Binary Solvent Manager, a Waters Acquity Sample Manager (samples cooled to 10? C.), a Water Acquity Column Manager (column temperature 30? C.), a Waters Acquity Photodiode Array Detector (monitoring at 254 nm and 214 nm), a Waters Acquity TQD with electrospray ionization and a Waters Acquity BEH C18, 2.1?50 (1.7 ?m) column. Preparative HPLC can be performed using a Waters HPLC system comprised of a Waters 1525 Binary HPLC pump, a Waters 2489 UV/Visible Detector (monitoring at 254 nm and 214 nm) and a Waters)(Bridge Prep phenyl or C18 19?100 mm (5 ?m) column.

    [0506] HPLC elution method 1: Waters Acquity BEH C18 2.1?50 mm (1.7 ?m) column; mobile phase A: H.sub.2O (0.1% v/v TFA); mobile phase B: acetonitrile (0.1% v/v TFA); flow rate=0.3 mL/min; initial=90% A, 3-3.5 min=0% A, 4 min'90% A, 5 min=90% A.

    [0507] HPLC elution method 2: Waters XBridge Prep Phenyl 19?100 mm (5 ?m) column; mobile phase A: H.sub.2O (0.1% v/v TFA); mobile phase B: acetonitrile (0.1% v/v TFA); flow rate: 10 mL/min; initial=80% A, 13 min=0% A.

    [0508] HPLC elution method 3: Waters Acquity BEH C18 2.1?50 mm (1.7 ?m) column; mobile phase A: H.sub.2O (0.1% v/v TFA); mobile phase B: acetonitrile (0.1% v/v TFA); flow rate=0.3 mL/min; initial=90% A, 8 min=0% A, 10 min=0% A, 11 min=90% A, 12 min=90% A.

    [0509] HPLC elution method 4: Waters XBridge Prep C18 OBD 19?100 mm (5 ?m) column; mobile phase A: H.sub.2O (0.1% v/v TFA); mobile phase B: acetonitrile (0.1% v/v TFA); flow rate: 10 mL/min; initial=80% A, 3 min=80% A, 13 min=20% A, 18 min=0% A.

    [0510] HPLC elution method 5: Waters XBridge Prep C18 OBD 19?100 mm (5 ?m) column; mobile phase A: H.sub.2O (0.1% v/v TFA); mobile phase B: acetonitrile (0.1% v/v TFA); flow rate: 10 mL/min; initial=90% A, 3 min=90% A, 13 min=0% A, 20 min=0% A.

    [0511] HPLC elution method 6: Waters XBridge Prep C18 OBD 19?100 mm (5 ?m) column; mobile phase A: H.sub.2O (0.1% v/v TFA); mobile phase B: acetonitrile (0.1% v/v TFA); flow rate: 10 mL/min; initial=75% A, 13 min=0% A, 15 min=0% A.

    [0512] HPLC elution method 7: Waters XBridge Prep C18 OBD 19?100 mm (5 ?m) column; mobile phase A: H.sub.2O (0.1% v/v TFA); mobile phase B: acetonitrile (0.1% v/v TFA); flow rate: 10 mL/min; initial=80% A, 12 min=0% A, 15 min=0% A.

    [0513] HPLC elution method 8: Waters XBridge Prep C18 OBD 19?100 mm (5 ?m) column; mobile phase A: H.sub.2O (0.1% v/v TFA); mobile phase B: acetonitrile (0.1% v/v TFA); flow rate: 10 mL/min; initial=90% A, 12 min=0% A, 15 min=0% A.

    [0514] Analytical Size Exclusion Chromatography (SEC) can be performed using a Waters system comprised of a Waters 1525 Binary HPLC pump, a Waters 2489 UV/Visible Detector (monitoring at 280 nm), a Bioscan Flow Count radiodetector (FC-3300) and TOSOH TSKgel G3000SWx1, 7.8?300 mm column. The isocratic SEC method can have a flow rate of, e.g., mL/min, with a mobile phase of 0.1 M phosphate, 0.6 M NaCl, 0.025% sodium azide, pH=7.

    [0515] MALDI-MS (positive ion) can be performed using a MALDI Bruker Ultraflextreme Spectrometer.

    [0516] Radio thin-layer chromatography (radioTLC) can be performed with Bioscan AR-2000 Imaging Scanner, and can be carried out on iTLC-SG glass microfiber chromatography paper (Agilent Technologies, SGI0001) plates using citrate buffer (0.1 M, pH 5.5).

    Example 2. Synthesis of 4-{[11-oxo-11-(2,3,5,6-tetrafluorophenoxy)undecyl]carbamoyl}-2-[4,7,10-tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]butanoic acid (Compound B)

    [0517] A bifunctional chelate, 4-{[11-oxo-11-(2,3,5,6-tetrafluorophenoxy)undecyl]carbamoyl}-2-[4,7,10-tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]butanoic acid (Compound B), can be synthesized according to the scheme provided in FIG. 2. To a solution of 5-(tert-butoxy)-5-oxo-4-(4,7,10-tris(2-(tert-butoxy)-2-oxoethyl)-1,4,7,10-tetraazacyclododecan-1-yl)pentanoic acid (DOTA-GA-(tBu).sub.4, 50 mg, 0.07 mmol) in ACN (2.0 mL), DSC (50 mg, 0.21 mmol) is added, followed by pyridine, (0.20 mL, 2.48 mmol). The reaction is stirred at room temperature for 1 hour. To the reaction mixture is added 11-aminoundecanoic acid, (70 mg, 0.36 mmol) followed by PBS solution (1.0 mL) at room temperature. The reaction is stirred for 72 hours at room temperature. The reaction mixture is filtered with a syringe filter and purified directly by Prep-HPLC using method 6 to yield Intermediate 2-A.

    [0518] To a solution of Intermediate 2-A (40 mg, 0.03 mmol), TFP (90 mg, 0.54 mmol) and EDC (40 mg, 0.27 mmol) in ACN (1.0 mL) is added pyridine (0.05 mL, 50 mg, 0.62 mmol) at room temperature. The solution is stirred at room temperature for 24 hours. The reaction is purified directly by Prep-HPLC using method 7 to provide Intermediate 2-B as a wax after concentration using a Biotage V10 Rapid Evaporator.

    [0519] Intermediate 2-B is dissolved in DCM/TFA (1.0 mL/2.0 mL) and allowed to stir at room temperature for 24 hours. The reaction is concentrated by air stream and purified directly by Prep-HPLC using method 8 to yield Compound B as a clear wax after concentration. An aliquot is analyzed by HPLC-MS elution method 3.

    [0520] .sup.1H NMR (600 MHz, DMSO-d.sub.6) ?7.99-7.88 (m, 1H), 7.82 (t, J=5.5 Hz, 1H), 3.78 (broad s, 4H), 3.43 (broad s, 12H), 3.08 (broad s, 4H), 3.00 (m, 3H), 2.93 (broad s, 3H), 2.77 (t, J=7.2 Hz, 2H), 2.30 (broad s, 2H), 1.88 (broad s, 2H), 1.66 (p, J=7.3 Hz, 2H), 1.36 (m, 4H), 1.32-1.20 (m, 9H).

    Example 3. Synthesis of [.SUP.225.Ac]-Compound B-Anti-FGFR3 Conjugate

    [0521] Compound B (1 ?mole) is dissolved in a hydrochloric acid solution (0.001 M). An aliquot of Compound B solution (5 ?L, 70 nmole) is added to a solution containing an anti-FGFR3 antibody (1.8 nmoles) in a phosphate buffer (pH 8). After 3 hours at ambient temperature, the resulting immunoconjugate is purified via a Sephadex G-50 resin packed column. The immunoconjugate Compound B-anti-FGFR3 is eluted from the column with acetate buffer (pH 6.5).

    [0522] Ac-225 (15 ?Ci, 10 ?L) is added to a solution of Compound B-anti-FGFR3 (300 ?g in acetate buffer (pH 6.5). The radiolabeling reaction is incubated at 30? C. for 1 hour. The crude product, [.sup.225Ac]-Compound B-anti-FGFR3, is purified via a Sephadex G-50 resin packed column eluted with acetate buffer.

    Example 4. Synthesis of 4-{[2-(2-{2-[3-oxo-3-(2,3,5,6-tetrafluorophenoxy)propoxy]ethoxy}ethoxy)ethyl]carbamoyl}-2-[4,7,10-tris(carboxymethyl) -1,4,7,10-tetraazacyclododecan-1-yl]butanoic acid (Compound C)

    [0523] A bifunctional chelate, 4-{[2-(2- {2- [3-oxo-3-(2,3,5,6-tetrafluorophenoxy)propoxy]ethoxy}ethoxy)ethyl]carbamoyl}-2-[4,7,10-tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]butanoic acid (Compound C), is synthesized according to the scheme provided in FIG. 3.

    [0524] To a solution of 5-(tert-butoxy)-5-oxo-4-(4,7,10-tris(2-(tert-butoxy)-2-oxoethyl)-1,4,7,10-tetraazacyclododecan-1-yl)pentanoic acid (DOTA-GA(tBu).sub.4, 100 mg, 0.143 mmol) in ACN (8.0 mL) is added DSC (73 mg, 0.285 mmol) and pyridine (0.80 mL, 9.89 mmol). The reaction mixture is stirred for 90 min at ambient temperature. This solution is added to a semi-solution of amino-PEG3-acid (63 mg, 0.285 mmol in 1.2 mL of DMF) in a 100 mL round bottom flask. After 4 hours at ambient temperature, the reaction is worked up by concentrating to dryness under a stream of air. The crude material is purified by HPLC elution method 2 (dissolved the crude in 6 mL of 20% ACN/H.sub.2O). The fractions containing product are pooled and concentrated under vacuum and then co-evaporated with ACN (3?2 mL).

    [0525] To a vial containing Intermediate 1-A (82 mg, 60 ?mol) is added ACN (2 mL), NEt.sub.3 (50 ?L, 360 ?mol, 6 equiv.), HBTU (23 mg, 60 ?mol, 1 equiv.) and a TFP solution (50 mg, 300 ?mol, 5 equiv., dissolved in 250 ?L of ACN). The resulting clear solution is stirred at ambient temperature for 3 hours. The reaction is worked up by concentrating the solution to dryness under an air stream and is then diluted with ACN/H.sub.2O (1:1, 3 mL total) and purified on preparative HPLC using elution method 4. Fractions containing product are pooled and concentrated under vacuum and then co-evaporated with ACN (3?2 mL). Intermediate 1-B is obtained as a clear residue.

    [0526] To a vial containing Intermediate 1-B (67 mg, 64 ?mol) is added DCM (2 mL) and TFA (2 mL). The resulting solution is stirred at ambient temperature for 16 hour. Additional, TFA (2 mL) is added, and the reaction is stirred at ambient temperature for 6 hours. The reaction is concentrated to dryness under an air stream, with the crude product being finally dissolved in ACN/H.sub.2O (1 mL of 10% ACN/H.sub.2O). The crude reaction solution isthen purified by preparative HPLC using elution method 5. The fractions containing product are pooled, frozen and lyophilized. Compound C is obtained as a white solid . An aliquot is analyzed by HPLC-MS elution method 3.

    [0527] .sup.1H NMR (DMSO-d.sub.6, 600 MHz) ?7.97-7.91 (m, 2H), 3.77 (t, 2H, J=6.0 Hz), 3.58-3.55 (m, 2H), 3.53-3.48 (m, 8H), 3.44-3.38 (m, 10H), 3.23-3.08 (m, 11H), 3.02 (t, 2H, J=6.0 Hz), 2.93 (broad s, 4H), 2.30 (broad s, 2H), 1.87 (broad s, 2H).

    Example 5. Synthesis of [.SUP.225.Ac]-Compound C-Anti-FGFR3 Conjugate

    [0528] Compound C (1 ?mole) is dissolved in a hydrochloric acid solution (0.001 M). An aliquot of Compound C solution (5 ?L, 70 nmole) is added to a solution containing anti-FGFR3 antibody (1.8 nmoles) in a phosphate buffer (pH 8). After 3 hours at ambient temperature, the resulting immunoconjugate is purified via a Sephadex G-50 resin packed column. The immunoconjugate Compound C-anti-FGFR3 is eluted from the column with acetate buffer (pH 6.5). Identities of eluates can be confirmed by, e.g., MALDI-TOF.

    [0529] Ac-225 (15 ?Ci, 10 ?L) is added to a solution of Compound C-anti-FGFR3 (300 ?g in acetate buffer (pH 6.5). The radiolabeling reaction is incubated at 30? C. for 1 hour. The crude product, [.sup.225Ac]-Compound C-anti-FGFR3, is purified via a Sephadex G-50 resin packed column eluted with acetate buffer.

    Example 6. Synthesis of [.SUP.225.Ac]-DOTA-Anti-FGFR3 Conjugate

    [0530] ##STR00012##

    [0531] Compound C (1 ?mole) is dissolved in a hydrochloric acid solution (0.001 M). An aliquot of Compound C solution (5 ?L, 70 nmole) is added to a solution containing anti-FGFR3 antibody vofatamab (1.8 nmoles) in a phosphate buffer (pH 8). After 3 hours at ambient temperature, the resulting immunoconjugate is purified via a Sephadex G-50 resin packed column. The immunoconjugate Compound C-anti-FGFR3 is eluted from the column with acetate buffer (pH 6.5). Identities of eluates can be confirmed by, e.g., MALDI-TOF.

    [0532] Ac-225 (15 ?Ci, 10 ?L) is added to a solution of Compound C-anti-FGFR3 (300 ?g in acetate buffer (pH 6.5). The radiolabeling reaction is incubated at 30? C. for 1 hour. The crude product, [.sup.225Ac]-DOTA-anti-FGFR3, was purified via a Sephadex G-50 resin packed column eluted with acetate buffer. The purified compound was characterized by the analytical methods provided below. As shown in the structure above, FGFR3 antibody vofatamab is linked to the A-L moiety of Formula I-a via the side-chain amino group of a lysine residue.

    [0533] iTLC-SG plates (Agilent Technologies) were spotted with 1-2 uL of radioimmunoconjugate solution and eluted with 20 mM citrate+5% MeOH. Radioimmunoconjugates remained at the baseline while free Ac-225 moved with the solvent front. Plates were held for a minimum of 12 hours before scanning to allow formation of secular equilibrium. RadioTLC analysis was performed using an Eckert and Ziegler AR-2000 TLC Scanner using WinScan V3 software for analysis.

    [0534] Analytical SEC-HPLC performed using a Waters 1525 Binary HPLC pump, a Waters 2707 autosampler, a Waters 2489 dual wavelength UV/Visible Detector (280 nm with no baseline correction), and Eckert and Zeigler Radiodetector with a Waters E-SAT/IN module. Size exclusion chromatography was done using a TOSOH TSKgel G3000SW column (5 um, 7.8 mm ID?300 mm, no guard column) at a flow rate of 1 mL/min using 0.1 M phosphate buffered saline (pH 7) as mobile phase.

    [0535] Bruker UltrafleXtreme MALDI TOF/TOF with a Linear detector in Positive Ion Mode was used for MALDI-MS analysis. A saturated solution of sinapinic acid was prepared in TA30 solvent (30:70 [v/v] acetonitrile:0.1% TFA in water). The samples (0.3 mg/mL in 20 mM ammonium formate) were mixed in a 1:1 ratio with the matrix solution. 1 ?L was spotted on the plate and a protein solution of BSA was used as an external standard.

    Example 7. Synthesis of Radioimmunoconjugates Comprising Different Linkers

    [0536] Synthesis of [.sup.225Ac]-DOTA-Anti-FGFR3-I

    ##STR00013##

    [0537] DOTAGA anhydride (1 ?mole) is dissolved in an acetate buffer solution (pH 6.5). An aliquot of DOTAGA anhydride solution (5 ?L, 70 nmole) is added to a solution containing anti-FGFR3 antibody vofatamab (5 nmoles) in an acetate buffer (pH 9). After 1 hour at ambient temperature, the resulting immunoconjugate is purified via a Sephadex G-50 resin packed column. The immunoconjugate DOTAGA-anti-FGFR3 is eluted from the column with acetate buffer (pH 6.5). Identities of eluates can be confirmed by, e.g., MALDI-TOF.

    [0538] Ac-225 (15 ?Ci, 10 ?L) is added to a solution of DOTAGA-anti-FGFR3 (300 ?g in acetate buffer (pH 6.5). The radiolabeling reaction is incubated at 35? C. for 1 hour. The crude product, [.sup.225Ac]-DOTA-anti-FGFR3-I, was purified via a Sephadex G-50 resin packed column eluted with acetate buffer. The purified compound was characterized by the analytical methods described in Example 6.

    Synthesis of [.SUP.225.Ac]-DOTA-Anti-FGFR3-II

    [0539] ##STR00014##

    [0540] Compound B (1 ?mole) is dissolved in a hydrochloric acid solution (0.001 M). An aliquot of Compound B solution (5 ?L, 70 nmole) is added to a solution containing anti-FGFR3 antibody vofatamab (1.8 nmoles) in a phosphate buffer (pH 8). After 3 hours at ambient temperature, the resulting immunoconjugate is purified via a Sephadex G-50 resin packed column. The immunoconjugate Compound B-anti-FGFR3 is eluted from the column with acetate buffer (pH 6.5).

    [0541] Ac-225 (15 ?Ci, 10 ?L) is added to a solution of Compound B-anti-FGFR3 (300 ?g in acetate buffer (pH 6.5). The radiolabeling reaction is incubated at 30? C. for 1 hour. The crude product, [.sup.225Ac]-DOTA-anti-FGFR3-II, was purified via a Sephadex G-50 resin packed column eluted with acetate buffer. The purified compound was characterized by the analytical methods described in Example 6.

    Example 8. Effects of [.SUP.225.Ac]-Anti-FGFR3 Conjugates on Tumor Growth and Survival in a Bladder Cancer Xenograft Model

    [0542] [.sup.225Ac]-anti-FGFR3 conjugates are tested using the human UM-UC-1 bladder cell line, which expresses wild type FGFR3. UM-UC-1 cells are injected into immunocompromised mice. After the establishment of tumors, mice are administered an [.sup.225Ac]-anti-FGFR3 conjugate, control (e.g., PBS buffer or other vehicle alone), or optionally unconjugated anti-FGFR3.

    [0543] Tumor volume is monitored twice weekly using caliper measurements, and the results are compared across treatment groups. Survival is recorded. Greater inhibition of tumor growth and/or greater survival in [.sup.225Ac]-anti-FGFR3 conjugate treatment groups indicates increased efficacy.

    Example 9. Effects of [.SUP.225.Ac]-Anti-FGFR3 Conjugates on Tumor Growth and Survival in WT and Mutant FGFR3 Bladder Cancer Xenograft Models

    [0544] While wild-type FGFR3 is overexpressed in certain cancers, some tumors are associated with mutant FGFR3. In this Example, [.sup.225Ac]-anti-FGFR3 conjugates are tested using various human bladder cell lines that express either wild type or mutant FGFR3.

    [0545] RT112 bladder cancer cells, which express WT FGFR3, are injected into nude (nu/nu) mice, and tumors are allowed to grow to a mean volume of ?100-150 mm.sup.3. Animals are dosed twice weekly with vehicle or with an [.sup.225Ac]-anti-FGFR3 conjugate. Optionally, a third set of animals are dosed with unconjugated anti-FGFR3.

    [0546] Tumors are measured twice weekly using a caliper, and tumor volume is calculated using the formula:


    V=0.5?a?b.sup.2

    wherein a and b are the length and width of the tumor, respectively.

    [0547] Tumor growth is compared across groups.

    [0548] To assess the effects of [.sup.225Ac]-anti-FGFR3 conjugates on FGFR3 signaling, tumor lysates are collected at 48 and 72 hour after treatment. Phosphorylation and total protein levels of FRS2?, AKT, and p44/42 MAPK (downstream mediators of FGFR3 signaling) in tumor lysates are examined.

    [0549] Additionally, effects of [.sup.225Ac]-anti-FGFR3 conjugates are studied in a Ba/F3-FGFR3.sup.S249C allograft model. See, e.g., Qing et al., Antibody-based targeting of FGFR3 in bladder carcinoma and t(4;14)-positive multiple myeloma in mice. J Clin Invest. 2009 May 1; 119(5): 1216-1229. (S249C is the most frequent FGFR3 mutation found in bladder cancer.) Tumor growth and tumor lysates are assessed as mentioned above for the RT112 xenograft model.

    Example 10. Effects of [.SUP.225.Ac]-Anti-FGFR3 Conjugates on Tumor Growth and Survival in Multiple Myeloma Xenograft Models

    [0550] OPM2 and KMS11 are t(4:14)+multiple myeloma cell lines harboring K650E Y373C FGFR3 mutations, respectively. [.sup.225Ac]-anti-FGFR3 conjugates are tested in OPM2 and KMS11 xenograft models. Cells are expanded, and 15?10.sup.6 OPM2 or 20?10.sup.6 KMS11 cells are implanted subcutaneously into the flanks of mice in a volume of 0.2 ml in Hank's Balanced Salt Solution (HBSS)/Matrigel (1:1 v/v: BD Biosciences). Tumors are measured twice weekly as a caliper, and tumor volume is calculated as described in Example 9.

    [0551] When tumors reach an average size of 150-200 mm.sup.3, animals are randomly assigned to a treatment or control group. Each [.sup.225Ac]-anti-FGFR3 conjugate may be tested in a separate treatment group. A control group may include mice administered HBSS or other vehicle. Optionally, for comparison, one or more treatment groups are included in which mice are administered unconjugated anti-FGFR3 (cold antibody). Mice in all groups are administered the relevant agents for their group twice weekly intraperitoneally.

    [0552] Tumor volume is monitored twice weekly using caliper measurements, and the results are compared across treatment groups. Survival is recorded. Greater inhibition of tumor growth and/or greater survival in [.sup.225Ac]-anti-FGFR3 conjugate treatment groups indicates increased efficacy.

    Example 11. Effects of [.SUP.225.Ac]-Anti-FGFR3 Conjugates on Tumor Growth and Survival in a Liver Cancer Xenograft Model

    [0553] [.sup.225Ac]-anti-FGFR3 conjugates are tested in a tumor xenograft model based on a liver cancer cell line (Huh7) essentially as described in Example 10.

    Example 12. Effects of [.SUP.225.Ac]-Anti-FGFR3 Conjugates on Tumor Growth and Survival in a Breast Cancer Xenograft Model

    [0554] [.sup.225Ac]-anti-FGFR3 conjugates are tested in a tumor xenograft model based on a breast cancer cell line (Cal-51) essentially as described in Example 10.

    Example 13. Effects of [.SUP.225.Ac]-Anti-FGFR3 Conjugates on Tumor Growth and Survival in a Colon Adenocarcinoma Xenograft Model

    [0555] [.sup.225Ac]- anti-FGFR3 conjugates are tested in the MC38 mouse colon adenocarcinoma xenograft model. FGFR3-positive MC38 cells are expanded, and 1?10.sup.6 MC38 cells are implanted subcutaneously into the flanks of female C57BL/6 mice that are 8 to 12 weeks of age. When tumors reach an average size of 80-120 mm.sup.3, animals are pair matched and assigned to a treatment or control group. Each [.sup.225Ac]-anti-FGFR3 conjugate may be tested in a separate treatment group. A control group may include mice administered phosphate-buffered saline (PBS). Optionally, for comparison, one or more treatment groups are included in which mice are administered unconjugated anti-FGFR3 (cold antibody). Mice in all groups may be administered the relevant agents for their group according to a regular schedule, e.g., weekly, twice a week, or thrice per week, for one or more (e.g., 1, 2, or 3) weeks intravenously or intraperitoneally.

    [0556] Tumor volume is monitored twice weekly using caliper measurements, and the results are compared across treatment groups. Survival is recorded. Greater inhibition of tumor growth and/or greater survival in [.sup.225Ac]-anti-FGFR3 conjugate treatment groups indicates increased efficacy.

    Example 14. Effects of [.SUP.225.Ac]-Anti-FGFR3 Conjugates on Immune Cell Infiltration Using an Adenocarcinoma Cell Line

    [0557] MC38 (adenocarcinoma) cells are implanted subcutaneously into the flanks of female C57BL/6 mice that are 8 to 12 weeks of age. When tumors reach an average size of 80-120 mm.sup.3, animals are pair matched and divided into treatment and control group. A control group of mice receive PBS, immunoconjugate treatment group(s) receive [.sup.225Ac]-anti-FGFR3 conjugates, and optional antibody treatment group(s) receive unconjugated anti-FGFR3. All groups are administered according to the same route and dosing schedule: twice weekly intravenously.

    [0558] After 7 days of treatment, half of the animals from each group are sacrificed, and tumors are collected. After 14 days of treatment, the remaining half of animals in each group are sacrificed, and tumors are collected. Half of each tumor is processed for paraffin embedding, while the other half is used to prepare a single cell suspension for flow cytometry analyses. Samples for flow cytometry analyses are stained for CD8 and for markers of T-regulatory cells. Higher ratios of CD8+ to regulatory T cells may indicate enhanced efficacy via immune cell infiltration into tumors.

    Example 15. Effects of [.SUP.225.Ac]-Anti-FGFR3 Conjugates on Lung Tumor Development

    [0559] [.sup.225Ac]-anti-FGFR3 conjugates are tested in two mouse lung cancer xenograft models: Madison 109 (M109) and Lewis Lung Carcinoma cells, both of which are FGFR3-positive. 1?10.sup.6 Lewis Lung Carcinoma tumor cells are implanted subcutaneously into flanks of female C57BL/6 mice that are 8 to 12 weeks of age. Additionally, 1?10.sup.6 Madison 109 tumor cells are implanted subcutaneously into the flanks of CR female BALB/c mice that are 8 to 12 weeks of age.

    [0560] When tumors reach an average size of 100-200 mm.sup.3, animals are pair matched and treatment is initiated. Each [.sup.225Ac]-anti-FGFR3 conjugate may be tested in a separate treatment group. A control group may include mice administered phosphate-buffered saline (PBS). Optionally, for comparison, one or more treatment groups are included in which mice are administered unconjugated anti-FGFR3 (cold antibody). Mice in all groups may be administered (intravenously or intraperitoneally) the relevant agents for their group according to a regular schedule, e.g., weekly, twice a week, or thrice per week. In this example, mice are treated for one, two, or three weeks (see below).

    [0561] Tumors are measured using calipers twice weekly, and the results are compared across treatment groups. Greater inhibition of tumor growth in [.sup.225Ac]-anti-FGFR3 conjugate treatment groups indicates increased efficacy.

    [0562] After 7 days of treatment, some of the animals from each group are sacrificed, and tumors are collected. After 14 days of treatment, some of the remaining animals in each group are sacrificed, and tumors are collected. The remaining animals continue to be dosed until day 21, at which time they are sacrificed and their tumors are collected. Half of each tumor is processed for paraffin embedding, while the other half is frozen in Optimal Cutting Temperature (O.C.T.) compound.

    Example 16. Effects of [.SUP.225.Ac]-Anti-FGFR3 Conjugates on Survival

    [0563] Example 14 and/or Example 15 is performed, except that mice are not sacrificed and are instead monitored for tumor growth and survival over a period of at least months. Enhanced survival in [.sup.225Ac]-anti-FGFR3 conjugate treatment groups indicates enhanced therapeutic efficacy.

    Example 17. Effects of [.SUP.225.Ac]-Anti-FGFR3 Conjugates on Tumor Growth and Survival in a Bladder Cancer Cell Lines Involving FGFR3 Fusions

    [0564] [.sup.225Ac]-anti-FGFR3 conjugates are tested in a tumor xenograft models based on one or more of the RT4, RT112, SW780, and UMUC-14 bladder cell lines, essentially as described in Example 10. RT4 and RT112 cells contain an FGFR3-TACC3 fusion, SW780 cells contain an FGFR- BAIAP2L1 fusion, and UMUC-14 harbors an FGFR3.sup.S249C.

    Example 18. Binding of DOTA-Anti-FGFR3 Conjugate to Cancer Cells Expressing FGFR3

    [0565] The present Example demonstrates binding of conjugated anti-FGFR3 to FGFR3-positive cancer cells at subnanomolar/picomolar Kd ranges.

    [0566] An unlabeled DOTA-anti-FGFR3 conjugate was synthesized using 1) a pure R enantiomer of Compound C (see Example 4) (that is, an R-enantiomer of a (2R)-2-[4,7,10-tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentanedioic acid (R-DOTA-GA), connected through a PEG3 acid linker to a 2,3,5,6-tetrafluorophenol active ester) and 2) MFGR1877S (vofatamab), an anti-FGFR3 antibody. Binding of DOTA-anti-FGFR3 to FGFR3-positive cancer cell lines RT4 (bladder), RT112 (bladder), and HepG2 (liver) was assessed by flow cytometry.

    [0567] FIGS. 4A, 4B, and 4C show the binding curves for RT4, RT112, and HepG2, respectively, and the corresponding binding affinities (Kd) are summarized in Table 2.

    TABLE-US-00006 TABLE 2 Binding affinities of anti-FGFR3 conjugate to FGFR3+ cancer cells Kd [nM] Kd [nM] Kd [nM] RT4 RT112 HepG2 Anti-FGFR3 conjugate 0.448 0.248 0.279

    Example 19. In Vivo Biodistribution of [.SUP.177.Lu]-DOTA-Anti-FGFR3 Conjugate

    [0568] A Balb/c nude/RT4 cell line xenograft mouse model was used to assess the in vivo biodistribution of a radiolabeled anti-FGFR3 conjugate. A [.sup.177Lu]-DOTA-anti-FGFR3 conjugate was synthesized using a pure R enantiomer of Compound C (see Example 4), MFGR1877S (vofatamab), and lutetium-177.

    [0569] Groups of tumor-bearing animals were injected intravenously with [.sup.177Lu]-DOTA-anti-FGFR3. Doses contained about 23 microcuries (?Ci) of activity on 2 ?g (0.1 mg/kg) of antibody. Animals were euthanized at 4 h, 24 h, 48 h, 96 h, and 168 h after injection to determine levels of radioactivity in the blood, kidney, liver, lungs, spleen, skin, tumor, and tail (n=3 per time point).

    [0570] Results were expressed as the percentage injected dose per gram of tissue (% ID/g) and are depicted in FIG. 5. [.sup.177Lu]-DOTA-anti-FGFR3 cleared rapidly from the blood and demonstrated transient uptake in the liver, lungs, and spleen. Tumor uptake was about 5% ID/g at all time points. Without wishing to be bound by any particular theory, the observed level of tumor uptake could be attributable to the small size of the RT4 tumors (about 50 mm.sup.3).

    Example 20. In Vivo Biodistribution of [.SUP.177.Lu]-DOTA-Anti-FGFR3 Conjugate after Pre-Dosing with Cold Anti-FGFR3

    [0571] The present Example demonstrates that pre-dosing with cold anti-FGFR3 results in improved uptake of FGFR3-targeted radioimmunoconjugates in tumor cells and reduced levels of uptake in normal tissues.

    [0572] A Balb/c nude/RT112 cell line xenograft mouse model was used to assess the in vivo biodistribution of [.sup.177Lu]-DOTA-anti-FGFR3 after pre-dosing with cold (non-radiolabeled, unconjugated) anti-FGFR3 antibody.

    [0573] Groups of tumor-bearing mice were injected intravenously with [.sup.177Lu]-DOTA-anti-FGFR3. Doses contained about 23 microcuries (?Ci) of activity on 2 ?g (0.1 mg/kg) of antibody. Approximately three hours before administration of [.sup.177Lu]-DOTA-anti-FGFR3, half of the mice were administered 100 ?g cold anti-FGFR3 (vofatamab) by intraperitoneal injection. Animals were euthanized at 4 h, 24 h, 48 h, and 96 h after injection to determine levels of radioactivity in the blood, intestine (small and large), kidney and adrenal glands, liver and gall bladder, lungs, spleen, skin, bladder, urine, and tumor (n=3 per time point).

    [0574] Results were expressed as the % ID/g and are depicted in FIGS. 6A and 6B. Pre-dosing with cold anti-FGFR3 reduced clearance of radioactivity from the blood, reduced uptake of [.sup.177Lu]-DOTA-anti-FGFR3 in normal tissues, and increased uptake of [.sup.177Lu]-DOTA-anti-FGFR3 in tumors.

    Example 21. In Vivo Biodistribution of Radiolabeled Anti-FGFR3 Conjugates Co-Dosed with Cold Anti-FGFR3

    [0575] The present Example demonstrates that co-dosing with cold anti-FGFR3 results in improved uptake of FGFR3-targeted radioimmunoconjugates in tumor cells and reduced levels of uptake in normal tissues. Moreover, the present Example demonstrates that DOTA-anti-FGFR3 conjugates labeled with different radionuclides exhibit similar biodistribution profiles.

    [0576] DOTA-anti-FGFR3 conjugate was synthesized using a pure R enantiomer of Compound C (see Example 4), MFGR1877S (vofatamab), and indium-111.

    [0577] A Balb/c nude/RT112 cell line xenograft mouse model was used to assess the in vivo biodistribution of [.sup.177Lu]-DOTA-anti-FGFR3 conjugate and [.sup.111In]-DOTA-anti-FGFR3 conjugates when co-dosed with cold anti-FGFR3.

    [0578] Groups of tumor-bearing mice were injected intravenously with [.sup.177Lu]-DOTA-anti-FGFR3 at about 22 microcuries (?Ci) of activity on 2 ?g (0.1 mg/kg) of antibody. Mice were also co-administered 50, 100, or 200 ?g of cold anti-FGFR3 via the same intravenous injection. Animals were euthanized at 24 h and 96 h after injection to determine levels of radioactivity in the blood, intestine, kidney, liver, lungs, spleen, skin, bladder, urine, and tumor (n=3 per time point).

    [0579] Results were expressed as the % ID/g and depicted in FIGS. 7A-7C. Co-dosing with 100 ?g or 200 ?g cold anti-FGFR3 reduced clearance of radioactivity from the blood, reduced uptake of [.sup.177Lu]-DOTA-anti-FGFR3 in normal tissues, and increased uptake of [.sup.177Lu]-DOTA-anti-FGFR3 in tumors.

    [0580] A biodistribution study was also performed using [.sup.111In]-DOTA-anti-FGFR3 co-dosed with 100 ?g of cold anti-FGFR3, similarly as described for the [.sup.177Lu]-DOTA-anti-FGFR3 co-dosing experiment in this Example. FIGS. 8A and 8B show the results % ID/g in mice administered [.sup.177Lu]-DOTA-anti-FGFR3 (FIG. 8A) or [.sup.111In]-DOTA-anti-FGFR3 (FIG. 8B), each co-dosed with cold anti-FGFR3. Both [.sup.177Lu]-DOTA-anti-FGFR3 and [.sup.111In]-DOTA-anti-FGFR3 showed good tumor uptake with about 34% - 37% ID/g at 96 h after dosing.

    Example 22. Effects of [.SUP.225.Ac]-DOTA-Anti-FGFR3 Conjugate on Tumor Growth and Survival in a Bladder Cancer Xenograft Model

    [0581] The present Example demonstrates therapeutic efficacy of an [.sup.225Ac]-DOTA-anti-FGFR3 conjugate (structure as shown in FIG. 1C) in a bladder cancer model. Moreover, the present Example demonstrates that with a regimen including pre-dosing with cold anti-FGFR3, treatment with [.sup.225Ac]-DOTA-anti-FGFR3 conjugate was not only effective but well-tolerated, with limited observed toxicity.

    [0582] A [.sup.225Ac]-DOTA-anti-FGFR3 conjugate was synthesized using a pure R enantiomer of Compound C (see Example 4), MFGR1877S (vofatamab), and actinium-225.

    [0583] A Balb/c nude/RT112 cell line xenograft mouse model was used to assess the in vivo activity of [.sup.225Ac]-DOTA-anti-FGFR3 conjugate after pre-dosing with cold anti-FGFR3. Tumors were grown subcutaneously to about 150 mm.sup.3 in volume. Groups of tumor-bearing mice were injected intravenously with [.sup.225Ac]-DOTA-anti-FGFR3 (50 nCi, 100 nCi, 200 nCi, or 400 nCi doses), cold anti-FGFR3, or vehicle controls (n=5 per group). Except for mice in a control group, 3 hours before administration of [.sup.225Ac]-DOTA-anti-FGFR3, mice were injected intraperitoneally with 100 ?g cold anti-FGFR3. Relative tumor volume (FIG. 9A) and relative body weights (FIG. 9B) were evaluated up to 28 days after administration.

    [0584] As shown in FIG. 9A, treatment with 200 nCi or 400 nCi [.sup.225Ac]-DOTA-anti-FGFR3 significantly inhibited tumor growth. One mouse in the 400 nCi group lost 30% of its body weight and was sacrificed on Day 11. However, as shown in FIG. 9B, on average, mice in treatment groups did not demonstrate significant weight loss relative to mice in control groups, suggesting that the treatment was tolerated and that toxicity was limited.

    Example 23. Effects of [.SUP.225.Ac]-DOTA-anti-FGFR3 Conjugates on Tumor Growth and Survival in a Bladder Cancer Xenograft Model

    [0585] The present Example demonstrates therapeutic efficacy of an [.sup.225Ac]-DOTA-anti-FGFR3 conjugate (structure as shown in FIG. 1C) in a bladder cancer model. Moreover, the present Example demonstrates that with a regimen including co-dosing with cold anti-FGFR3, treatment with [.sup.225Ac]-DOTA-anti-FGFR3 conjugate was not only effective but well-tolerated, with limited observed toxicity, in at least some treatment groups.

    [0586] A Balb/c nude/RT112 cell line xenograft mouse model was used to assess the in vivo activity of [.sup.225Ac]-DOTA-anti-FGFR3 conjugate with co-dosing of cold anti-FGFR3. Tumors were allowed to grow subcutaneously to about 150 mm.sup.3 in volume. Groups of tumor bearing mice were injected intravenously with [.sup.225Ac]-DOTA-anti-FGFR3 (50 nCi, 100 nCi, 200 nCi, or 400 nCi) co-dosed with 100 ?g anti-FGFR3. Control groups received cold anti-FGFR3 only or a vehicle control. n=5 per group. Relative tumor volume (FIG. 10A) and relative body weights (FIG. 10B) were evaluated up to 28 days after administration.

    [0587] As shown in FIG. 10A, treatment with 200 nCi or 400 nCi [.sup.225Ac]-DOTA-anti-FGFR3 significantly inhibited tumor growth, and treatment with lower doses (50-100 nCi) of [.sup.225Ac]-DOTA-anti-FGFR3 resulted in some inhibition of tumor growth.

    [0588] In the 400 nCi treatment group, two mice lost significant weight and were sacrificed, and the other three mice were not affected. However, mice in the other treatment groups did not demonstrate significant weight loss relative to mice in control groups. (See FIG. 10B.)

    Example 24. In Vivo Biodistribution of Radiolabeled Anti-FGFR3 Conjugates Co-Dosed with Cold Anti-FGFR3 in a Bladder Cancer Xenograft UM-UC-1 Model

    [0589] The present Example demonstrates that co-dosing with cold anti-FGFR3 results in improved uptake of FGFR3-targeted radioimmunoconjugates in tumor cells and reduced levels of uptake in normal tissues.

    [0590] A human bladder transitional cell carcinoma cell line (UM-UC-1) xenograft mouse model was used to assess the in vivo biodistribution of [.sup.177Lu]-DOTA-anti-FGFR3 conjugate when co-dosed with cold anti-FGFR3 at dosages of 100 ?g (or 5 mg/kg) and 200 ?g (or 10 mg/kg). Groups of tumor-bearing mice were injected intravenously with [.sup.177Lu]-DOTA-anti-FGFR3 at about 22 microcuries (?Ci) of activity on 2 ?g (0.1 mg/kg) of antibody and co-dosed with either 100 ?g (5 mg/kg) or 200 ?g (10 mg/kg) of cold anti-FGFR3 antibody vofatamab. Animals were euthanized at 4 h, 24 h, 48 h, 96 h, and 168 h after injection to determine levels of radioactivity in the blood, intestine, kidney, liver, lungs, spleen, skin, and tumor (n=3 per time point).

    [0591] Results were expressed as the % ID/g and depicted in FIG. 11. Co-dosing with 100 ?g or 200 ?g cold anti-FGFR3 reduced clearance of radioactivity from the blood, reduced uptake of [.sup.177Lu]-DOTA-anti-FGFR3 in normal tissues, and increased uptake of [.sup.177Lu]-DOTA-anti-FGFR3 in tumors. Moreover, superior blood exposure and tumor uptake at 168 h was demonstrated with 200 ?g of cold anti-FGFR3 antibody as compared to 100 ?g. For example, [.sup.177Lu]-DOTA-anti-FGFR3 showed good tumor uptake with about 20% - 25% ID/g at 168 h after dosing in the bladder cancer xenograft UM-UC-1 model.

    Example 25. Effects of [.SUP.225.Ac]-DOTA-Anti-FGFR3 Conjugates on Tumor Growth and Survival in a Bladder Cancer Xenograft UM-UC-1 Model

    [0592] The present Example demonstrates therapeutic efficacy of an [.sup.225Ac]-DOTA-anti-FGFR3 conjugate (structure as shown in FIG. 1C) administered in a single vs multi-dose mode in a bladder cancer UM-UC-1 xenograft model. Moreover, the present Example demonstrates that with a regimen including co-dosing with cold anti-FGFR3 antibody vofatamab, treatment with [.sup.225Ac]-DOTA-anti-FGFR3 conjugate was not only effective but well-tolerated.

    [0593] UM-UC-1 cell line xenograft mouse model was used to assess the in vivo activity of [.sup.225Ac]-DOTA-anti-FGFR3 conjugate with co-dosing of 200 ?g (10 mg/kg) of cold anti-FGFR3 antibody. Tumors were allowed to grow subcutaneously to about 150 mm.sup.3 in volume. Groups of tumor-bearing mice were injected intravenously with [.sup.225Ac]-DOTA-anti-FGFR3 (50 nCi, 100 nCi, 200 nCi, or 400 nCi) co-dosed with 200 ?g cold anti-FGFR3 antibody (vofatamab). Control groups received cold anti-FGFR3 only or a vehicle control. n=5 per group. Relative tumor volumes (FIG. 12) were evaluated up to 62 days after administration.

    [0594] As shown in FIG. 12, treatment with 400 nCi [.sup.225Ac]-DOTA-anti-FGFR3 at the single-dosing regimen significantly inhibited tumor growth, and treatment with lower doses (50-200 nCi) of [.sup.225Ac]-DOTA-anti-FGFR3 resulted in little or no inhibition of tumor growth. Interestingly, treatment with multi-dosing regimens at lower doses (50 nCi?4 doses; 100 nCi?4 doses; 200 nCi?2 doses) of [.sup.225Ac]-DOTA-anti-FGFR3 all resulted in significant inhibition of tumor growth, demonstrating superior therapeutic efficacy as compared to single doses at 50 nCi, 100 nCi and 200 nCi. Furthermore, no toxicity was observed in the treatment groups with multi-dosing regimen.

    Example 26. In Vivo Biodistribution of Radiolabeled Anti-FGFR3 Conjugates Co-Dosed with Cold Anti-FGFR3 in a Bladder Cancer Xenograft RT112 Model

    [0595] The present Example demonstrates that co-dosing with cold anti-FGFR3 results in improved uptake of FGFR3-targeted radioimmunoconjugates in tumor cells and reduced levels of uptake in normal tissues.

    [0596] A Balb/c nude/RT112 cell line xenograft mouse model was used to assess the in vivo biodistribution of [.sup.177Lu]-DOTA-anti-FGFR3 conjugate when co-dosed with cold anti-FGFR3 at dosages of 100 ?g (or 5 mg/kg) and 200 ?g (or 10 mg/kg). Groups of tumor-bearing mice were injected intravenously with [.sup.177Lu]-DOTA-anti-FGFR3 at about 22 microcuries (?Ci) of activity on 2 ?g (0.1 mg/kg) of antibody and co-dosed with 100 ?g (5 mg/kg) or 200 ?g (10 mg/kg) of cold anti-FGFR3 antibody vofatamab. Animals were euthanized at 4 h, 24 h, 48 h, 96 h, and 168 h after injection to determine levels of radioactivity in the blood, intestine, kidney, liver, lungs, spleen, skin, and tumor (n=3 per time point).

    [0597] Results were expressed as the % ID/g and depicted in FIG. 13. Co-dosing with 100 ?g or 200 ?g cold anti-FGFR3 reduced clearance of radioactivity from the blood, reduced uptake of [.sup.177Lu]-DOTA-anti-FGFR3 in normal tissues, and increased uptake of [.sup.177Lu]-DOTA-anti-FGFR3 in tumors. Superior blood exposure and tumor uptake at 168 h was demonstrated with 200 ?g of cold anti-FGFR3 antibody as compared to 100 ?g. For example, [.sup.177Lu]-DOTA-anti-FGFR3 showed excellent tumor uptake with about 50% - 55% ID/g at 168 h after dosing in the bladder cancer xenograft RT112 model.

    Example 27. Effects of [.SUP.225.Ac]-DOTA-Anti-FGFR3 Conjugates on Tumor Growth and Survival in a Bladder Cancer Xenograft RT112 Model

    [0598] The present Example demonstrates therapeutic efficacy of an [.sup.225Ac]-DOTA-anti-FGFR3 conjugate (structure as shown in FIG. 1C) administered in a single vs multi-dose mode in a bladder cancer RT112 xenograft model. Moreover, the present Example demonstrates that with a regimen including co-dosing with cold anti-FGFR3 antibody vofatamab, treatment with [.sup.225Ac]-DOTA-anti-FGFR3 conjugate was not only effective but well-tolerated.

    [0599] A Balb/c nude/RT112 cell line xenograft mouse model was used to assess the in vivo activity of [.sup.225Ac]-DOTA-anti-FGFR3 conjugate with co-dosing of 200 ?g (10 mg/kg) of cold anti-FGFR3 antibody. Tumors were allowed to grow subcutaneously to about 150 mm.sup.3 in volume. Groups of tumor-bearing mice were injected intravenously with [.sup.225Ac]-DOTA-anti-FGFR3 (100 nCi, 200 nCi, or 400 nCi) co-dosed with 200 ?g cold anti-FGFR3 antibody (vofatamab). A vehicle control was used. n=5 per group. Relative tumor volumes (FIG. 14) were evaluated up to 62 days after administration.

    [0600] As shown in FIG. 14, treatment with 400 nCi [.sup.225Ac]-DOTA-anti-FGFR3 at the single-dosing regimen significantly inhibited tumor growth, and treatment with 100 nCi of [.sup.225Ac]-DOTA-anti-FGFR3 resulted in little inhibition of tumor growth, while treatment with 200 nCi of [.sup.225Ac]-DOTA-anti-FGFR3 resulted in significant inhibition of tumor growth for the first 25 days followed by tumor recurrence thereafter. Interestingly, treatment with multi-dosing regimens at lower doses (100 nCi?4 doses; 200 nCi?2 doses) of [.sup.225Ac]-DOTA-anti-FGFR3 resulted in significant inhibition of tumor growth, thereby demonstrating superior therapeutic efficacy as compared to single doses at 100 nCi and 200 nCi. Furthermore, no toxicity was observed in the treatment groups with multi-dosing regimen.

    Example 28. Effects of FGFR3 Radioimmunoconjugates Comprising Different Linkers on Tumor Growth and Survival in a Bladder Cancer Xenograft RT112 Model

    [0601] The present Example demonstrates therapeutic efficacy of three FGFR3 radioimmunoconjugates, i.e., [.sup.225AC]-DOTA-anti-FGFR3, [.sup.225Ac]-DOTA-anti-FGFR3-I, and [.sup.225Ac]-DOTA-anti-FGFR3-II, each administered in a single dosing mode with a regimen including co-dosing with cold anti-FGFR3 antibody in a bladder cancer RT112 xenograft model. Moreover, the present Example demonstrates that with a regimen including co-dosing with cold anti-FGFR3 antibody vofatamab, treatment with three conjugates comprising different linkers were all therapeutically effective.

    [0602] A Balb/c nude/RT112 cell line xenograft mouse model was used to assess the in vivo activity of three different [.sup.225Ac]-DOTA-anti-FGFR3 conjugates with co-dosing of cold anti-FGFR3 antibody. Tumors were allowed to grow subcutaneously to 100 mm.sup.3 in volume. Groups of tumor-bearing mice were injected intravenously with [.sup.225Ac]-DOTA-anti-FGFR3, [.sup.225Ac]-DOTA-anti-FGFR3-I and [.sup.225Ac]-DOTA-anti-FGFR3-II at 200 nCi and 400 nCi, when co-dosed with 200 ?g of anti-FGFR3 cold antibody vofatamab. Control group was treated with a vehicle only. Relative tumor volume was evaluated up to 32 days after administration (FIGS. 15A and 15B).

    [0603] As shown in FIG. 15A, treatment with 200 nCi of [.sup.225Ac]-DOTA-anti-FGFR3 resulted in the most pronounced tumor regression, followed by tumor regrowth after day 20. Treatment with 200 nCi of [.sup.225Ac]-DOTA-anti-FGFR3-I led to tumor stabilization, followed by regrowth, whereas treatment with 200 nCi of [.sup.225Ac]-DOTA-anti-FGFR3-II did not have a durable therapeutic effect. As shown in FIG. 15B, treatment with 400 nCi of the above three [.sup.225Ac]-DOTA-anti-FGFR3 conjugates resulted in a comparable therapeutic efficacy, leading to durable tumor regression in all cases.

    OTHER EMBODIMENTS

    [0604] While the invention has been described in connection with specific embodiments thereof, it will be understood that it is capable of further modifications and this application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the present disclosure that come within known or customary practice within the art to which the invention pertains and may be applied to the essential features herein before set forth.