DIAGNOSTIC METHOD FOR INFECTIOUS DISEASES
20240142444 ยท 2024-05-02
Inventors
- Lance Liotta (Fairfax, VA, US)
- Marissa A. Howard (Fairfax, VA, US)
- Alessandra Luchini Kunkel (Fairfax, CA, US)
- Sameen Yusuf (Fairfax, VA, US)
- Sara Sharif (Fairfax, VA, US)
- Ruben MAGNI (Fairfax, VA, US)
Cpc classification
International classification
Abstract
The invention relates to a relates to a highly sensitive, non-invasive diagnostic method for detection infectious diseases. In one embodiment, the invention relates to novel rapid, self-working, visual field test for a panel of disease specific derived biomarkers. In one embodiment, the invention comprises a collecting device comprising a collapsible non hygroscopic net tethered with immobilized nanoparticles to capture and concentrate a target analyte present in a fluid; wherein the nanoparticle comprises a core and a shell, wherein the core comprises a molecular bait. The invention also relates to identification of biomarkers for identification of various pathogenic diseases.
Claims
1. A nanoparticle comprising a core and a shell, wherein the core comprises a molecular bait, and wherein the nanoparticle is configured to capture a biomolecule, a nucleic acid, an exosome, and/or a virus.
2. (canceled)
3. The nanoparticle of claim 1, wherein the capture of the biomolecule, the nucleic acid, an exosome, and/or the virus is from a fluid sample comprising urine, blood, and/or saliva.
4. The nanoparticle of claim 3, wherein the capture is achieved by sequestering target analytes from a whole volume of the urine, the blood, and/or the saliva and bringing the target analytes into a small volume within the nanoparticle.
5. The nanoparticle of claim 1, wherein the core of the nanoparticle has surface area at least 1000 times greater than surface area of the shell of the nanoparticle.
6. The nanoparticle of claim 1, wherein the nanoparticles are an open mesh, non-aggregating, colloidal and >95% open void.
7. The nanoparticle of claim 1, wherein the nanoparticles are immobilized on a collapsible non hygroscopic net such that the target analyte is preserved in a dry state.
8. The nanoparticle of claim 7, wherein a collection device comprising the collapsible non hygroscopic net is configured to collect a fluid sample such that the fluid sample is in dry state.
9. (canceled)
10. The nanoparticle of claim 12, wherein an enzyme is immobilized with the nanoparticles, wherein the enzyme is configured to produce an enzymatically amplified color reaction inside the nanoparticles containing the target analyte.
11. (canceled)
12. The nanoparticle of claim 19, wherein a target analyte captured by the nanoparticle is configured to be displayed on a solid phase antibody for production of the enzymatically amplified color reaction inside the nanoparticles.
13. The nanoparticle of claim 12, where the nanoparticles have sensitivity of about 95% and specificity about 80% of the target analytes from a whole volume of the urine, the blood, and/or the saliva.
14-17. (canceled)
18. A method comprises: a) fabricating nanoparticles comprising a core and a shell, wherein the core comprises a molecular bait, and wherein the nanoparticle is configured to capture the biomolecule, the nucleic acid, the exosome, and/or the virus; b) immobilizing the nanoparticle on a collapsible non hygroscopic net; c) collecting a fluid sample within a collecting device comprising the collapsible non hygroscopic net of step (b); d) sequestering target analytes from a whole volume of the fluid sample and bringing the target analytes into a small volume within the nanoparticles; e) analyzing a target analytes present in the fluid sample.
19. The method of claim 18, wherein the nanoparticles comprises an immobilized enzyme, wherein the immobilized enzyme is configured to produce an enzymatically amplified color reaction inside the nanoparticles containing the target analyte.
20. (canceled)
21. The method of claim 18, wherein the target analyte captured by the nanoparticle is configured to be displayed on a solid phase antibody for production of the enzymatically amplified color reaction inside the nanoparticles.
22. The method of claim 18, wherein the nanoparticle is functionalized with a molecular bait, wherein the molecular bait is configured to captures the target analytes in a solution displacing contaminant.
23. The method of claim 18, wherein the fluid sample is urine, blood, and/or saliva of a subject.
24. The method of claim 18, wherein the nanoparticles are an open mesh, non-aggregating, colloidal and >95% open void and wherein the nanoparticles have sensitivity of about 95% and specificity about 80% of the target analytes from the whole volume of the urine, the blood, and/or the saliva.
25-26. (canceled)
27. The biomarker of claim 52, wherein identification of a Chagas disease comprising a peptide comprising an amino acid sequence selected from the group consisting of SEQ ID No. 1 to SEQ ID No. 229 and/or SEQ ID No. 269 to SEQ ID No. 286.
28. The biomarker of claim 52, wherein identification of Mycobacterium species comprising a peptide comprising an amino acid sequence selected from the group consisting of SEQ ID No. 230 to SEQ ID No. 268 and/or SEQ ID No. 287 to SEQ ID No. 312.
29. (canceled)
30. The biomarker of claim 52, wherein identification of lyme disease comprising a peptide comprising an amino acid sequence selected from the group consisting of SEQ ID No. 322 to SEQ ID No. 345.
31-51. (canceled)
52. A biomarker, comprising an amino acid sequence selected from the group consisting of SEQ ID No. 1 to SEQ ID No. 345, for selection of a disease selected from the group consisting of a Chagas disease, a Mycobacterium disease and a Lyme disease.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
[0095]
[0096]
[0097]
[0098]
[0099]
[0100]
[0101]
[0102]
[0103]
[0104]
[0105]
[0106]
[0107]
[0108]
[0109]
[0110]
[0111]
DETAILED DESCRIPTION
[0112] The practice of the present invention will employ, unless otherwise indicated, conventional techniques of nanotechnology, nano-engineering, molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry, immunology, and pharmacology, which are within the skill of the art. Such techniques are explained fully in the literature, such as, Molecular Cloning: A Laboratory Manual, 2.sup.nd ed. (Sambrook et al., 1989); Oligonucleotide Synthesis (M. J. Gait, ed., 1984); Animal Cell Culture (R. I. Freshney, ed., 1987); Methods in Enzymology (Academic Press, Inc.); Current Protocols in Molecular Biology (F. M. Ausubel et al., eds., 1987, and periodic updates); PCR: The Polymerase Chain Reaction (Mullis et al., eds., 1994); and Remington, The Science and Practice of Pharmacy, 22.sup.th ed., (Pharmaceutical Press and Philadelphia College of Pharmacy at University of the Sciences 2012).
[0113] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as is commonly understood by one of ordinary skill in the art to which this invention belongs. All patents, applications, published applications and other publications referred to herein are incorporated by reference in their entireties. If a definition set forth in this section is contrary to or otherwise inconsistent with a definition set forth in the patents, applications, published applications and other publications that are herein incorporated by reference, the definition set forth in this section prevails over the definition that is incorporated herein by reference.
[0114] To facilitate understanding of the invention, a number of terms and abbreviations as used herein are defined below as follows:
[0115] When introducing elements of the present invention or the preferred embodiment(s) thereof, the articles a, an, the and said are intended to mean that there are one or more of the elements. The terms comprising, including and having are intended to be inclusive and mean that there may be additional elements other than the listed elements.
[0116] The term and/or when used in a list of two or more items, means that any one of the listed items can be employed by itself or in combination with any one or more of the listed items. For example, the expression A and/or B is intended to mean either or both of A and B, i.e. A alone, B alone or A and B in combination. The expression A, B and/or C is intended to mean A alone, B alone, C alone, A and B in combination, A and C in combination, B and C in combination or A, B, and C in combination.
[0117] The methods and techniques of the present invention are generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the present specification unless otherwise indicated. The nomenclatures used in connection with, and the procedures and techniques of embodiments herein, and other related fields described herein are those well-known and commonly used in the art.
[0118] As defined herein, approximately, about can, in some embodiments, mean within plus or minus ten percent of the stated value. In other embodiments, approximately can mean within plus or minus five percent of the stated value. In further embodiments, approximately can mean within plus or minus three percent of the stated value. In yet other embodiments, approximately can mean within plus or minus one percent of the stated value.
[0119] Nanoparticle: The term nanoparticle as used herein refers to nanostructure, particles, vesicles, or fragments thereof having at least one dimension (e.g., height, length, width, or diameter) of between about 1 nm and about 10 ?m. For systemic use, an average diameter of about 50 nm to about 500 nm, or 100 nm to 250 nm may be preferred. The term nanostructure, nanocages, nanocage includes, but is not necessarily limited to, particles and engineered features. The particles and engineered features can have, for example, a regular or irregular shape. Such particles are also referred to as nanoparticles. The layer of nanoparticles can be implemented with nanoparticles in a monolayer or with a layer having agglomerations of nanoparticles. In some embodiments, the nanoparticle comprising or consisting an inner core covered by an outer surface.
[0120] As used herein, a subject in need refers to an animal, a non-human mammal or a human. A subject in need refers to a patient.
[0121] Throughout this disclosure, various aspects of this invention are presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible sub-ranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed sub-ranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 3, 4, 5, and 6. This applies regardless of the breadth of the range.
[0122] Throughout this disclosure, the term nanocage or nanocage or nanoaffinity or nanoparticle affinity or nanocapture or affinity hydrogel particles are used interchangeably. The term nanocage and cage are used interchangeably throughout the specification.
[0123] Throughout this disclosure, the term Mycobacterium tuberculosis, TB, tb, Mtb have been used interchangeably,
[0124] Throughout this disclosure, chemical bait, affinity bait, molecular bait has been used interchangeably. Throughout this disclosure, collapsible cup, collection cup, origami are used interchangeably.
[0125] Other objects, advantages and features of the present invention will become apparent from the following specification taken in conjunction with the accompanying drawings.
[0126] Exosomes are membrane bound extracellular vesicles (EVs) that are produced in the endosomal compartment of most eukaryotic cells. The multivesicular body (MVB) is an endosome defined by intraluminal vesicles (ILVs) that bud inward into the endosomal lumen.
[0127] Biomolecules are the molecules present in organisms that are essential to one or more typically biological processes. Capture is defined as formation of a bond with the molecular bait with the target analyte. In one embodiment, the capture can be defined as formation of an affinity bond of the target analyte with the molecular bait. In one embodiment, the capture is defined as formation of bond with the nanoparticle and the target analyte.
[0128] Biomarker Harvesting Nanoparticle Technology (Nanocage) that can Capture, Concentrate, and Preserve, Biomolecules, Nucleic Acids, Exosomes, and Whole Viruses
[0129] In one embodiment, the goal of this study is to introduce a method for investigating candidate pathogen specific peptides in patients diagnosed with pathogenic illness such as but not limited to Borreliosis, Babesiosis Anaplasmosis, Ehrlichiosis, Tick-borne encephalitis virus, Powassan Virus disease, Rickettsiosis, TBRF, Toxoplasma gondii and Tularemia, Mycobacterium tuberculosis, Toxoplasma gondii, and Trypanosoma cruzi, and Babesia microti. In one embodiment, the combined hydrogel particle pre-processing with a highly sensitive immunoassay to detect OspA, a relevant biomarker for Lyme borreliosis.
[0130] The analytical sensitivity of MS analysis is currently in the range of 10-100 ng/mL when analyzing complex matrices without pre-analytical processing, hence mass spectrometry analysis applied directly to body fluid samples lacks the sensitivity needed for low abundance pathogen derived protein detection.
[0131] The molecular bait is defined as a molecule to capture the target analyte present in a sample. In an embodiment, the molecular bait forms an affinity bond with the target analyte in a sample. In an embodiment, the molecular bait is a chemical molecule as chemical bait. In an embodiment, the molecular bait is non-chemical bait. The molecular bait is also defined as affinity bait, chemical bait.
[0132] In one embodiment, the pre-processing of the sample with affinity hydrogel particles concentrates the low abundance biomarkers to achieve mass spectrometry sensitivity in the low picogram/mL range. Additionally, the present method ensures linearity and precision of the assay in physiologically relevant protein concentration ranges.
[0133] In one embodiment, affinity hydrogel particles consist of polymeric networks functionalized with high affinity chemical baits that capture, concentrate, and preserve solution phase analytes in one step, while excluding interfering contaminants such as high abundance proteins that would otherwise negatively affect the analytical sensitivity of mass spectrometry analysis.
[0134] In an embodiment, the term contaminant refers to any foreign or unwanted molecule present in a solution. The contaminant may be a biological macromolecule that is present in the sample of the protein to be purified, such as DNA, RNA, or a protein other than the protein to be purified. Contaminants include, for example, unwanted protein variants, such as aggregated proteins, misfolded proteins, poorly disulfide-bonded proteins, high molecular weight species; other from host cells that secrete the protein being purified. Proteins, host cell DNA, components from cell culture media, molecules that are part of an absorbent set for affinity chromatography that leaches into the sample during the previous purification step, such as protein A; endotoxin; nucleic acid; virus; Or a fragment of any of the above.
[0135] Functionalization refers to the surface modification of nanoparticle, which includes conjugation of chemicals or bio molecules on to the surface like folic acid, biotin molecules, oligo nucleotides, peptides, antibodies, etc., to enhance the properties and hit the target with high precision. Functionalization of nanoparticle allows to inculcate properties that are specifically interested to be incorporated in nanoparticles.
[0136] In an embodiment, the nanocage technology is a hydrogel nanocage affinity hydrogel particles with molecular bait harvesting technology.
[0137] The nanocages are hollow, porous nanoparticles ranging in size from between about 1 nm and about 10 ?m.
[0138] In an embodiment, the hydrogel nanocage affinity bait harvesting technology, and used the technology to successfully detect very low abundance (picogram/mL) pathogen shed antigens in urine or other body fluids with high sensitivity and specificity.
[0139] In one aspect, the present invention provides hydrogel nanocage affinity bait comprises a) an inner core, and b) an outer Shell.
[0140] In an embodiment, the nanocage in the present composition can have any suitable size. For example, the nanocage can have a diameter from about 10 nm to about 10 ?m. In certain embodiments, the diameter of the nanocage is about 10 nm, 20 nm, 30 nm, 40 nm, 50 nm, 60 nm, 70 nm, 80 nm, 90 nm, 100 nm, 110 nm, 120 nm, 130 nm, 140 nm, 150 nm, 200 nm, 300 nm, 400 nm, 500 nm, 600 nm, 700 nm, 800 nm, 900 nm, 1 ?m, 2 ?m, 3 ?m, 4 ?m, 5 ?m, 6 ?m, 7 ?m, 8 ?m, 9 ?m, and 10 ?m.
[0141] In an embodiment, the nanocage or nanoparticle in the present composition can have any suitable shape, including but not limited to, sphere, square, rectangle, triangle, circular disc, cube-like shape, cube, rectangular parallelepiped (cuboid), cone, cylinder, prism, pyramid, right-angled circular cylinder and other regular or irregular shape.
[0142] In an embodiment, the nanoparticles are open mesh, non-aggregating, colloidal and >95% open void. The open mesh is a space or an opening formed due to network of the hydrogel polymer of the nanoparticles. An open mesh can be such as a scrim, reticulated or honeycomb mesh. The open voids are formed in open mesh. The nanoparticle comprises an open mesh such as a scrim, reticulated or honeycomb mesh, wherein the open voids pass directly through the nanoparticle occupy a significant portion of the surface. For example, the percentage of the surface of the nanoparticle occupied by the open void may be at least 70%, at least about 80% or at least about 90% or more than 95%. As used herein, the non-aggregating is the state of dispersed bioparticulates.
[0143] The internal high affinity bait core of the nanoparticle has a surface area >1000 greater that the surface of the nanoparticle. The internal captured analytes are shielded by the surrounding shell.
[0144] In an embodiments, the baits are immobilized into the core of the nanoparticle where they affinity capture analytes of interest and efficiently dissociate the analytes from unwanted interfering protein. Within the internal space of the hydrogel nanoparticles there is a vast excess of chemical bait with respect to analyte molecules. This excess of chemical bait: 1) stoichiometrically favors analyte-bait association on-rate, and 2) keeps analyte non-covalently attached to the particle in time, because a analyte molecule that dissociates from a bait will find nearby bait molecules that will trap it. The internal captured analytes are shielded by the surrounding shell have created hydrogel nanocage affinity bait biomarker harvesting technology, and have used the sensitivity-amplification (1000 fold) attribute of the technology to successfully detect very low abundance, previously invisible (picogram/mL), pathogen shed antigens in urine with high sensitivity and specificity.
[0145] In an embodiment, the hydrogel nanocage affinity bait biomarker harvesting technology has sensitivity amplification of 500 fold, 700 fold, 900 fold, 1000 fold, 1200 fold, 1500 fold, 2000 fold, 2500 fold, 3000 fold.
[0146] In an embodiment, molecular bait known in prior arts such as bind with the pathogen derived proteins, lipophosphoglycans, and glycans with vert high affinity. In an embodiment, the affinity is around (10.sup.?13).
[0147] In an embodiment, the affinity is around (10.sup.?12, 10.sup.?13, 10.sup.?14). The baits are immobilized into the core of the nanoparticle where the affinity capture analytes away from unwanted interfering proteins (
[0148] In an embodiment, the chemical baits are selected from but not limited to reactive blue 221 (RB221), trypan blue (TB), Bismarck brown (BB), and Alcian Blue.
[0149] In an embodiment, the internal surface area of the hydrogel polymer mesh nanocages is thousands of times greater than the surface of an equivalent solid particle. In an embodiment, the internal surface area of the hydrogel polymer mesh nanocages can be 500 times, 750 times, 1000 times, 1200 times, 1500 times, 2000 times greater than the surface of an equivalent solid particle.
[0150] In an embodiment, the effective pore size of the particles is a function of hydrogel polymer crosslinks. Rendering the crosslinks degradable provides a means to induce the nanocages to open up and display the captured sequestered analyte cargo.
[0151] In an embodiment,
[0152] The invention comprises specific amino acid sequences liberated by enzymatic digestion of bacterial and protozoan proteins that are absolutely specific for the pathogenic strains such as Mycobacterium tuberculosis and Trypanosoma cruzi.
[0153] In an embodiment, novel previously unknown, urinary peptides have been identified in TB infected patients derived from pathogenic Mycobacterium tuberculosis (Mtb) in adults and in pediatric HIV negative patients with active pulmonary TB.
[0154] In an embodiment, novel previously unknown, urinary peptides have been identified in Chagas, lyme patients.
Collection Vessel Origami Cup
[0155] In an embodiment, the nanotechnology harvest is integrated into a novel Origami collection cup. In an embodiment, the collection cup collects body fluid. In an embodiment, Urigami is a combination of the words urine and origami because the device collapse like an origami and can be used in urine to capture molecular information. In an embodiment, the Urigami collects urine and compresses the body fluid flat for fluid-free mailing.
[0156] In an embodiment, the collection device in the present composition can have any suitable shape and size, including but not limited to, cup, strip, sphere, square, rectangle, triangle, circular disc, cube-like shape, cube, rectangular parallelepiped (cuboid), cone, cylinder, prism, pyramid, right-angled circular cylinder and other regular or irregular shape.
[0157] In an embodiment, the collection device can have any size to collect a fluid and can collect the fluid in any range such as but not limited to 10 ml, 20 ml, 30 ml, 50 ml, 75 ml, 100 ml, >100 ml, >200 ml, >300 ml, >400 ml, >500 ml, >600 ml, 700 ml, >800, >900 ml, >1000 ml.
[0158] In an embodiment, the collection device is in form of a cup collects urine >1000 ml of urinary fluid analytes into a flat envelope for mailing that permits field or home collection of >100 mL content of urine analytes mailed in an envelope, obviating the need for shipment and refrigeration of urine fluid.
[0159] In one embodiment, the nanoparticles are immobilized on a collapsible non-hygroscopic net such that the target analyte is preserved in a dry state. The non-hygroscopic is a general term used to describe materials that does not retain moisture. In one embodiment, the non-non-hygroscopic can be defined as a material that may retain less than about 15% about 10% or about 7% or about 5% or about 3% moisture by mass, between 40 and 90% RH at room temperature. Collapsible herein refers to easily foldable.
[0160] In one embodiment, the collection vessel comprising the collapsible non hygroscopic net is configured to collect a fluid sample such that the fluid sample is in concentrated and dried state.
[0161] In an embodiment, the invention comprises a collecting vessel comprising an affinity net tethered with nanocages configured to capture and concentrate a target analyte present in a fluid. In an embodiment, the affinity net is a glass wool or glass fiber net. In an embodiment, the affinity net is non hygroscopic net.
[0162] In one embodiment, the collection vessel tethers the biomarker harvesting nanoparticles of
[0163] In an embodiment, the harvested analyte is eluted and concentrated into a small volume. The small volume may be volume ?100, ?50 ?l, ?20 ?l, ?15 ?l, ?10 ?l, ?5 ?l for the diagnostic purpose. For example: The harvested TB analytes are eluted off the net into a small volume thereby concentrating all of the TB analytes in the original 60 mL into a small volume <10 microliters for analysis by Mass Spectrometry or Immunoassay.
[0164] The low-cost collection vessel is simply mailed or given to the subject, who collects the sample into the dry pre-addressed envelope (
[0165] In an embodiment, fluid such as urine is not shipped or mailed, and no bacterial contamination is likely.
[0166] In an embodiment, origami collection envelope folds around 100 mL of urine fluid biomarkers into a dry confidential envelop for secure mail service transport, completely obviating the need for liquid or frozen urine handling shipment or storage, achieving virtually 100% yield of known TB antigens.
[0167] In an embodiment, disposable low-cost urine sampling envelop rapidly harvests and separates in one step all relevant biomarkers of urine, and then collapses into dry sealed envelope for mailing, banking and surveillance. For example:
[0168] In an embodiment, the nanoparticle harvested analytes are preserved against degradation. Pathogenic organisms such as TB do not survive desiccated environment eliminating the extremely low likelihood that the urine analytes captured in the device pose an infectious hazard. Although liquid urine is not considered infectious for viable TB, we have an extra measure of safety in the design of urine collection envelope. Various bacterial suppressors for microbial growth can be used for inhibition of undesired growth of any microbe. For example: Since the dye chemistry uses copper intercalated dyes (copper surfaces are antibacterial as shown in
[0169] In an embodiment, a multifunctional nanoparticle buoyant cage contains a new class of solid phase affinity copper dye which binds carbohydrate antigens with an affinity hundreds of times higher than existing antibodies or lectins.
[0170] In an embodiment, this technology in one step, in solution, to affinity capture, concentrate, and displace from interfering biomolecules, antigens of pathogenic microbes such as Mtb antigens present in patient's undiluted urine. The biomolecule can be defined as molecules present in organisms that are essential to one or more biological processes.
[0171]
[0172] The affinity net is glass wool tethered with Nanocage particles housed in a waterproof collapsible collection cup. Glass wool (10 mg, Ohio Valley Specialty? Untreated Glass Wool, Fisher Scientific) will be acid treated (33% HCl for 2 hours at room temperature) to enable nanoparticle attachment. After the glass wool has dried from acid treatment, 3 mL of nanoparticles (10 mg/mL) will be incubated with the glass wool for 1 hour at room temperature. The dyed glass wool will then be dried in an oven at 85? C. for 15 minutes. Washes will then be performed with MilliQ water in order to remove excess nanoparticles. Alternatively, glass wool will be treated with 3-aminopropyltriethoxysilane and 4,4-Azobis(4-cyanovaleric acid) will be used to covalently attach amine containing nanocages. Cages will be covalently bound to the glass fibers by reversible cross linkers, that are detachable using heat (80? C.,
[0173] In an embodiment, the collapsible container is described in
[0174] The Scanning electron microscopy (SEM) documents association of the hydrogel nanoparticles with the glass wool fibers as shown in (
[0175] In an embodiment, the collapsible container concentrates the volume of urine. The volume concentration factor reproducibility determines the sensitivity enhancement of the technology. The 7B shows the volume reduction attained by the collapsible cup. In an embodiment, the volume reduction leads to net reduction in weight of the collapsible cup. In an embodiment, the weight reduction varies from 30 to 100 times, 35 to 100 times, 40 to 100 times, 50 to 100 times.
[0176] In an embodiment, the volume concentration factor reproducibility highly optimal amplification of sensitivity. The volume concentration increases the amplification factor by a 100-fold, 150-fold, 200-fold, 250-fold.
[0177] In an embodiment, the volume concentration factor reproducibility highly optimal has a 100-fold amplification of sensitivity and a precision of less than 10% CV with a sensitivity of 15 picograms/mL 2SD above.
[0178] In an embodiment, the origami cup has a shelf life over a period of 6 months, 12 months, 18 months, over 24 months.
[0179] In an embodiment, the affinity chemistry-based nanotechnology overcomes roadblocks to achieve a highly sensitive and specific pathogen test. In an embodiment, the affinity chemistry-based nanotechnology overcomes roadblocks to achieve a highly sensitive and specific pathogen test for known TB antigens LAM and ESAT-6.
Detection
[0180] In an embodiment, the target analyte captured and sequestered inside nanoparticles is processed to get a result with 100-fold, 150-fold, 200-fold, 250-fold higher sensitivity compared to existing technology. In an embodiment, the target analyte is processed by for mass spectrometry analysis. In an embodiment, the target analyte is analyzed with a visual lateral flow assay. In general terms, lateral flow assay use immunoassay technology using nitrocellulose membrane, coloured nanoparticles (or labels), and typically antibodies, to produce results which may be visualized.
[0181] In an embodiment, the origami device is processed to get a result with 100-fold, 150-fold, 200-fold, 250-fold higher sensitivity compared to existing technology. In an embodiment, the origami device is processed by sending the folded device at room temperature to a centralized laboratory for immune-blot analysis. In an embodiment, the origami device is processed by for mass spectrometry analysis. In an embodiment, the sample in the origami device is analyzed with a visual lateral flow assay.
[0182] After high affinity, capture of the analyte, high specificity is achieved by the antibody detection method or mass spectrometry applied to the analyte captured by the nanoparticles.
[0183] Conventional Lateral flow immunoassays are a robust well established platform. Nevertheless, they lack adequate sensitivity to detect low abundance (<1.0 ?g/mL) of pathogenic antigens such as TB antigen in urine. The novel one-step self-working, enzymatically amplified visual, lateral flow immunoassay of this invention (
[0184] In an embodiment, the novel Visual One Step Self-Working Lateral Flow Disposable Immunoassay is integrated with the collection device of
[0185] In an embodiment, the solution phase enzyme amplification occurs inside the nanocage nanoparticle volume.
[0186] In an embodiment, the invention provides a novel Visual One Step Self-Working Lateral Flow Disposable Immunoassay (as shown in
[0187] In one embodiment, enzyme immunoassay is employed for visual detection of the captured analyte molecule within nanoparticles. In an embodiment, enzymes are covalently immobilized in the particles while retaining full enzymatic activity. The same nanocage particle will capture the pathogen derived analyte with high affinity. The enzymatically amplified color reaction occurs inside the nanoparticles containing the captured analyte only when the nanoparticles are bound to the antibody detection line in a lateral flow format.
[0188] The working principle is illustrated in
[0189] In an embodiment, the invention constitutes a new class of sandwich immunoassay that employs a novel high affinity chemical dye bait to capture the pathogen carbohydrate analyte in solution, and then, to display the captured analyte to a solid phase antibody (
[0190] Nanocage nanoparticles will contain HRP for enzymatic amplification inside the nanoparticle which is triggered only for Nanocages that have arrested on the solid phase antibody. The advantage of the lateral flow point of care format is that it is a one step, self-performing test which does not require addition of reagents and human training. The basic parameters that influence the sensitivity of any lateral flow test are: 1) affinity of the capture antibody, 2) solubilization and transit time of analyte in the conjugate pad, 3) total volume (total number of analyte molecules introduced in the test), and 4) visual detection sensitivity.
[0191] The limits the sensitivity of currently used visually read lateral flow immunoassays to 10-50 ng/mL. The capture antibody will be replaced by a special affinity dye bait that captures the analyte with 100 fold greater affinity. The binding of antigen to bait will take place in solution in the wick, with no diffusion boundaries. The volume of the sample moving through the detection line will be increased from 0.05 mL to 1.0 mL (20 fold). The visual detection sensitivity of the HRP amplified color is 1000 times greater than conventional lateral flow solid gold particles because the color saturates through the full volume of the hydrogel particle. Nanocage particles are absorbed in the up-front wick of the LFI device (
[0192] As shown in
[0193] In an embodiment, a nanoparticle buoyant cage has a high sensitivity (95%) and specificity (80%), compared to diseased and healthy controls, revealing, for the first time, a significant correlation of the urinary concentration of antigen with disease severity as shown in
[0194] In an embodiment, nanocages capture and immunoassay detection of pathogen antigens able to withstand 3+ high hemolysis, elevated nitrates and elevated total proteins and still maintain high specificity.
[0195] In an embodiment, the performance of the visually amplified lateral flow test for known antigens is compared to the laboratory microarray immunoassay, or mass spectrometry MS data on the same patients.
[0196] In an embodiment, the nanocage technology uses MS to attain high specificity for detection of the infectious disease. MS has the potential for virtual absolute specificity, does not require antibodies, is label free, low cost per sample and can measure dozens to hundreds of analytes in one sample. Mass spectrometry enhanced by nanotechnology can achieve previously unattainable sensitivity for characterizing urinary pathogen-derived peptides. In an embodiment, mass spectrometry enhanced by affinity hydrogel particles (analytical sensitivity=approx. 2.5 pg/mL) study pathogen-specific proteins shed in the urine of patients.
[0197] In an embodiment, the nanocage technology to create a highly sensitive, multiplex urine test that uses mass spectrometry (MS) to attain high specificity for detection of disease.
[0198] In an embodiment, the sensitivity greater is than 80 fold, 90 fold, 100 fold, 200 fold, 300 fold, 500 fold. The invention reduces the background, with a yield close to 100 percent to achieve a new class of urinary pathogenic antigen testing.
[0199] The hydrogel nanocage affinity bait biomarker harvesting technology have the sensitivity-amplification (1000 fold) attribute of the technology to successfully detect very low abundance, previously invisible (picogram/mL), pathogen shed antigens in urine with high sensitivity and specificity.
[0200] Biomarkers
[0201] We used a special bioinformatics method for adjudicating the specificity of urinary peptides that includes a taxonomic validation among pathogenic disease organism databases to maximize specificity with a goal of almost zero false positives (as shown in
[0202] In an embodiment, a large number of highly specific urinary peptides derived from TB, ChD or lyme organisms in the urine of subjects such as adults and children with documented active disease, including cases before and after therapy were found.
[0203] In an embodiment, the bioinformatic method for adjudicating the specificity of urinary peptides includes a taxonomic validation among any infectious organism databases to maximize specificity with a goal of zero false positives.
[0204] In an embodiment, peptides are authenticated on the basis of strict statistical and physicochemical parameters. Specificity of amino acid sequence and database annotation of the protein are authenticated via blast analysis. Phylogenic analysis is performed to attribute the peptide to a specific genus, species and strain with one amino acid mismatch tolerance.
[0205] In an embodiment, the combination of nanoparticle harvesting technology with Mass spectrometer has revealed an abundance of urine peptides derived specifically from a wide variety of pathogens. For Example: in
[0206] In an embodiment, the peptides derived from pathogen derived proteins detected in the urine of infected patients is a potential biomarker for the presence of the pathogen in a subject.
[0207] In an embodiment, the peptides derived from pathogen derived proteins detected in the urine of infected patients is a potential candidate for vaccine against the particular pathogen.
[0208] In an embodiment, peptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 229 or a variant sequence thereof which is at least 77%, preferably at least 88%, homologous (preferably at least 77% or at least 88% identical) to SEQ ID NO: 1 to SEQ ID NO: 229, wherein said is a biomarker for identification and diagnosis for Chagas disease, wherein said peptide is not the underlying full-length polypeptide.
TABLE-US-00001 TABLE1 ListofChagaspeptidesaspotentialbiomarkers SEQ. ID. NO Peptidesequence Accession 1 AAFAAEAAR A0A3S5IS68 2 ACDVSEAKVEDSWSRR EKF32052 3 ADVAYTTIMENTSSYFTMNYFVVLM A0A422P4I7 4 AEEAAAMLR A0A2V2WFL9 5 AEQITALLR Q4CMZ3 6 AESSVSVSR K2LXB4 7 AGAFVGSEK A0A2V2WWR6 8 AGDDEIQR A0A2V2WZ77 9 ALMDTNNFPAHVGAGER A0A422MX69 10 AMMRPDLQYTEVLLR Q4CQE0 11 APEQTGPFAADVLCIILLYIVVDMR A0A2V2W3H5 12 AQDISDLDLGR R7WS61 13 AQPLETELR A0A422Q558 14 AVEMVGADGTDTMFVD R7WSB9 15 AVSTVTTSPAG A0A2V2VC31 16 AVVDGLLR A0A422Q7A8 17 AVYVNSAR A0A2V2WJ77 18 CFHDADVVIGPHGSNLANAM K2NS51 19 CGGCLCCSGR V5CIK9 20 CLFNSTVLLFAVVMMCC A0A2V2W7TO 21 CLTLNSSNPTAIMAAASVMQN A0A422NQ50 22 CPVEEGGANFSVGQR Q4CTD9 23 CSMIIYSADNGSTWSLSK A0A2V2WCI3 24 CYYLALLR K2NW65 25 DAGTIAGLNVIR A0A2V2X690 26 DATSSANSLR A0A3R7KQD9 27 DAVDTFGNFAEDVER A0A422PFM9 28 DGGTTTPDDDR A0A3R7NKR6 29 DHATWVADPAAPPSSR R7WQV6 30 DIAPYVAGGGAEARAEVAR R7WQL0 31 DMIMYPGPSAAAHR EKF38730 32 DNLWAPVVLAQVCANYGV Q4D3S5 33 DSPDAPTPAPSEPAPPPAPGPVHPPAPGDDDLD R7WHJ0 DL 34 DYAVAFHSTVSLADGSMLLAK A0A2V2WST1 35 EAEGMGYYHVSGGLPQSCGTEDHRPALHLR V5B158 36 EAFSLFDKDGDGTITTK A0A0M4R526 37 EDAANNYAR Q27352 38 EDKESEGEVLVLTR Q4DIY6 39 EEPNSDTEGEEAGVQEE A0A3S5IRA7 40 EEVEELVGFAPGGVCPFGVNENVRIYLDIS K2N0F5 41 EGILLEGSTLK A0A2V2WF25 42 EGVVLGADTR V5BCU3 43 EHLFSMDVGDSLLFR A0A3R7PLX7 44 EINGTTQYVQR K2NG58 45 ELDNQVK A0A2V2UI95 46 EMCTLQLQLQQTPEKETFEK A0A422NKG4 47 EMLYGVALLSAALQQAEK K2NLI1 48 EQWALHGMMLNLSVPSR A0A3S5IS55 49 ESGVDMLK A0A2V2X1J4 50 EVDEQMLNVQNK P08562 51 FFAMAFGLFVLFVWMCCHCCR A0A2V2V1P0 52 FFHVNNTNLFVLMDGVSMFTEG A0A2V2XE54 53 FGAVMLLATLQAYTIR A0A3R7M247 54 FGGMDCPDSVLAR A0A2V2UW02 55 FIMFFCGCAVLLGLNCR V5BB77 56 FITATVGDGDDK A0A2V2W6N9 57 FLDFVAR A0A422NUW1 58 FLFCLQETVGSSSMDYCYEKQQ A0A2V2WMA5 59 FMSTHEEQLEHSQ A0A2V2WZD1 60 FSDVVAGYIDSK A0A2V2UV04 61 FTGDGETLLEAPCVAETTLR Q4CW04 62 FVDPSGLTR A0A3R7NAT9 63 FVGGAEAAVSSGVVMR K2MZT4 64 GASAIPCPADMQAGK A0A2V2XBV5 65 GDDEDDDDDDDEEEA A0A2V2VGA8 66 GDGTWYDCNEGETAAPSGSR A0A3R7M574 67 GEAVMDLLLAGCVPSGANPDSGVITFMK Q4D1D9 68 GEDGSNNAVLEK Q4D036 69 GEIIESNIR A0A2V2UH63 70 GIGITLDEK A0A3R7LC43 71 GILLFGPPGTGK A0A2V2UT50 72 GLHLMAGR K2NEJ7 73 GLLLFGPPGTGK A0A2V2V1P1 74 GSGAVMGDGTIVFPMQAKNK A0A2V2UTV8 75 GSMGSVGFAATLLHSMELFER K2MS94 76 GSSGTATWGTTIVAAAEEFRAK R7WKU9 77 GVGTGVLMSR R7WL85 78 GYAYRDTEMENVVMDICYNMGMGAQFGGKY Q4CQW5 79 HAFGVPSYQYSIYNIADPLCSLF A0A2V2VZB1 80 HEVHSAVYDLTR A0A3R7K6Z2 81 HHSDVVAFYDAFIHPEEELEVETR A0A422NTS1 82 HLVLSTLSASELQHAHDGDPMEGFFCSE Q4CVI3 83 HSHSAIIVEGQHDFAVWDSSY K2LZA4 84 HTYDGDGDDDENFLQVTMATTTMGNYEVMK A0A2V2X313 85 HVMFFIAAVFFIWILVVDLIAVR Q4DPH1 86 IEDNTMSSVNGVILFGDTTVR A0A2V2VZW2 87 IEQWLECQR K2NL75 88 IFEDSEGITNAEETEVR A0A422P0J7 89 IFETILEMVYGLVLDS A0A2V2XMI5 90 IGEVIGPK R7WP63 91 IGGIGTVPVGR Q0IK13 92 IGVSELQR A0A2V2XMU1 93 IIDAPGHR Q0IK13 94 IISNASCTTNCLAPLAK A0A3R7NEP8 95 ILSFIEAILVQGQTDPP A0A422NMF0 96 INIADFIR A0A2V2VN52 97 IVVLGSGGVGK A0A3R7MZE9 98 KMLLEHFLLLAE A0A422P455 99 KPGSMVFTPPPTAVPLDDYR R7WRZ0 100 KPQTNWMEVPFEHR K2N8N4 101 LALSEVELWR A0A422NHA3 102 LCCCPSVFATNVEK K2MS25 103 LCDFGLAR A0A2V2X529 104 LDGAAQQLGGDAGAAAAAVGCSHELL A0A3R7MXH1 105 LDLAELLR A0A2V2VB13 106 LEEEDFLK Q4E5C2 107 LFGVTTLDLVR A0A2V2XBW8 108 LGEIVTTIPTIGFNVETVEYK A0A2V2W496 109 LGGLSGLVPGR R7WMN9 110 LGGTCVNVGCVPK Q95NT5 111 LGTEAPAVAIGEDSVQWK R7WLW0 112 LGTVPLSR A0A422MPU6 113 LIAASQAR Q4DS89 114 LLEAGLAGK A0A422Q6S8 115 LLILAEGR A0A2V2VIP2 116 LLSFYSIIASR Q4E414 117 LMEEEYEGDTRPPDMVSM A0A2V2XE34 118 LNGCAESAEAR Q4E3F8 119 LPAIQGPR Q4DPM2 120 LQGLTEELR A0A3R7LJP3 121 LQIWDTAGQER A0A2V2XQ03 122 LSVLIAGATGSIGR A0A422PQ39 123 LSVNYLQDEDAILLDFEVVT V5B7F7 124 LVTAEGHEPTCDETPMLR A0A3R7LRS1 125 MCQCGAVWVSCHVMVADSVPVCMR A0A3R7KI25 126 MDWYTGLGITPENLR R7WKE5 127 MEGNHANESNNNNNNGEAG A0A3R7LHM4 128 MEVVTSDGMMPSLIGQM K2NMB3 129 MGTITQGMFAGSFIGVVYTA A0A3R7NR55 130 MLEILLYLPSSSGSAY A0A422NXA4 131 MLTSYSDDEALLDAIMAGASGFVLK R7WR50 132 MLVTEATPPLNLDQLR A0A3R7MBB1 133 MQEAKPVTSGSGSGGGGANEAEAK A0A3R7KUN1 134 MSHDSALTQTLDETGVER A0A3R7L3V1 135 NDQWARPPR V5B354 136 NGNTSGGSDMIAFPDSTC V5BVU1 137 NGTEGALADIANR A0A3R7RQU7 138 NLDIERPTYTNLNR Q27352 139 NMAELGRMVAMVH K2N1W1 140 NQSSGAPTFSFYLCK A0A3R7LMF9 141 NVSSSNHGAVMEAR A0A2V2W053 142 NVTFSGGGMILTVLIGAMTGDVANATF Q4D516 143 NVVQEIEGR A0A422N6T2 144 PIIAQVLEMEYANNGDLR A0A3R7KXD9 145 PTINGTGENLDGDEEEGDVSQDESQEDR Q4DGU9 146 QALCVTEAESFSLIINMMFQDR A0A3R7S1U0 147 QAPLHVSGADV A0A422P347 148 QDDLENVPGPPAAPDLR A0A2V2UNK0 149 QEETTEQEPEK K2MVQ9 150 QEFVDLTK A0A422MP99 151 QEQMECIPTR Q4DP60 152 QGDITMPSSLLEK A0A2V2VM12 153 QGETTGSEPPTLINAFYPGD A0A2V2XBI5 154 QGILQTYVK Q4E5S1 155 QHYQQQPPR A0A2V2X6F3 156 QITQVYGFYDECLR Q7Z1M4 157 QITVNDLPVGR Q4CVR5 158 QLAITEFCDVMYGQR V5BNX3 159 QLEAGGHR A0A3R7MK53 160 QLLEQDVR A0A3R7KLQ6 161 QMHLLAR A0A422NDF9 162 QNVLLFEDTLWTEMVHK K2NB36 163 QQAGAQSPSCPR K2NTB9 164 QSEEAETTTNAEQAVR K2NWF8 165 QSNELLSIIEDAK Q4CVE1 166 QTELDLAR A0A422NCY8 167 QVNYGMAATTAAGLPVNNANGSTGLEYK A0A3R7K553 168 QWMDDAVEGSELHFVLDDADMLEDDAVHVNH A0A3R7MQC3 169 SALGALGVPK A0A422MYC8 170 SAPLLILR A0A2V2VR51 171 SAVVAVLR A0A422PRQ9 172 SIATPGCDSPLR A0A3R7N5G3 173 SMDDIVIQGMNLLSAACR A0A422P9Z9 174 SQELQQDCIDCAAHALHELGLR A0A422PVR2 175 SSVLMEDGTLVFPLMATNAAK A0PGC0 176 STSSVSASLSMETVTAPADGEH V5APH8 177 SYSILDPHVSNEPESAESSFSNGSL A0A2V2XAQ5 178 TDALEFLVDLAAVIGYR A0A2V2VCF2 179 TGATIGFACK Q4CWY4 180 THAVLLLIGSR A0A422PRYO 181 THHCYEGVTFSGVGAVLTFFLN A0A2V2UU67 182 THQLILQMNTNEWYVYFDGMQVYDGYYMGSLFD K2NAQ3 E 183 TLEEALR A0A3R7M910 184 TTHQLAIVLQNGNQGSAYVDGR Q4E506 185 TTPSYVAFTDTER A0A2V2URZ0 186 TVEAEAAHGTVTR A0A2V2VIQ4 187 TVYSVVVWYAEDHHWQELR A0A2V2XJY7 188 VAESVPLPK K2MYN1 189 VAGGVSAPTAK Q4CV63 190 VATGTILSHR A0A3R7NRI4 191 VDAANLIVLVVAVA R7WKV5 192 VDAETVEQLR A0A3R7M124 193 VDGQSIVASSGDR Q4CY52 194 VEECVPGGFSPRPSHS A0A3R7NES5 195 VEIAEILR A0A2V2UWC4 196 VEIIANDQGNR A0A2V2URZ0 197 VEQLVSAVEGQK A0A2V2VKF8 198 VGSSAMVTMVR K2M2G1 199 VHNLSLNTPK A0A2V2WMX3 200 VIVEGGGIIVK K2MRM0 201 VLLLGDSGVGK A0A422MTA4 202 VLYVDSGPYEEVDTAR A0A422NHE5 203 VMIFCGTGGGAQAAVEEPSSDPK A0A2V2X7C4 204 VMYLMEAETGLLYLF A0A422Q9H5 205 VNDLFER A0A2V2W875 206 VQWACAPHVMRLAILADVWH A0A2V2W977 207 VSGMAEDVIR Q4DUT5 208 VTDFLLSR K2N9N3 209 VTVLSSQAEDPQVR A0A3R7RLF4 210 VVDAADADLVGSL A0A2V2VNJ1 211 VVHGSVIYMLVGMYNR V5AJC5 212 VVIAYEPVWAIGTGK A0A2V2VCE4 213 VVLLGDSGVGK A0A2V2W0E5 214 VVPAPDFAEAALAAVTPR R7WVP1 215 WGVAQQTL A0A422Q8Q9 216 WMQEVTVYATAMQAVR K2MKR1 217 WSSSLEGNLWK A0A3R7M3K7 218 WTGENLVPPAPCANLSGK A0A2V2VH22 219 YDANYVLTTEDF A0A2V2X972 220 YEPAGDQPAAIDDLER R7WWJ8 221 YEYTSGDLGCCITQIHMFLEK A0A3R7L734 222 YHFYNRSYLTGEK A0A422Q8W4 223 YIGGAAGANSGGDANK V5BIH4 224 YLAYLFQ A0A422QAL6 225 YLFGDFVAR A0A3R7N7Q6 226 YLGLLENIR V5DAW6 227 YLQLVFR A0A2V2V695 228 YLYEALR A0A422NG75 229 YQGVTEEIATIKNTMSGVAAR A0A422NI10
[0209] In an embodiment, Mtb proteins were identified in the urine of active TB patients. Mtb derived markers include membrane bound channels and receptors, secreted proteins related to Mtb virulence, essential transcriptional regulators, signal transduction proteins, metabolic enzymes, essential stress response factors, enzyme necessary for DNA precursor biosynthesis, ribosomal proteins, drug targets. Peptides derived from the Mtb protein are potential biomarkers for TB disease.
[0210] The present invention relates to a peptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 230 to SEQ ID NO: 268 or a variant sequence thereof which is at least 77%, preferably at least 88%, homologous (preferably at least 77% or at least 88% identical) to SEQ ID NO: 230 to SEQ ID NO: 268 of Table 2, wherein said is a biomarker for identification and diagnosis for TB disease, wherein said peptide is not the underlying full-length polypeptide.
TABLE-US-00002 TABLE2 ListofTBpeptidesaspotentialbiomarkers SEQ. ID. Accession NO. Peptidesequence number 230 TPLTATGLSK A0A049DCB4 231 AGQRWISIVEPLR G1BSG1 232 VTRETLALLIDLAR A0A1A9E4L1 233 SLWLAVVAGMIVAMLVYVLA H6WSE2 234 LQTPMQVYSADGELIAQFGEK A0A1K3J6H0 235 MLECYLQLSR A0A0T9V8Q5 236 AAEQYWQAEQATNGYMLK G8IR01 237 EIRPNLDELETGALSPYPIMR B2HKU7 238 AIFVLGDEGMEGGGGTLTSAAVTK A0A1K3CM05 239 WFAELTTK A0A081HW89 240 DKAALSSLR A0A051TRQ9 241 QDEIIEATGR A0AOT9N313 242 MQAAVAQGR A0A0Q3Z2T0 243 NDLGVFDFR A0A1K3H559 244 AIAENPDDIAEYCTSGLTLTGFLGLSDTPR A0A081I3K4 245 VAVIELDADR A0A051UHN0 246 VLAAASSPEK A0A049DVS9 247 EFLLDYLGIQHEPGVVMSR A0A0T9CW32 248 VVFINPADIEALGLTPGGR A0A081I8B0 249 FSVAELVRPWLDTWR A0A049DCE4 250 IAIVDSSFNHTFCAIIYCFHSFNYCFK A0A0T9LEC8 251 VTAICGFADLEALVEAGRTFR A0A051UG30 252 GQHFCIGYHLARLEISVLLQEWFR B2HLW7 253 LTGADFTR G7CF58 254 QALLTGR B2HHV4 255 MADITGNKQPR A0A1K3CBH1 256 ASVSPLSTAPFASIGSDDAVPSR A0A0T9PM68 257 MQPGTTTAIVGPSGCGK AOA0U0QKJ8 258 AFMTPSIAAALGRWFWWPLNTFNIVQR A0A051UGR6 259 LLQMVIMPLVFASILSAVAR A0A1K3EYR7 260 MDPDALVAQLVDEAQNVLR G8I3L7 261 VSVVSLPR A0A0T9M2X3 262 DFHAGFMSSGDVGYLDENGR A0A089QP93 263 LATVIAAMCAGADCIDDVDVLR G7CE61 264 DHPAPLIVR A0A0U0QND5 265 YLIGCDGGR A0A051TZ12 266 TGLSPSDMDVACMYDCFTYTVMATMEGFGFCE A0A051TXH8 K 267 SVTAAEGDALAR B2I428 268 GARVPALDLEQMQVIYQMR A0A0T9JZE4
[0211] In an embodiment, peptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 269 to SEQ ID NO: 286 or a variant sequence thereof which is at least 77%, preferably at least 88%, homologous (preferably at least 77% or at least 88% identical) to SEQ ID NO: 269 to SEQ ID NO: 286, wherein said is a biomarker for identification and diagnosis for Chagas disease, wherein said peptide is not the underlying full-length polypeptide.
TABLE-US-00003 TABLE3 ListofChagaspeptidesaspotentialbiomarkers SEQ.ID.No Protein PeptideSequence 269 transcript=TcCLB.507011.40:mRNA| YVSMGTNPHPSQSMSPVSM gene=TcCLB.507011.40| R organism=Trypanosoma_cruzi_CL_Brener_ Esmeraldo-like| gene_product=hypotheticalprotein, conserved| transcript_product=hypotheticalprotein, conserved|location=TcChr39-S:1342675- 1344600(+)|protein_length=641| sequence_SO=chromosome| SO=protein_coding|is_pseudo=false 270 transcript=BCY84_17297-t36_1| RFVHRDIKPSNILISR gene=BCY84_17297| organism=Trypanosoma_cruzi_cruzi_strain_ Dm28c|gene_product=protein kinase,cdc2-relatedkinase| transcript_product=proteinkinase,cdc2- relatedkinase| location=MBSY01000635:171329- 172321(?)|protein_length=330| sequence_SO=contig|SO=protein_coding| is_pseudo=false 271 transcript=BCY84_18641-t36_1| YAQFMESFSNFDFSIMWYCN gene=BCY84_18641| AGCLSTDVPR organism=Trypanosoma_cruzi_cruzi_strain_ Dm28c|gene_product=hypothetical protein|transcript_product=hypothetical protein| location=MBSY01000689:399673- 404679(+)|protein_length=1668| sequence_SO=contig|SO=protein_coding| is_pseudo=false 272 transcript=BCY84_22768-t36_1| HFTGSTAPR gene=BCY84_22768| organism=Trypanosoma_cruzi_cruzi_strain_ Dm28c|gene_product=hypothetical protein|transcript_product=hypothetical protein| location=MBSY01000794:48618- 63323(+)|protein_length=4901| sequence_SO=contig|SO=protein_coding| is_pseudo=false 273 transcript=TcCLB.506367.40:mRNA| LHLTGRLIAK gene=TcCLB.506367.40| organism=Trypanosoma_cruzi_CL_Brener_ Esmeraldo-like| gene_product=hypotheticalprotein, conserved| transcript_product=hypotheticalprotein, conserved|location=TcChr39-S:398908- 400392(?)|protein_length=494| sequence_SO=chromosome| SO=protein_coding|is_pseudo=false 274 transcript=BCY84_15012-t36_1| TAGDAAAAGGPR gene=BCY84_15012| organism=Trypanosoma_cruzi_cruzi_strain_ Dm28c|gene_product=hypothetical protein|transcript_product=hypothetical protein| location=MBSY01000599:157191- 157955(?)|protein_length=254| sequence_SO=contig|SO=protein_coding| is_pseudo=false 275 transcript=BCY84_01456-t36_1| FLACVNDGGHCSLFTQHEFP gene=BCY84_01456| SEDEFSTDFFNEHGK organism=Trypanosoma_cruzi_cruzi_strain_ Dm28c|gene_product=hypothetical protein|transcript_product=hypothetical protein|location=MBSY01000059:5809- 7914(?)|protein_length=701| sequence_SO=contig|SO=protein_coding| is_pseudo=false 276 hypotheticalprotein[Trypanosomacruzi CTVDISTAGSTETNIGDISCR strainCLBrener] 277 hypotheticalprotein[Trypanosomacruzi AVQAMCRDER strainCLBrener] 278 hypotheticalprotein[Trypanosomacruzi LIDFVENNAMK strainCLBrener] 279 mucin-associatedsurfaceprotein(MASP) GAGALEKVK [TrypanosomacruzistrainCLBrener] 280 transcript=BCY84_08138-t36_1| NNDGATGATR gene=BCY84_08138| organism=Trypanosoma_cruzi_cruzi_strain_ Dm28c|gene_product=trans-sialidase| transcript_product=trans-sialidase| location=MBSY01000386:3903-6602(?)| protein_length=899|sequence_SO=contig| SO=protein_coding|is_pseudo=false 281 hypotheticalprotein[Trypanosomacruzi KEAEAENALNR strainCLBrener] 282 transcript=TcCLB.507083.90:mRNA| RPRLVYSEDSEVR gene=TcCLB.507083.90| organism=Trypanosoma_cruzi_CL_Brener_ Esmeraldo-like| gene_product=hypotheticalprotein, conserved| transcript_product=hypotheticalprotein, conserved|location=TcChr25-S:339208- 340893(+)|protein_length=561| sequence_SO=chromosome| SO=protein_coding|is_pseudo=false 283 transcript=BCY84_13262-t36_1| IDLLQAELHK gene=BCY84_13262| organism=Trypanosoma_cruzi_cruzi_strain_ Dm28c|gene_product=hypothetical protein|transcript_product=hypothetical protein| location=MBSY01000938:10794-11717(?)| protein_length=307| sequence_SO=contig|SO=protein_coding| is_pseudo=false 284 transcript=BCY84_01068-t36_1| DSESHAESDRLKR gene=BCY84_01068| organism=Trypanosoma_cruzi_cruzi_strain_ Dm28c|gene_product=heatshock70 kDaprotein,mitochondrialprecursor| transcript_product=heatshock70kDa protein,mitochondrialprecursor| location=MBSY01000053:615988- 617955(?)|protein_length=655| sequence_SO=contig|SO=protein_coding| is_pseudo=false 285 mucin-associatedsurfaceprotein(MASP) MNPEKEKNGR [TrypanosomacruzistrainCLBrener] 286 hypotheticalprotein[Trypanosomacruzi QPHERMYCGTIK strainCLBrener]
[0212] In an embodiment, peptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 287 to SEQ ID NO: 311 or a variant sequence thereof which is at least 77%, preferably at least 88%, homologous (preferably at least 77% or at least 88% identical) to SEQ ID NO: 287 to SEQ ID NO: 311, wherein said is a biomarker for identification and diagnosis for TB disease, wherein said peptide is not the underlying full-length polypeptide.
TABLE-US-00004 TABLE4 ListofTBpeptidesaspotentialbiomarkers SEQ.ID.NO. ValidatedProteinsDescription PeptideSeq 287 responseregulatorwithCheY-like EELMLSVWGTGQGVSR receiverdomainandwinged-helix DNA-bindingdomain 288 GlcNAc-bindingproteinA TSNWEYFIGGTK precursor[Mycobacterium tuberculosis] 289 thymidylatesynthase%2CThyA ELITLEADIR [Mycobacteriumtuberculosis] 290 PAS/PACsensorhybridhistidine TVQDGRDKAVDDLATHVMAR kinase[Mycobacterium tuberculosis] 291 4-alpha-glucanotransferase WLQWQLDEQLCR [Mycobacteriumtuberculosis CAS/NITR204] 292 Uncharacterisedprotein MLPVNDVNNAGLMAQIPAVLAGP [Mycobacteriumtuberculosis] NR 293 peptidyl-prolylcis-transisomerase MFGTIQADGLTTLDK B[Mycobacteriumtuberculosis] 294 Uncharacterisedprotein VEEFLDLPR [Mycobacteriumtuberculosis] 295 Uncharacterisedprotein MSTGIAAMVVQFGLAMMPLGR [Mycobacteriumtuberculosis] 296 Uncharacterisedprotein IATVVVGVR [Mycobacteriumtuberculosis] 297 RHSrepeat-associatedcoredomain NQTLLLQGK [Mycobacteriumtuberculosis] 298 Conservedexportedproteinof YIDGLTIDR uncharacterisedfunction [Mycobacterium 299 RNA-directedDNApolymerase AWDGGDGALVR [Mycobacteriumtuberculosis] 235 DitFprotein[Mycobacterium MLECYLQLSR tuberculosis] 300 Uncharacterisedprotein MNPPMTFSVPNTTATNR [Mycobacteriumtuberculosis] 301 transposaseIS4familyprotein VDPQVVVGLLVDR [Mycobacteriumtuberculosis] 302 Uncharacterisedprotein NSWSMLLLMTSISIEK [Mycobacteriumtuberculosis] 303 hypotheticalproteinK875_05463 SWVIESMPSVAIDGIPK [Mycobacterium[tuberculosis] 304 hypotheticalproteinCAB90_02843 LETDRAHHNQLVGDR [Mycobacteriumtuberculosis] 305 chromosomesegregationprotein DELANAQAALR SMC[Mycobacteriumtuberculosis 306 hypotheticalproteinK875_03544 HPGLKVIVGHMGELLPYCFSR [Mycobacterium[tuberculosis] 307 Uncharacterisedprotein TLTEGGAGHYVSLLTNR [Mycobacteriumtuberculosis] 308 transcriptionalregulator%2CluxR AEATAADALAR family[Mycobacterium tuberculosis] 309 COX07571.1Uncharacterised LDSPDTSNAPR protein[Mycobacterium tuberculosis] 310 polynucleotidephosphorylase IGEVIGPK [Mycobacteriumtuberculosis] 311 hypotheticalproteinK875_04662 LGDDDVTPK [Mycobacterium[tuberculosis]
[0213] In an embodiment, peptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 230 to SEQ ID NO: 268 and 312 or a variant sequence thereof which is at least 77%, preferably at least 88%, homologous (preferably at least 77% or at least 88% identical) to SEQ ID NO: 230 to SEQ ID NO: 268 and 312, wherein said is a biomarker for identification and diagnosis for TB disease, wherein said peptide is not the underlying full-length polypeptide.
TABLE-US-00005 TABLE5 ListofTBpeptidesaspotentialbiomarkers ValidatedProtein SEQ.ID.No Description PeptideSequence 235 DitFprotein MLECYLQLSR OS=Mycobacterium tuberculosis GN=ERS075342_10708 PE=4SV=1 236 Gp11OS=Mycobacterium AAEQYWQAEQATNGYMLK phagefionnGN=11PE=4 SV=1 237 Acyl-CoAdehydrogenase EIRPNLDELETGALSPYPIMR FadE21 OS=Mycobacterium marinum(strainATCC BAA-535/M)GN=fadE21 PE=3SV=1 238 Uncharacterizedprotein AIFVLGDEGMEGGGGTLTSAAVTK OS=Mycobacterium tuberculosis GN=SAMEA2682835_00833 PE=4SV=1 239 Uncharacterizedprotein WFAELTTK OS=Mycobacteriumsp. TKK-01-0059 GN=K883_04441PE=4 SV=1 240 Uncharacterizedprotein DKAALSSLR OS=Mycobacterium tuberculosisTKK-01-0051 GN=K875_04984PE=4 SV=1 241 Tetr-familytranscriptional QDEIIEATGR regulator OS=Mycobacterium tuberculosis GN=ERS075342_07798 PE=4SV=1 242 Uncharacterizedprotein MQAAVAQGR OS=Mycobacterium tuberculosis GN=ERS007661_02799 PE=4SV=1 243 Organicsolventtolerance NDLGVFDFR proteinOS=Mycobacterium tuberculosisGN=1ptD PE=3SV=1 244 Uncharacterizedprotein AIAENPDDIAEYCTSGLTLTGFLGLSDTPR OS=Mycobacteriumsp. TKK-01-0059 GN=K883_01262PE=4 SV=1 245 DiacylglycerolO- VAVIELDADR acyltransferase OS=Mycobacterium tuberculosisTKK-01-0051 GN=K875_00641PE=3 SV=1 246 Uncharacterizedprotein VLAAASSPEK OS=Mycobacteriumavium XTB13-223 GN=X425_01922PE=4 SV=1 247 Uncharacterizedprotein EFLLDYLGIQHEPGVVMSR OS=Mycobacterium tuberculosis GN=ERS027644_02250 PE=4SV=1 248 FormatedehydrogenaseH VVFINPADIEALGLTPGGR FdhFOS=Mycobacterium sp.TKK-01-0059 GN=K883_00274PE=3 SV=1 249 Uncharacterizedprotein FSVAELVRPWLDTWR OS=Mycobacteriumavium XTB13-223 GN=X425_04258PE=4 SV=1 250 Uncharacterizedprotein IAIVDSSFNHTFCAIIYCFHSFNYCFK OS=Mycobacterium tuberculosis GN=ERS007672_06446 PE=4SV=1 251 Oxidoreductase VTAICGFADLEALVEAGRTFR OS=Mycobacterium tuberculosisTKK-01-0051 GN=K875_00555PE=4 SV=1 252 CytochromeP450191A3 GQHFCIGYHLARLEISVLLQEWFR Cyp191A3 OS=Mycobacterium marinum(strainATCC BAA-535/M) GN=cyp191A3PE=3SV=1 253 Uncharacterizedprotein LTGADFTR OS=Mycobacterium thermoresistibile(strain ATCC19527/DSM44167/ CIP105390/JCM6362/ NCTC10409/316) GN=KEK_08147PE=4 SV=1 254 ArylsulfataseAtsD QALLTGR OS=Mycobacterium marinum(strainATCC BAA-535/M)GN=atsD PE=4SV=1 255 PutativetaurineABC MADITGNKQPR transporterpermease proteinOS=Mycobacterium tuberculosisGN=ssuC PE=3SV=1 256 Uncharacterizedprotein ASVSPLSTAPFASIGSDDAVPSR OS=Mycobacterium tuberculosis GN=ERS075342_08795 PE=4SV=1 257 ABCtransporterATP- MQPGTTTAIVGPSGCGK bindingprotein OS=Mycobacterium tuberculosisGN=irtBPE=4 SV=1 312 Uncharacterizedprotein ATTTDMLR OS=Mycobacteriumsp. TKK-01-0059 GN=K883_01691PE=4 SV=1 258 Uncharacterizedprotein AFMTPSIAAALGRWFWWPLNTFNIVQR OS=Mycobacterium tuberculosisTKK-01-0051 GN=K875_00952PE=4 SV=1 259 Sodium:dicarboxylate LLQMVIMPLVFASILSAVAR symporter OS=Mycobacterium tuberculosisGN=tcyP PE=4SV=1 260 Gp79OS=Mycobacterium MDPDALVAQLVDEAQNVLR phageHedgerowGN=79 PE=4SV=1 261 Cellenvelope-related VSVVSLPR transcriptionalattenuator OS=Mycobacterium tuberculosisGN=ywtF_3 PE=4SV=1 262 Acyl-CoAsynthetase DFHAGFMSSGDVGYLDENGR OS=Mycobacterium tuberculosis(strainATCC 25618/H37Rv) GN=LH57_07805PE=4 SV=1 264 Uncharacterizedprotein DHPAPLIVR OS=Mycobacterium tuberculosis GN=ERS007672_01114 PE=4SV=1 265 Uncharacterizedprotein YLIGCDGGR OS=Mycobacterium tuberculosisTKK-01-0051 GN=K875_03148PE=4 SV=1 266 Uncharacterizedprotein TGLSPSDMDVACMYDCFTYTVMATMEGF OS=Mycobacterium GFCEK tuberculosisTKK-01-0051 GN=K875_04012PE=4 SV=1 267 Uncharacterizedprotein SVTAAEGDALAR OS=Mycobacterium marinum(strainATCC BAA-535/M) GN=MMAR_p20PE=4 SV=1 268 GntRfamilytranscriptional GARVPALDLEQMQVIYQMR regulator OS=Mycobacterium tuberculosisGN=mcbR_1 PE=4SV=1 230 ABCtransporterATP- TPLTATGLSK bindingprotein OS=Mycobacteriumavium XTB13-223 GN=X425_04233PE=4 SV=1 231 Gp54OS=Mycobacterium AGQRWISIVEPLR phageYoshiGN=54PE=4 SV=1 232 Glucose-6-phosphate VTRETLALLIDLAR isomerase OS=Mycobacteriumbovis GN=pgiPE=3SV=1 233 Gp40OS=Mycobacterium SLWLAVVAGMIVAMLVYVLA phageSpartacusGN=40 PE=4SV=1
[0214] In an embodiment, peptides such as Seq. ID No. such as 288, 244, 245, 246, 248, 249, 251, 252 and 243 are biomarkers for mycobacterium genus including pathogenic and non-pathogenic species.
[0215] In one embodiment, peptides derived from proteins associated with mechanism of drug resistance in TB were detected in the urine of patients as shown in
[0216] In one embodiment, the identified peptide was twin-arginine translocation (Tat) protein (IFTEPAGDAAQGTEQRK (SEQ. ID No. 313), Accession No. CNE85390.1) whose function is to facilitate the export of tertiary proteins across the cytoplasmic membrane for Mtb. This protein is especially important for pathogenic strains of mycobacterium since virulence factors must be exported out of the bacterial cell.
[0217] In one embodiment, the identified peptide was ABC transporter ATP-binding protein (MQPGTTTAIVGPSGCGK (SEQ. ID No. 257), Accession No. CFE39497.1). The ABC Transporter protein uses ATP hydrolysis to drive transport of substrates across the cellular membrane, and are the overarching class for drug transporting proteins related to Mtb resistance to major antibiotics.
Working Example
[0218] The invention is illustrated by the following working examples. The following examples as described are not intended to be construed as limiting the scope of the present invention.
[0219] General Material and Methods
[0220] Nanocage fabrication: Poly(NIPAm-co-BAC-co-AA)N-Isopropylacrylamide (NIPAm, 4.5 g, 39 mmol), bis(acryloyl)cystamine (BAC 236 mg, 0.9 mmol) and allylamine (AA, 338 ?l, 4.5 mmol) will be dissolved in 150 mL of water, and filtered using a 0.45 ?m nitrocellulose membrane disk filter. The system will be purged with nitrogen for 30 minutes at room temperature and then heated to 50? C. N,N,N,N-tetramethylethylenediamine (TEMED, Thermo Fisher, 19.4 mg, 0.17 mmol) will be added to the solution and after 10 minutes potassium persulfate (50 mg, 0.18 mmol) will be added to initiate the polymerization. The system will be held at 50? C. under nitrogen for 4 hours prior to washing and size characterization by light scattering and AFM.
[0221] Covalent incorporation of binding baits: the following four dye baits will be coupled to the nanoparticles and tested for affinity and yield of extraction as described previously [17, 31, 32]: reactive blue 221 (RB221), trypan blue (TB), Bismarck brown (BB), and Alcian Blue. For TB glycans, RB221 will be coupled to the cages as follows: 0.3 g of RB221 powder will be mixed to a solution obtained by adding 0.66 g of Na2CO3 to 50 ml of DI water and stirring at medium rate until completely dissolved. The solution will be filtered (0.45 ?m pore size). 50 ml of cage suspension will be added and allowed to incubate overnight at room temperature. RB221 coupled cages will be washed five times (54,400 rcf, 50 min, 25? C.) and re-suspended in 50 mL of DI water.
[0222] Urigami Collapsible affinity net urine collection vessel. The affinity net is glass wool tethered with Nanocage particles housed in a waterproof collapsible collection cup. Glass wool (10 mg, Ohio Valley Specialty? Untreated Glass Wool, Fisher Scientific) will be acid treated (33% HCl for 2 hours at room temperature) to enable nanoparticle attachment. After the glass wool has dried from acid treatment, 3 mL of nanoparticles (10 mg/mL) will be incubated with the glass wool for 1 hour at room temperature. The dyed glass wool will then be dried in an oven at 85? C. for 15 minutes. Washes will then be performed with MilliQ water in order to remove excess nanoparticles. Alternatively, glass wool will be treated with 3-aminopropyltriethoxysilane and 4,4-Azobis(4-cyanovaleric acid) will be used to covalently attach amine containing nanocages. Cages will be covalently bound to the glass fibers by reversible cross linkers, that are detachable using heat (80? C.,
[0223] Fabrication of visual lateral flow one step urine test employing Nanocages: An enzymatically amplified color reaction occurs inside the nanoparticles containing the captured pathogen analyte for the nanoparticles bound to the antibody detection line (
[0224] Pore dilation of cages in order to allow antibody access to captured analytes (
[0225] Covalent bonding of HRP into the nanocage. HRP will be linked to the cages using the Lightning kit (Aviva Biosciences). 100 ?L of 5 mg/mL HRP solution in PBS will be mixed with Nanocages (100 ?L, 5 mg/mL dry weight concentration) and allowed to incubate at room temperature for 15 minutes prior to washing, impregnation in the wick and freeze drying.
[0226] Nitrocellulose, Wick and Cassette: Microporous nitrocellulose membranes (pore sizes in the range 5-30 microns) will be screened in order to identify the optimal performance: rapid flow, good wettability, and good visual resolution. Test reagents and effects of reagents location in the test will be investigated (GE healthcare Life Sciences, Millipore, etc.). Cellulose and polymer (Polypropylene, PTFE, PVDF, Porex, Rayon, polyester, viscose) based wicking materials will be investigated (GE Healthcare Life Sciences, Interstate Specialty Products). Thickness will range from 500 ?m to 3000 ?m. Custom made cassettes capable to incorporate larger than standard wick volumes will be designed with Google SketchUp and 3D printed with equipment at Mason or through 3D printing service (Shapeways, Inc.).
[0227] HRP substrate. 3,3-diaminodbenzidine (DAB) will be adsorbed in the input wick. DAB is a sensitive colorimetric substrate that is oxidized by H2O2 in the presence of HRP and produces an intense brown, insoluble polymeric product. Sensitivity can be enhanced further by addition of metals. Other colorimetric substrates will be investigated: 4-Chloro-1-naphthol (4CN, insoluble purple product); 3,3,5,5-Tetramethylbenzidine (TMB, soluble blue product); 2,2-Azino-di(3-ethylbenzthiazoline-6sulfonate) (ABTS, soluble green color); o-Phenylenediamine dihydrochloride (orange-brown soluble product).
[0228] Analytical sensitivity of the novel lateral flow immunoassay. Glycan binding nanocages preloaded with HRP will be adsorbed in the upfront wick. Model solutions containing different concentrations of pathogen antigens in healthy volunteer urines will be used to assess the analytical sensitivity of the prototype device. Interfering substances will be mixed to the model solutions in order to assess and minimize nonspecific background signal.
[0229] Immuno macroarray analysis of urinary antigen: Cages will be separated from urine by centrifugation, washed with DI water and mixed with 10 ?L of Novex 2? Tris-Glycine SDS Sample Buffer (Thermo Fisher Scientific) containing 10% (v/v) 2-mercaptoethanol and incubated at 100? C. for 2 minutes. The cage suspension will be centrifuged (16,100 rcf, 25? C., 10 minutes) and the supernatant was saved and subjected to detergent removal (HiPPR Detergent Removal Resin Column Kit, Thermo Scientific) according to the vendor's instruction and using 100 ?l of bead suspension. Aliquots of 4 p L of the resulting purified elution will be robotically deposited on PVDF membranes previously activated with methanol and rinsed with DI water [33]. Membranes will be allowed to dry at room temperature and then stained using antibody, HRP labelled anti mouse antibody, and enhanced chemiluminescence system (Supersignal West Dura, Thermo Fisher Scientific).
[0230] Mass Spectrometry: Antibody independent TB specific antigen urine test for clinical validation and discovery. Antigens captured in the nanocages will be eluted with 1% Rapigest (Waters, Millford, MA) in 50 mM ammonium bicarbonate with 10 mM TCEP for 10 minutes at 100? C. Eluates will be alkylated with 50 mM iodoacetamide for 15 minutes in the dark at room temperature, then diluted 10-fold in 50 mM ammonium bicarbonate to lower the Rapigest concentration to 0.1%. Samples will be then digested with trypsin overnight at 370 C. Digestion will be halted by adding trifluoroacetic acid to a final concentration of 0.1%. Samples will be desalted with C-18 spin columns (Thermo Fisher), dried by vacuum centrifugation, and then reconstituted in 0.1% formic acid in water. Trypsin digested eluate samples will be analyzed on an Orbitrap Fusion mass spectrometer (ThermoFisher Scientific, Waltham, MA, USA) equipped with a nanospray EASY-nLC 1200 HPLC system (Thermo Fisher Scientific, Waltham, MA, USA). Peptides will be separated using a reversed-phase PepMap RSLC 75 ?m i.d.?15 cm long with 2 ?m, C18 resin LC column (ThermoFisher Scientific, Waltham, MA, USA). The mobile phase will consist of 0.1% aqueous formic acid (mobile phase A) and 0.1% formic acid in 80% acetonitrile (mobile phase B). After sample injection, the peptides will be eluted by using a linear gradient from 5% to 50% B over 15 min and ramping to 100% B for an additional 2 min. The flow rate will be set at 300 nL/min. The Orbitrap Fusion will be operated in a data dependent mode in which one full MS scan (60,000 resolving power) from 300 Da to 1500 Da using quadrupole isolation, will be followed by MS/MS scans in which the most abundant molecular ions will be dynamically selected by Top Speed, and fragmented by collision-induced dissociation (CID) using a normalized collision energy of 35%. Peptide Monoisotopic Precursor Selection and Dynamic Exclusion (8 sec duration), will be enabled, as will be the charge state dependency so that only peptide precursors with charge states from +2 to +4 will be selected and fragmented by CID.
[0231] MS Bioinformatics pipeline. High-confidence peptide identifications will be obtained by applying the following filter criteria to the search results: Xcorr versus charge 1.9, 2.2, 3.5 for 1+, 2+, 3+ ions; ?Cn >0.1; probability of randomized identification e0.01. Acceptable false discovery rate (FDR) based on forward-reverse decoy will be <1% [35]. The following pre-analytical filtering criteria will be applied: 1) absence of carryover as determined by analyzing a blank sample with a 90-minute gradient, and 2) manual validation of each peptide spectra.
[0232] Statistical Plan Under CAP/CLIA laboratory compliance including blinded proficiency testing, statistical analysis will be conducted using the guidelines in the FDA CDRH guidance document for diagnostic test evaluation. Regression analysis will be performed with STATA 13. The relationship between covariates and outcome will be explored using linear, logistic, and ordinal regression. Forward and backward stepwise regression will be used to optimize covariate selection. The covariates of interest are: indicators of socioeconomic status, clinical symptoms, such as cough, fever, and weight loss; as well as indicators of appetite.
Example 1: Urine Tb Screening in Adults
[0233] In one embodiment, the invention relates to harvesting and detection of known TB antigens lipoarabinomannan (LAM) and ESAT-6 in HIV negative culture positive pulmonary TB.
[0234] The clinical validation of our technology (N=1200 banked specimens with full clinical characterization), and to create additional novel technology, to address urgent roadblocks for urine TB screening in the laboratory and in the field (
[0235] Tuberculosis patient characterization. Urine samples (N=600) were collected from hospitalized patients in Peru. Diagnosis of active pulmonary tuberculosis for these hospitalized patients was performed by analyzing sputum samples by means of Auramine stain for acid-fast bacilli, and using the microscopic observation broth-drug susceptibility assay (MODS). The relative intensity of Auramine staining for acid fast organisms was scored from 0 to 3 with 3 being the highest [28]. Specimens were collected under informed consent; the study received IRB approval at the Universidad Peruana Cayetano Heredia (Lima, Peru) and Johns Hopkins Blooomberg School of Public Health (Baltimore, MD). Clinical and demographic data were collected from patients following recruitment to the study. This included age, sex, previous TB diagnosis, weight, appetite, self-reported symptoms including cough, hemoptysis, fever, fatigue, and average number of cough in prior 24 hours. Appetite was assessed using the Simplified Nutritional Appetite Questionnaire (SNAQ), which has been used and validated to assess appetite and weight loss in ambulatory patients in a range of settings. Urine samples were immediately centrifuged at 3,000 rcf for 10 min, and the supernatants were stored in liquid nitrogen or ?80? C. until use. Urine specimens from 300 hospitalized diseased controls and 300 healthy volunteer (Table 6) negative controls were collected from the same geographical area. Patient urine samples were qualified before the analysis by urinary dipstick testing (Multistix GP, Siemens) for hematuria, proteinuria, cystitis, and specific gravity analysis for each case. Diseased non-TB patients were ill with a variety of severe systemic, pulmonary, and urinary tract diseases including pneumonia, lung cancer, pyelonephritis, genitourinary infection, sepsis, cryptosporidiosis, cerebral toxoplasmosis, giardiasis, colon cancer with gastroenteritis, and liver failure.
TABLE-US-00006 TABLE 6 Information of TB patients and controls. Median age - years (IQR) Sex: M/F Tuberculosis patients 29 (22-37) 410/190 (microbiologically proven), N = 600 Healthy volunteers N = 300 26 (22-37) 170/130 Diseased, tuberculosis negative 32 (28-51) 185/105 controls, N = 300 N signify number
TABLE-US-00007 TABLE 7 Microbiological and clinical data of N = 600 Microbiological and Clinical Data, N = 600 N Auramine Sputum Smear Microscopy Results 0 (%) 120 1 (%) 190 2 (%) 110 3 (%) 90 Paucibacillary (%) 90 MODS Positive 600 Negative 0 Mycobacterium tuberculosis isolate sensitive to: Isoniazid 580 Rifampicin 580 Weight in kilograms 52.9 SNAQ Composite Score 13.2 Self- reported Symptoms Cough Yes 430 No 170 Hemoptysis Yes 160 No 440 Fever Yes 410 No 190 Fatigue Yes 310 No 290
[0236] Example 1 was executed using general materials and methods discussed prior in the application. The antibodies for LAM and ESAT-6 were tested and calibrated prior usage in the experiment. Anti-LAM and anti-ESAT6 monoclonal antibodies were obtained from BEI Resources (clone CS-35) and Abcam (clone 11G4), respectively and yielded a highly specific single band for LAM and ESAT6 with no detectable background in urine matrix. Glucose Oxidase, anti LAM mouse antibody (BEI resources) or anti LPG mouse antibody will be diluted 1:10 in PBS for a final concentration of 0.1 mg/mL. 0.01 mL of the diluted mAb solution will be striped on nitrocellulose (1?4 cm, Millipore) using an automated striper and dried at 37? C. in a forced air oven (Fisher scientific Isotemp). The nitrocellulose membrane will be blocked with 50 mg/mL PEG 8000 for 30 minutes, rinsed and dried. H2O2 delivery rate will be balanced by optimizing the glucose: GO ratio.
[0237] Immuno macroarray analysis of urinary LAM and ESAT6. Purified Lipoarabinomannan (LAM) from Mycobacterium tuberculosis strain H37Rv and Anti LAM antibody will be obtained from BEI Resources (Cat No. NR-14848, and NR-13811 LAM mAb clone CS-35). ESAT6 recombinant protein and anti-ESAT6 monoclonal antibody clone 11G4 will be obtained from Abcam (catalog No. ab124574 and ab26246). Membranes will be allowed to dry at room temperature and then stained using anti-LAM CS-35 or anti-ESAT6 mAb, HRP labelled anti mouse antibody, and enhanced chemiluminescence system (Supersignal West Dura, Thermo Fisher Scientific).
[0238] Mass Spectrometry: Tandem mass spectra will be searched against the NCBI Mycobacterium tuberculosis databases using Proteome Discover v 2.1 with SEQUEST using tryptic cleavage constraints. Mass tolerance for precursor ions will be 5 ppm, and mass tolerance for fragment ions will be 0.05 Da. Data will be analyzed with oxidation (+15.9949 Da) on methionine as a variable post translation modification, and carbamidomethyl cysteine (+57.0215) as a fixed modification. A 1% false discovery rate (FDR) will be used as a cut-off value for reporting peptide spectrum matches (PSM) from the database. Tandem mass spectra will be searched against the UNIPROT, NCBI and Gene Expression Omnibus (GEO, accession number GSE62152[34]) Mycobacterium tuberculosis databases with Proteome Discoverer software using tryptic cleavage constraints.
[0239] Statistical Plan: Primary outcome is detection of LAM and/or ESAT6 in patient urine. LAM and ESAT6 will be considered as linear, binary (urinary LAM cutpoint=115 pg/mL ESAT cutpoint=100 pg/mL), and ordinal outcome (urinary LAM<115 pg/mL, 115 pg/mL<urinary LAM <320 pg/mL, urinary LAM >320 pg/mL).
Results of Example 1:
[0240] Test Target Criteria. Disposable lateral flow urine RDT. Time to result=15 minutes. Readout=visual band compared to control band on same strip. Power requirements=none. Operating temperature=+5? C. to +70? C. with 70% humidity. Stability=2 years at 0? C. to 40? C. in foil package. Reagent integration=self-contained. Diagnostic sensitivity for pulmonary TB compared positive smear and positive sputum culture=90% (>68% for smear-negative culture-positive patients). Specificity=90% compared to microbiological reference standard [2].
[0241] In one embodiment, the technology had sensitivity >95% and a specificity of >80% for active pulmonary TB in HIV negative patients, compared to non-TB diseased controls.
[0242] Importantly, we show that the concentration of urinary LAM correlates significantly with the clinical severity of the disease.
[0243]
[0244] The
[0245] In
[0246] We demonstrated that the mAb is specific for Mtb LAM in urine in comparison to polysaccharides purified from multiple serotypes of N. meningitidis and S. pneumoniae. We screened a high number of anti-LAM antibodies. In particular, the human mAb clone A194-01 demonstrated significantly improved affinity for Mtb LAM with respect to clone CS-35. An optimized anti-LAM sandwich immunoassay comprising capture (CS-35 or FIND 28) and detection (A194-01) antibodies. The novel sandwich immunoassay attains high sensitivity in bacterial and urine LAM and it can readily translated to a rapid test, lateral flow immunoassay as shown in
[0247] Identification of novel Mtb proteins in the urine of tuberculosis patients: characterized TB patients were analyzed with the Nanocage enhanced mass spectrometry workflow. Several new peptides were identified according to the criteria of Bioinformatics pipeline. In addition, to the preanalytical filtering criteria for MS bioinformatics pipeline for identification of peptides, the following post-analytical filtering criteria is applied: 1) peptide length >7 amino acids. 2) 100% amino acid identity match with pathogenic Mtb, 3) exclusion of housekeeping proteins (tubulin, actin, ubiquitin), 4) exclusion of peptides that overlap with any naturally occurring in non-Mycobacterium protein (100% identity match), 5) authentication of protein annotation using randomized protein databases and alignment of whole candidate proteins in the closest taxonomy clade (JalView), and 6) a patient will be considered positive for Mtb infection if >=2 peptides uniquely belonging to Mtb according to the present criteria will be identified.
[0248] Several proteins of potential high biological importance were found. These include GAP family protein an integral membrane protein required for glycolipid transport to the cell surface, PadR-like family transcriptional regulator, which has been associated to a defective form of the mycobacterial cell wall in response to antimicrobial factors, and a number of proteins associated to glucose, nitrogen and lipid metabolism. Table 8 gives a list of Mtb proteins identified in the urine of active pulmonary TB patients.
TABLE-US-00008 TABLE 8 Mtb proteins identified in the urine of active pulmonary TB patients. True Positive Patients Definition [Mtb] Accession Number Q Value Twin-arginine translocation CNE65390.1 0.01668 pathway signal (virulence factor) ABC transporter ATP- CFE39497.1 0.04403 binding protein (multidrug resistance) cell envelope-related CNF54817.1 0.003363 transcriptional attenuator arylsulfatase AtsD AMC71783.1 0.008922 Antirestriction protein SGC98382.1 0.01380 (immune evasion) Tetr-family transcriptional CNG74091.1 0.004629 regulator (multidrug resistance) Organic solvent tolerance SGD19216.1 0.004629 protein (nutrient deprivation) acyl-CoA dehydrogenase WP_094357863.1 0.02466 (metabolic activity) acyl-CoA synthetase WP_052629386.1 0.1144 (dormancy / latent infection)
Example 2: Detection Test for Active Tb in Children and Adults
[0249] The method employed to execute Example 2 was similar to sections of General Material and Methods and Example 1. The urine samples (N=300) were collected from hospitalized patients in Peru. Diagnosis of active pulmonary tuberculosis was done according to Example 1.
[0250] A total of 60 Mycobacterium tuberculosis specific proteins were identified in urine samples from 150 culture and PCR positive TB patients (
[0251] Ten antigens were in common between pediatric and adult patients as shown in
[0252] MS and immunoassay identification of TB antigen ESAT6 in the urine of HIV negative microbiologically confirmed, pediatric and adult TB patients. Seven archived, sputum culture positive children, all contained ESAT6 in the urine. Immuno array analysis using anti-ESAT6 antibody clone 11G4 (Abcam, cat number ab26246) reached an analytical sensitivity of 0.05 pg/mL (1 mL volume, 100 fold concentration factor). Five microbiologically confirmed, adult TB patients were positive for the Nanocage ESAT6 urinary test.
[0253] Scanning EM documents association of the hydrogel nanoparticles with the glass wool fibers (
[0254] CBBA is an abbreviation of a hospital from where samples were collected.
[0255] Table 9 shows the identification of TB peptides in the samples. The parameters are Internal controls of of commercial software that is called Proteome Discoverer, genes per peptide. Accession number is an identification number that you can use in the database to identify the sequence and the description is what we know of course about the protein. We have a Q value that is a modify P value that corrects for multiple tests. It is also defined as the minimal false discovery rate at which the identification is considered correct. PEP score is a measure of how well the spectrum matches with the peptide sequence and the higher, the better. The number of peptides it means that the number of unique peptides that we identified with that sequence. The PSM is a pesticide, spectrum matches. Those are how many times that sequence, that ion has hit the detector. pI is an isoelectric point. AA is amino acid. kDa is kilodalton, MW is molecular weight.
TABLE-US-00009 TABLE9 IdentificationofTBpeptidesinthesamples. No.of No. S. Exp.q- SumPEP No.of No.of No.ofUnique Protein of No. Accession Description value Score Coverage Peptides PSMs Peptides Groups AAs MWkDa cal.pI 1 A0A0T9V8Q5 DitFprotein 0.01666 1.4541 23.255 1 1 1 1 43 4.696 7.3 OS= Mycobacterium tuberculosis GN=ERS075342_ 10708 PE=4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous mLEcYL M1 1 1 A0A0T9V8Q5 A0A0T9V8Q5 0 2 0.3032 0 (A2) QLSR? (Oxidation); (SEQID C4 No.235) (Carbamido- methyl) 2 G8IR01 Gp11 0.02466 1.3393 1.958 1 1 1 1 919 100.801 5.88 OS= Mycobacteriumphage fionnGN=11 PE=4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous AAEQY M16 1 1 G8IR01 G8IR01 0 2 0.1039 0 (A2) WQAEQ (Oxidation) ATNGYm LK.sup.b (SEQID No.236) 3 B2HKU7 Acyl-CoA 0.02466 1.2737 5.097 1 1 1 1 412 44.795 5.97 dehydrogenase FadE21 OS= Mycobacterium marinum (strainATCC BAA-535/M) GN=fadE21 PE=3SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous EIRPNLD M20 1 1 B2HKU7 B2HKU7 0 3 0.1946 0 (A2) ELETGA (Oxidation) LSPYPIm R.sup.b (SEQID No.237) 4 G7CAU4 Adenosylmethionine- 0.02728 1.1864 1.5625 1 1 1 1 448 48.166 5.63 8- amino-7- oxononanoate aminotransferase OS= Mycobacterium thermoresistibile (strain ATCC19527/ DSM44167/ CIP105390/ JCM6362/ NCTC10409/ 316)GN=bioA PE=3SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous VTALET 1 1 G7CAU4 G7CAU4 0 2 0.2108 0 (A2) R.sup.c (SEQID No.314) 5 A0A1K3CM05 Uncharacterized 0.03901 1.1304 7.7419 1 1 1 1 310 33.209 5.11 protein OS= Mycobacterium tuberculosis GN=SAMEA2682835_ 00833 PE=4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous AIFVLG M10 1 1 A0A1K3CM05 A0A1K3CM05 0 3 0.2956 0 (A2) DEGmEG (Oxidation) GGGTLT SAAVTK.sup.a (SEQID No.238) 6 A0A081HW89 Uncharacterized 0.01380 1.0188 2.216 1 1 1 1 361 40.723 9.64 protein OS= Mycobacteriumsp. TKK-01-0059 GN=K883_04441 PE=4 SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Selected WFAELT 1 2 A0A081HW89 A0A081HW89; 0 2 0.0123 (A2) TK.sup.b A0A081I0S7 (SEQID No.239) No.of No. Exp.q- SumPEP No.of No.of No.ofUnique Protein of MW Accession Description value Score Coverage Peptides PSMs Peptides Groups AAs [kDa] calc.pI 7 A0A051TRQ9 Uncharacterized 0.00358 1.6784 1.927 1 2 1 1 467 50.317 5.34 protein OS= Mycobacterium tuberculosis TKK-01-0051 GN=K875_04984 PE-4 SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous DKAALS 1 1 A0A051TRQ9 A0A051TRQ9 1 2 0.2976 0 (A2) SLR? (SEQID No.240) SequestHT Unambiguous DKAALS 1 1 A0A051TRQ9 A0A051TRQ9 1 2 0.4576 0 (A2) SLR? (SEQID No.240) 8 A0A0T9N3I3 Tetr-family 0.00462 1.47534 3.937 1 1 1 1 254 27.568 5.27 transcriptional regulator OS= Mycobacterium tuberculosis GN=ERS075342_ 07798 PE=4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous QDEIIEA 1 1 A0A0T9N313 A0A0T9N313 0 2 0.1829 0 (A2) TGR? (SEQID No.241) 9 A0A0Q3Z2T0 Uncharacterized 0.00462 1.45717 20.454 1 1 1 1 44 4.765 11.41 protein OS= Mycobacterium tuberculosis GN=ERS007661_ 02799 PE=4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous MQAAV 1 1 A0A0Q3Z2T0 A0A0Q3Z2T0 0 2 0.2521 0 (A2) AQGR? (SEQID No.242) 10 A0A1K3H559 Organic 0.00462 1.43997 1.140 1 1 1 1 789 89.898 5.38 solvent tolerance protein OS= Mycobacterium tuberculosis GN=1ptD PE=3SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous NDLGVF 1 1 A0A1K3H559 A0A1K3H559 0 2 0.2133 0 (A2) DFR? (SEQID No.243) 11 A0A1K3J6H0 Transglycosylase 0.01700 1.30891 2.570 - 1 1 1 817 89.79 6.61 OS= 1 Mycobacterium tuberculosis GN=mrcA PE=4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous LQTPMQ 1 1 A0A1K3J6H0 A0A1K3J6H0 0 3 0.2448 0 (A2) VYSADG ELIAQFG EK? (SEQID No.234) 12 A0A081I3K4 Uncharacterized 0.01868 1.3003 2.029 1 1 1 1 1478 152.374 6.87 protein OS= Mycobacteriumsp. TKK-01-0059 GN=K883_01262 PE-4 SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous AIAENP C13 1 1 A0A08113K4 A0A08113K4 0 4 0.1707 0 (A2) DDIAEYc (Carbamido- TSGLTL methyl) TGFLGL SDTPR.sup.b (SEQID No.244) No.of No. Exp.q- SumPEP No.of No.of No.ofUnique Protein of MW Accession Description value Score Coverage Peptides PSMs Peptides Groups AAs [kDa] calc.pI 13 A0A051UHN0 Diacylglycerol 0.00125 2.0223 2.132 1 2 1 1 469 51.923 6.96 O- acyltransferase OS= Mycobacterium tuberculosis TKK-01-0051 GN=K875_00641 PE=3 SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous VAVIEL 1 1 A0A051UHN0 A0A051UHN0 0 2 0.3205 0 (A2) DADR.sup.b (SEQID No.245) SequestHT Unambiguous VAVIEL 1 1 A0A051UHN0 A0A051UHN0 0 2 0.3186 0 (A2) DADR (SEQID No.245) 14 A0A1K3LFE0 Heme/hemopexin 0.00125 1.8136 2.0408 1 1 1 1 980 111.633 6.68 utilization proteinC OS= Mycobacterium tuberculosis GN=hxuC PE=3SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous QASAWT 1 1 A0A1K3LFE0 A0A1K3LFE0 0 2 0.2788 0 (A2) PMLSAS VHLTDD LR.sup.c (SEQID No.315) 15 A0A049DVS9 Uncharacterized 0.00125 1.7239 3.105 1 1 1 1 322 33.956 5.83 protein OS= Mycobacteriumavium XTB13-223 GN=X425_01922 PE=4 SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous VLAAAS 1 4 A0A049DVS9 B2HLI5; 0 2 0.2227 0 (A2) SPEK.sup.b A0A081I611; (SEQID A0A051TJY1; No.246) A0A049DVS9 16 A0A0T9CW32 Uncharacterized 0.00125 1.6848 10.919 1 1 1 1 174 19.284 10.87 protein OS= Mycobacterium tuberculosis GN=ERS027644_ 02250 PE-4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous EFLLDY 1 3 A0A0T9CW32 A0A0U0R9S4; 0 3 0.2259 0 (A2) LGIQHEP A0A0T9CW32; GVVMSR.sup.a A0A0U0UFW7 (SEQID No.247) 17 A0A081I8B0 Formate 0.00125 1.53685 2.461 1 1 1 1 772 83.571 6.93 dehydrogenase HFdhF OS= Mycobacteriumsp. TKK-01-0059 GN=K883_00274 PE=3 SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous VVFINP 1 1 A0A08118B0 A0A081I8B0 0 3 0.0958 0 (A2) ADIEAL GLTPGG R.sup.b (SEQID No.248) 18 A0A049DCE4 Uncharacterized 0.00125 1.52665 4.559 1 1 1 1 329 33.359 7.31 protein OS= Mycobacteriumavium XTB13-223 GN=X425_04258 PE=4 SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous FSVAEL 1 1 A0A049DCE4 A0A049DCE4 0 3 0.061 0 (A2) VRPWLD TWR.sup.b (SEQID No.249) 19 A0A051TUK1 Uncharacterized 0.00997 1.3483 1.736 1 1 1 1 403 43.563 5.26 protein OS= Mycobacterium tuberculosis TKK-01-0051 GN=K875_03594 PE=4 SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Selected SVALNL 1 1 A0A051TUK1 A0A051TUK1 0 2 0 0 (A2) R.sup.c (SEQID No.316) 20 A0AQU0UGJ6 Uncharacterized 0.01523 1.2294 56.25 1 1 1 1 48 5.605 8.7 protein OS= Mycobacterium tuberculosis GN=ERS007672_ 06446 PE-4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous IAIVDSS C13 1 1 A0A0U0UGJ6 A0A0U0UGJ6 0 3 0.527 0 (A2) FNHTFc (Carbamido- AIIYcFH methyl); SFNYcFK.sup.a C18 (SEQID (Carbamido- No.250) methyl); C25 (Carbamido- methyl) 21 A0A0T9LEC8 Twin-arginine 0.01667 1.1813 9.189 1 1 1 1 185 19.386 9.48 translocation pathwaysignal OS= Mycobacterium tuberculosis GN=ERS075342_ 03632 PE=4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous IFTEPAG 1 1 A0A0T9LEC8 A0A0T9LEC8 1 2 0.139 0 (A2) DAAQGT EQRK.sup.c (SEQID No.313) 22 A0A051UG30 Oxidoreductase 0 2.2788 4.545 1 1 1 1 462 48.66 5.5 OS= Mycobacterium tuberculosis TKK-01-0051 GN=K875_00555 PE=4 SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous VTAIcGF C5 1 1 A0A051UG30 A0A051UG30 1 3 0.2081 0 (A2) ADLEAL (Carbamido- VEAGRT methyl) FR.sup.b (SEQID No.251) 23 B2HLW7 Cytochrome 0 1.4999 5.970 1 1 1 1 402 45.163 5.62 P450191A3 Cyp191A3 OS= Mycobacterium marinum (strainATCC BAA-535/M) GN=cyp191A3 PE=3SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous GQHFcIG C5 1 1 B2HLW7 B2HLW7 1 4 0.1179 0 (A2) YHLARL (Carbamido- EISVLLQ methyl) EWFR.sup.b (SEQID No.252) 24 A0A1K3ETE3 Conserved 0.00279 1.2315 6.060 1 1 1 1 297 31.832 6.11 proteinof uncharacterised function BmrU OS= Mycobacterium tuberculosis GN=yegS PE=3SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous SLWNSL 1 1 A0A1K3ETE3 A0A1K3ETE3 0 2 0.2865 0 (A2) FNEGEA EGVIMK.sup.c (SEQID No.317) 25 G7CF58 Uncharacterized 0.00632 1.5040 2.352 1 1 1 1 340 34.455 8.94 protein OS= Mycobacterium thermoresistibile (strain ATCC19527/ DSM44167/ CIP105390/ JCM6362/ NCTC10409/ 316) GN=KEK_08147 PE=4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous LTGADF 1 1 G7CF58 G7CF58 0 2 0.3177 0 (A2) TR.sup.b (SEQID No.253) 26 A0A1K3J6H0 Transglycosylase 0.00892 1.3894 2.570 1 1 1 1 817 89.79 6.61 OS= Mycobacterium tuberculosis GN=mrcA PE=4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous LQTPMQ 1 1 A0A1K3J6H0 A0A1K3J6H0 0 3 0.2733 0 (A2) VYSADG ELIAQFG EK? (SEQID No.234) 27 B2HHV4 Arylsulfatase 0.00892 1.3784 0.871 1 1 1 1 803 87.66 5.91 AtsD OS= Mycobacterium marinum (strainATCC BAA-535/M) GN=atsD PE=4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous QALLTG 1 13 B2HHV4 A0A0T9D371; 0 2 0.2189 0 (A2) R.sup.a A0A1A9T8A0; (SEQID A0A0T9ASE6; No.254) A0A0U0RKC9; R4LZQ1; A0A109SV27; A0A120IVP6; A0A0H3MAW3; A0A0E7T2U1; A0A045IQX6; GOTQE3; A0A0T9X8C5; B2HHV4 28 A0A1K3CBH1 Putative 0.00892 1.3783 4.150 1 1 1 1 265 28.642 10.15 taurineABC transporter permease protein OS= Mycobacterium tuberculosis GN=ssuC PE=3SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous MADITG 1 1 A0A1K3CBH1 A0A1K3CBH1 1 2 0.1832 0 (A2) NKQPR.sup.a (SEQID No.255) 29 A0A0T9PM68 Uncharacterized 0.03561 1.2855 16.197 1 1 1 1 142 14.926 9.64 protein OS= Mycobacterium tuberculosis GN=ERS075342_ 08795 PE=4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous ASVSPLS 1 1 A0A0T9PM68 A0A0T9PM68 0 2 0.1853 0 (A2) TAPFASI GSDDAV PSR? (SEQID No.256) 30 A0A0U0QKJ8 ABC 0.04402 1.2565 7.589 1 1 1 1 224 23.734 5.6 transporter ATP-binding protein OS= Mycobacterium tuberculosis GN=irtBPE=4 SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous MQPGTT C15 1 1 A0A0U0QKJ8 A0A0U0QKJ8 0 2 0.5023 0 (A2) TAIVGPS (Carbamido- GcGK.sup.a methyl) (SEQ.ID No.257) 31 A0A081I4T0 Uncharacterized 0.04457 1.24161 5.333 1 1 1 1 150 16.58 5.9 protein OS= Mycobacteriumsp. TKK-01-0059 GN=K883_01691 PE=4 SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous ATTTDM 1 1 A0A081I4T0 A0A081I4T0 0 2 0.1943 0 (A2) LR 32 A0A0T9M5C9 FadD27 0 1.4458 3.344 1 1 1 1 299 32.704 10.67 OS= Mycobacterium tuberculosis GN=ERS075342_ 05377 PE=4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous EVADAV 1 1 A0A0T9M5C9 A0A0T9M5C9 0 2 0.3194 0 (A2) LWPR.sup.c (SEQ.ID No.318) 33 A0A0T9KY47 DNA 0.05104 1.1290 1.005 1 2 0 0 696 76.847 7.59 topoisomerase (ATP- hydrolyzing) OS= Mycobacterium tuberculosis GN=gyrB_1 PE=4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Rejected VLNEQL 0 1 A0A0T9KY47 0 2 0.0444 (A2) R.sup.c (SEQ.ID No.319) SequestHT Rejected VLNEQL 0 1 A0A0T9KY47 0 2 0.0152 0 (A2) R.sup.c (SEQ.ID No.319) 34 A0A0U0QK90 Uncharacterized 0.05104 1.1258 4.929 1 1 1 1 142 15.236 11.96 protein OS= Mycobacterium tuberculosis GN=ERS007672_ 00869 PE=4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous LSVAVI 1 3 A0A0U0QK90; 0 2 0.2792 0 (A2) R A0A0U0UPZ5; (SEQ.ID A0A0U0QT26 No.320) 35 A0AQU0UPZ5 Uncharacterized 0.05104 1.1258 12.727 1 1 1 1 55 6.045 12 protein OS= Mycobacterium tuberculosis GN=ERS007726_ 04149 PE-4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous LSVAVI 1 3 A0A0U0QK90; 0 2 0.2792 0 (A2) R.sup.c A0A0U0UPZ5; (SEQ.ID A0A0U0QT26 No.320) 36 A0A0U0QT26 Uncharacterized 0.051044084 1.1258 7.865 1 1 1 1 89 9.772 12.21 protein OS= Mycobacterium tuberculosis GN=ERS007657_ 03479 PE=4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous LSVAVI 1 3 A0A0U00QK90; 0 2 0.2792 0 (A2) R.sup.c A0A0U0UPZ5; (SEQ.ID A0A0U0QT26 No.320) 37 A0A051UGR6 Uncharacterized 0 1.2431 2.821 1 1 1 1 957 104.145 6.62 protein OS= Mycobacterium tuberculosis TKK-01-0051 GN=K875_00952 PE=4 SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous AFmTPSI M3 1 1 A0A051UGR6 A0A051UGR6 1 4 0.1184 0 (A2) AAALGR (Oxidation) WFWWP LNTFNIV QR? (SEQ.ID No.258) 38 A0A1K3EYR7 Sodium: 0.11441 0.92009 4.3103 1 1 1 1 464 48.701 9.04 dicarboxylate symporter OS= Mycobacterium tuberculosis GN=tcyP PE=4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous LLQmVI M4 1 1 A0A1K3EYR7 A0A1K3EYR7 0 4 0.2295 0 (A2) mPLVFA (Oxidation); SILSAVA M7 R.sup.a (Oxidation) (SEQ.ID No.259) 39 A0A0T9K2L6 Glycoside 0 2.7880 1.080 1 1 1 1 648 69.221 7.2 hydrolase, family3-like protein OS= Mycobacterium tuberculosis GN=bg1X_1 PE=3SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Selected DPGLVE 1 1 A0A0T9K2L6 A0A0T9K2L6 0 2 0.0149 0 (A2) R.sup.c (SEQ.ID No.321) 40 G8I3L7 Gp79 0.00238 1.7937 13.286 1 2 1 1 143 15.855 4.98 OS= Mycobacteriumphage Hedgerow GN=79PE-4 SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous mDPDAL M1 1 2 G8I3L7 G3M4D5; 0 3 0.0822 0 (A2) VAQLVD (Oxidation) G8I3L7 EAQNVL R.sup.b (SEQ.ID No.260) SequestHT Unambiguous mDPDAL M1 1 2 G8I3L7 G3M4D5; 0 3 0.1359 0 (A2) VAQLVD (Oxidation) G8I3L7 EAQNVL R.sup.b (SEQ.ID No.260) 41 A0A0T9M2X3 Cellenvelope- 0.00336 1.5430 1.4285 1 1 1 1 560 59.4 9.91 related transcriptional attenuator OS= Mycobacterium tuberculosis GN=ywtF_3 PE=4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous VSVVSL 1 1 A0A0T9M2X3 A0A0T9M2X3 0 2 0.0741 0 (A2) PR? (SEQ.ID No.261) 42 A0A089QP93 Acyl-CoA 0.01513 1.3715 3.7383 1 1 1 1 535 57.98 6.61 synthetase OS= Mycobacterium tuberculosis (strainATCC 25618/ H37Rv) GN=LH57_07805 PE=4 SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous DFHAGF 1 9 A0A089QP93 A0A0T9XJJ8; 0 3 0.5504 0 (A2) MSSGDV R4MIN4; GYLDEN G0TIN1; GR.sup.a A0A0T9D8R9; (SEQ.ID A0A0T9YKC3; No.262) A0A089QP93; O06831; A0A0G4E256; A0A0U0QZH2 43 A0A0T9N3I3 Tetr-family 0.02466 1.2457 3.9370 1 1 1 1 254 27.568 5.27 transcriptional regulator OS= Mycobacterium tuberculosis GN=ERS075342_ 07798 PE-4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous QDEIIEA 1 1 A0A0T9N313 A0A0T9N313 0 2 0.309 0 (A2) TGR? (SEQID No.241) 44 A0AQU0QND5 Uncharacterized 0.00227 1.4190 7.6923 1 1 1 1 117 12.861 6.68 protein OS= Mycobacterium tuberculosis GN=ERS007672_ 01114 PE=4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous DHPAPLI 1 2 A0A0U0QND5 A0AQU0QND5; 0 2 0.2393 0 (A2) VR A0A0U0TPK3 (SEQID No.264) 45 A0A051TZ12 Uncharacterized 0.00227 1.2916 1.8145 1 1 1 1 496 54.103 6.42 protein OS= Mycobacterium tuberculosis TKK-01-0051 GN=K875_03148 PE=4 SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous YLIGcDG C5 1 1 A0A051TZ12 A0A051TZ12 0 2 0.2587 0 (A2) GR (Carbamido- (SEQID methyl) No.265) 46 A0A051TXH8 Uncharacterized 0.00227 1.2503 8.7301 1 1 1 1 378 40.861 5.41 protein OS= Mycobacterium tuberculosis TKK-01-0051 GN=K875_04012 PE=4 SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous TGLSPS C12 1 1 A0A051TXH8 A0A051TXH8 0 3 0.1154 0 (A2) DMDVAc (Carbamido- MYDcFT methyl); YTVmAT C16 MEGFGF (Carbamido- cEK methyl); (SEQID M22 No.266) (Oxidation); C31 (Carbamido- methyl) 47 B2I428 Uncharacterized 0.03794 1.0608 8.2191 1 1 1 1 146 15.631 11.66 protein OS= Mycobacterium marinum (strainATCC BAA-535/M) GN=MMAR p20PE-4 SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous SVTAAE 1 1 B2I428 B2I428 0 2 0.1241 0 (A2) GDALAR (SEQID No.267) 48 A0A0T9JZE4 GntRfamily 0.03805 1.0086 8.2608 1 1 1 1 230 25.888 6.44 transcriptional regulator OS= Mycobacterium tuberculosis GN=mcbR_1 PE=4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous GARVPA M18 1 1 A0A0T9JZE4 A0A0T9JZE4 1 4 0.1311 0 (A2) LDLEQM (Oxidation) QVIYQm R (SEQID No.268) 49 G7CE61 Transposase, 0.00619 1.1665 4.8351 1 1 1 1 455 48.849 9.55 IS4family protein OS= Mycobacterium thermoresistibile (strain ATCC19527/ DSM44167/ CIP105390/ JCM6362/ NCTC10409/ 316) GN=KEK_06363 PE=4SV=1 No.of Master No.of Identifying PSM Annotated Protein No.of Protein Protein Missed Node Ambiguity Sequence Mod. Groups Proteins Accessions Accessions Cleavages Charge DeltaScore DeltaCn SequestHT Unambiguous LATVIA C9 1 1 G7CE61 G7CE61 0 4 0.2028 0 (A2) AMcAGA (Carbamido- DcIDDV methyl); DVLR C14 (SEQID (Carbamido- No.263) methyl) * superscript .sup.a =Validated through BLAST for Mycobacterium tuberculosis, .sup.b =Validated through BLAST for Mycobacterium genus including pathogenic and non pathogenic species, .sup.c =Rejected; Mod. is Modification
Example 3: Screening Test for Chagas Disease
[0256] Urine samples were collected from infants (less than one month of age) with and without CD congenital infection at the Percy Bolen Maternidad hospital in Santa Cruz, Bolivia. Positive samples were characterized by being positive for two of the following independent methods: serology, PCR, and micromethod. The study included 16 positive and 11 negative infant samples. The concentration of T. cruzi derived analytes in urine and Mass Spectrometry sample preparation was done according to
[0257] Novel T. cruzi specific urinary markers are identified with high sensitivity and specificity in patients congenitally infected with Chagas disease. Following the workflow described in
[0258] The telomeric and subtelomeric regions of T. cruzi's chromosomes are enriched in retrotransposon hot spot (RHS) protein and trans-sialidase-like protein pseudogenes which suggests a function in generation of new variants of surface proteins (involved in invasion of host cell). New protein variants are hypothesized to be mobilized by retrotransposon elements. Other studies also revealed the unique RHS proteins' role in transcription elongation and mRNA export of trypanosomes, which suggests the parasite's divergent from other eukaryotes in the universal transcription process as shown in
[0259] The Table 10 below shows identification of antigen in Chagas sample by MS. Accession number, Q value, PEP score, PSM, pI, AA, kDa, MW has same meaning has defined in Example 2, Table 9.
TABLE-US-00010 TABLE10 IdentificationofChagaspeptidesinthesamples. Exp. Sum No.of No.of No S. q- PEP Cover- No.of No.of Unique Protein of MW calc. No. Accession Description value Score age Peptide PSMs Peptide Groups AAs kDa pI 1 TcCLB.5 transcript= 0.047 3.120 1 1 1 1 641 72.1 5.91 07011.40: TcCLB. mRNA- 507011.40 p1 |mRNA| gene= TcCLB. 507011.40 |organism= Trypanosoma_ cruzi_CL_ Brener_ Esmeraldo- like| gene_ product= hypothetical protein, conserved| transcript_ product= hypothetical protein, conserved| location= TcChr39- S:1342675- 1344600(+)| protein_ length=641 |sequence_ SO= chromosome| SO= protein_ coding| is_pseudo= false Anno- No.of No. Master No.of Identi- tated Pro- of Protein Protein Missed fying PSM Se- tein Pro- Acces- Acces- Cleav- Delta Delta Node Ambiguity quence Mod. Groups teins sions sion ages Charge Score Cn Sequest Selected YVSM 1 1 TcCLB TcCLB. 0 3 0.0263 0 HT(A2) GTNPH .50701 507011. PSQSM 1.40:m 40:mRN SPVSM RNA- A-p1 R p1 (SEQ IDNO. 269) 2 BCY84_1 transcript= 0.214 4.8484 1 1 1 1 330 37.4 7.06 7297- BCY84_17297- t36_1-p1 t36_1| gene= BCY84_ 17297| organism= Trypanosoma_ cruzi_cruzi_ strain_Dm28c |gene_ product= protein kinase, cdc2-related kinase| transcript_ product= protein kinase, cdc2- related kinase| location= MBSY 01000635: 171329- 172321(?)| protein_ length= 330| sequence_ SO= contig| SO= protein_ coding| is_pseudo= false Sequest Unambiguous RFVHR 1 3 BCY84 BCY84 2 2 0.1111 0 HT(A2) DIKPS 17297- _17297- NILISR t36_ t36_1- (SEQ 1-p1 p1; IDNO. XP_814 270) 575.1; XP_806 767.1 3 BCY84_1 transcript= 0.155 1.7985 1 1 1 1 1668 183.8 6.24 8641- BCY84_18641- t36_1-p1 t36_1| gene= BCY84_ 18641| organism= Trypanosoma_ cruzi_cruzi_ strain_Dm28c |gene_ product= hypothetical protein| transcript_ product= hypothetical protein| location= MBSY 01000689: 399673- 404679(+)| protein_ length= 1668| sequence_ SO= contig| SO= protein_ coding| is_pseudo= false Sequest Unambiguous YAQF C19(Car 1 1 BCY84 BCY84 0 3 0.1034 0 HT(A2) MESFS bamidom _18641- 18641- NFDFS ethyl); t36_1- t36_1- IMWYc C23(Car p1 p1 NAGcL bamidom STDVP ethyl) R (SEQ IDNO. 271) 4 BCY84_2 transcript= 0 0.1836 1 1 1 1 4901 535.8 6.55 2768- BCY84_22768- t36_1-p1 t36_1| gene= BCY84_ 22768| organism= Trypanosoma_ cruzi_cruzi_ strain_Dm28c |gene_ product= hypothetical protein| transcript_ product= hypothetical protein| location= MBSY 01000794: 48618- 63323(+)| protein_ length= 4901| sequence_ SO= contig| SO= protein_ coding| is_pseudo= false Sequest Unambiguous HFTGS 1 2 BCY84 TcCLB. 0 3 0.1579 0 HT(A2) TAPR _22768- 507083. (SEQ t36_1- 109:mR IDNO. p1 NA-p1; 272) BCY84 _22768- t36_1- p1 5 TcCLB.5 transcript= 0.091 2.0242 1 1 1 1 494 54.3 6.19 06367.40: TcCLB. mRNA- 506367.40: p1 mRNA| gene= TcCLB. 506367.40 |organism= Trypanosoma_ cruzi_CL_ Brener_ Esmeraldo- like |gene_ product= hypothetical protein, conserved| transcript_ product= hypothetical protein, conserved| location= TcChr39-S: 398908- 400392(-)| protein_ length=494 |sequence_ SO= chromosome |SO= protein_ coding| is_pseudo= false Sequest Unambiguous LHLTG 1 1 TcCLB TcCLB. 1 2 0.3333 0 HT(A2) RLIAK .50636 506367. (SEQ 7.40:m 40:mRN IDNO. RNA- A-p1 273) p1 6 BCY84_1 transcript= 0.064 4.7244 1 1 1 1 254 28.4 9.6 5012- BCY84_15012- t36_1-p1 t36_1| gene= BCY84_15012 |organism= Trypanosoma_ cruzi_cruzi_ strain_Dm28c |gene_ product= hypothetical protein| transcript_ product= hypothetical protein| location= MBSY 01000599: 157191- 157955(-)| protein_ length= 254| sequence_ SO= contig| SO= protein_ coding| is_pseudo= false Sequest Unambiguous TAGDA 1 3 BCY84 TcCLB. 0 2 0.1571 0 HT(A2) AAAG _15012- 510149. GPR t36_1- 100:mR (SEQ p1 NA-p1; IDNO. XP_818 274) 640.1; BCY84 _15012- t36_1- p1 7 BCY84_0 transcript= 0.053 4.9928 1 1 1 1 701 79.5 6.6 1456- BCY84_01456- t36_1-p1 t36_1| gene= BCY84_ 01456| organism= Trypanosoma_ cruzi_cruzi_ strain_Dm28c |gene_ product= hypothetical protein| transcript_ product= hypothetical protein| location= MBSY 01000059: 5809-7914(-) |protein_ length=701 |sequence_ SO= contig| SO= protein_ coding| is_pseudo= false Sequest Unambiguous FLACV C4(Carba 1 2 BCY84 BCY84 0 3 0.4667 0 HT(A2) NDGG midomet _01456- _01456- HcSLFT hyl); t36_1- t36_1- QHEFP C11(Car p1 p1; SEDEF bamidom BCY84 STDFF ethyl) _18460- NEHGK t36_1- (SEQ p1 IDNO. 275) 8 XP_8109 hypothetical 0.053 1.0758 1 1 1 1 1952 210.9 6.77 20.1 protein [Trypanosoma cruzistrain CLBrener] Sequest Unambiguous cTVDIS C1(Carba 1 1 XP_81 XP_810 0 3 0.2466 0 HT(A2) TAGST midomet 0920.1 920.1 ETNIG hyl); DIScR C20(Car (SEQ bamidom IDNO. ethyl) 276) 9 XP_8119 hypothetical 0.053 0.9756 1 1 1 1 1025 115.6 6.01 85.1 protein [Trypanosoma cruzistrain CLBrener] Sequest Selected AVQA C6(Carba 1 1 XP_81 XP_811 1 2 0 0 HT(A2) McRDE midomet 1985.1 985.1 R hyl) (SEQ IDNO. 277) 10 XP_8153 hypothetical 0.101 1.1578 1 1 1 1 950 108.1 8.79 88.1 protein [Trypanosoma cruzistrain CLBrener] Sequest Unambiguous LIDFV 1 2 XP_81 XP_811 0 2 0.5443 0 HT(A2) ENNA 5388.1 863.1; MK XP_815 (SEQ 388.1 IDNO. 278) 11 XP_8102 mucin- 0.068 2.0642 1 1 1 1 436 45.3 4.78 36.1 associated surface protein (MASP) [Trypanosoma cruzistrain CLBrener] Sequest Selected GAGAL 1 1 XP_81 XP_810 1 2 0.0297 0 HT(A2) EKVK 0236.1 236.1 (SEQ IDNO. 279) 12 BCY84_0 transcript= 0.066 1.1123 1 1 1 1 899 94.5 5.66 8138- BCY84_08138- t36_1-p1 t36_1| gene= BCY84_ 08138| organism= Trypanosoma_ cruzi_cruzi_ strain_Dm28c |gene_ product= trans- sialidase |trans- cript_ product= trans- sialidase| location= MBSY 01000386: 3903- 6602(-)| protein_ length= 899| sequence_ SO= contig| SO= protein_ coding| is_pseudo= false Sequest Unambiguous NNDG 1 1 BCY84 BCY84 0 2 0.4958 0 HT(A2) ATGAT _08138- _08138- R t36_1- t36_1- (SEQ p1 p1 IDNO. 280) 13 XP_8033 hypothetical 0.056 3.1976 1 1 1 1 344 37.1 7.69 09.1 protein [Trypanosoma cruzistrain CLBrener] Sequest Unambiguous KEAEA 1 1 XP_80 XP_803 1 2 0.3707 0 HT(A2) ENALN 3309.1 309.1 R (SEQ IDNO. 281) 14 TcCLB.5 transcript= 0.047 2.3172 1 1 1 1 561 62.3 9.25 07083.90: TcCLB. mRNA- 507083.90: p1 mRNA| gene= TcCLB. 507083.90 |organism= Trypanosoma_ cruzi_CL_ Brener_ Esmeraldo- like |gene_ product= hypothetical protein, conserved| transcript_ product= hypothetical protein, conserved| location= TcChr25-S: 339208- 340893(+)| protein_ length= 561| sequence_ SO= chromosome| SO= protein_ coding| is_pseudo= false Sequest Unambiguous RPRLV 1 1 TcCLB TcCLB. 1 4 0.2533 0 HT(A2) YSEDS .50708 507083. EVR 3.90:m 90:mRN (SEQ RNA- A-p1 IDNO. p1 282) 15 BCY84_1 transcript= 0.046 3.2573 1 1 1 1 307 34.4 4.7 3262- BCY84_13262- t36_1-p1 t36_1| gene= BCY84_ 13262| organism= Trypanosoma_ cruzi_cruzi_ strain_ Dm28c| gene_ product= hypothetical protein| transcript_ product= hypothetical protein| location= MBSY 01000938: 10794- 11717(-)| protein_ length= 307| sequence_ SO= contig| SO= protein_ coding| is_pseudo= false Sequest Unambiguous IDLLQ 1 2 BCY84 XP_806 0 2 0.6825 0 HT(A2) AELHK _13262- 363.1; (SEQ t36_1- BCY84 IDNO. p1 _13262- 283) t36_1- p1 16 BCY84_0 transcript= 0 1.9847 1 1 1 1 655 71 6.13 1068- BCY84_01068- t36_1-p1 t36_1| gene= BCY84_ 01068| organism= Trypanosoma_ cruzi_cruzi_ strain_ Dm28c| gene_ product= heatshock 70kDa protein, mitochon- drial precursor| transcript_ product= heatshock 70kDa protein, mitochon- drial precursor| location= MBSY 01000053: 615988- 617955(-)| protein_ length= 655| sequence_ SO= contig| SO= protein_ coding| is_pseudo= false Sequest Unambiguous DSESH 1 6 BCY84 TcCLB. 2 3 0.2514 0 HT(A2) AESDR _01068- 511745. LKR t36_1- 10:mRN (SEQ p1 A-p1; IDNO. XP_819 284) 091.1; BCY84 _01068- t36_1- p1; XP_806 221.1; XP_804 120.1; BCY84 _01069- t36_1- p1 17 XP_8099 mucin- 0 2.5316 1 1 1 1 395 39.8 5.05 01.1 associated surface protein (MASP) [Trypanosoma cruzistrain CLBrener] Sequest Unambiguous mNPEK M1(Oxid 1 1 XP_80 XP_809 2 3 0.2787 0 HT(A2) EKNGR ation) 9901.1 901.1 (SEQ IDNO. 285) 18 XP_8208 hypothetical 0 5.3333 1 1 1 1 225 25.3 7.05 30.1 protein [Trypanosoma cruzistrain CLBrener] Sequest Selected QPHER M6(Oxid 1 3 XP_82 TcCLB. 1 2 0.0263 0 HT(A2) mYcGT ation); 0830.1 510373. IK C8(Carba 80:mRN (SEQ midomet A-p1; IDNO. hyl) XP_809 286) 165.1; XP_820 830.1 The abbreviated words have same meaning as defined in Table 9. All annotated peptides sequences were validated through Blast for Trypanosoma cruzi.
Example 4: Screening Test for Lyme Disease in Children
[0260] Patients enrolled in this study fall into five categories: 1) patients with acute stage Borrelia infection defined by a two-tier serology criteria; 2) Persistent symptoms after treatment following EM rash (PTLDS) symptomatic patients with a clinical diagnosis of PTLDS; 3) patients treated in community centers and private practices with clinical suspicion of tick-borne illnesses but in the absence of clinical information regarding previous symptoms and treatments; 4) diseased controls, which include patients harboring non-tick-borne infections, who are hospitalized in Peru, a geographic region where ticks are very rare, and U.S. patients with a diagnosis of traumatic brain injury and acute respiratory distress syndrome; and 5) healthy controls.
[0261] Specificity of the mass spectrometry analytic method is ensured by a three-tier authentication algorithm which requires stringent filters for peptide identification, 100% amino acid sequence identity with tick-borne pathogen proteins, evolutionary taxonomic verification for related pathogens, and lack of overlap with human or non-tick-borne pathogenic organisms. Identified peptides are verified by concomitant urine western blot immunoassays, orthogonal mass spectrometry based parallel reaction monitoring (PRM), and an animal model of persistent Babesiosis. The parameters for the authentication algorithm are established on a set of acute Lyme patients and negative controls; the method is then applied to a non-overlapping set of non acute patients including PTLDS (category 2) and other patients suspected of tick-borne illnesses (category 3), and negative controls. The correlation between the number of pathogen-specific urinary peptides and the presence or absence of symptoms as assessed by health care professionals is investigated.
[0262] The control group consisted of 100 patients (M/F=1, median age=41, IQR=25.75), including healthy controls and disease control patients diagnosed with acute respiratory distress syndrome, tuberculosis, and traumatic brain injury. Peptides derived from Borrelia species known to be pathogenic in humans were found in 10/10 Lyme borreliosis patients. No peptides derived from other tick borne organism investigated (Babesia, Anaplasma, Rickettsia, Ehrlichia, Bartonella, Francisella, Powassan virus, encephalitis virus, and Colorado tick fever virus) were identified. The list of peptides identified in each patient is reported in Table 13. Identified peptides belonged to different proteins including membrane associated proteins (e.g. OspC), motility proteins (e.g. flagellar motor switch protein FliN), transport proteins (e.g., ABC transporter substrate binding protein, periplasmic oligopeptide binding protein, mechanosensitive ion channel family protein), chemotaxis proteins (e.g. MotA), protein translation and modification proteins (e.g., peptide chain release factor N(5), glutamine methyl transferase), metabolic enzymes (e.g. Chain A, Glyceraldehyde-3-phosphate dehydrogenase, nicotinate phosphoribosyltransferase), RNA and protein metabolism (e.g. translation elongation factor YigZ), and antigens known to elicit immune response (e.g., immunogenic protein P37). A patient was considered positive for a given pathogen if at least two unique peptides deriving unambiguously (100% sequence identity with the pathogen and less than 90% sequence identity with any other organism) from such pathogen were identified. Zero false positive peptides were identified in 100 healthy and diseased controls.
TABLE-US-00011 TABLE 11 Demographic information of patients enrolled in this study. Demographic and clinical characteristics of sample cohort. Acute LB = acute Lyme Borreliosis, PTLDS = post treatment Lyme disease syndrome, NA-TBI = suspected non-acute tick borne infection. Controls Patients Diseased Healthy Characteristics Acute LB PTLDS NA-TBI Controls Controls N 10 36 112 215 35 Age (Median) 52.5 50 46 35.5 31 (IQR = 14) (IQR = 25) (IQR = 32) (IQR = 31) (IQR = 60) Sex Male/Female 4/6 14/22 54/58 112/57 18/17 NA 46 Tick discovered 6Y/1N 11Y/10N 11Y/15N Bull's eye rash 10Y/0N 26Y/5N 24N Joint pain 7Y/0N 22Y/4N 15Y/N Fatigue 7Y/0N 18Y/6N 20Y/4N Fever 7Y/0N 11Y/13 7Y/17N Facial Palsy 1Y/3N 3Y/20N 3Y/21N Neurological 4Y/0N 16Y/7N 9Y/14N Serology (Pos) 10Y/0N 19Y/4N 12Y/14N
TABLE-US-00012 TABLE12 Borreliapeptidesidentifiedintruepositive caseswithEMrashandCDCpositiveserology. Borreliaurinarypeptidesareidentifiedbefore EMrashdevelopment,andreverttonegative aftertherapycompletionandsymptomsresolu- tion.AcuteLymeBorreliosissymptoms=joint pain,fatigue,facialpalsy,neurological symptoms. Under treat- ment Number (at of Acute time identi- LB of fied Sample EM symp- Sero- collec- Borrelia Peptide ID Rash toms logy tion) peptides sequence 108838 Y Y Pos No 3 IDTEEAAVK (SEQID. No.322); NAGNFEIIR SEQID. No.323; VTLSDISTK (SEQID. No.324) 104821 Y Y Pos No 2 AILKTNGDK TLGAAELEK (SEQID. No.325); NNFCLSKSD LEEIR (SEQID. No.326) 790907 Y Y Pos No 2 SNQDNQTLL LSLHQAIAK (SEQID. No.327); LKNSHAELG VAGNGATTD ENAQK (SEQID. No.328) 889597 Y Y Pos Yes 2 GGYLDHVNH (2 AGAKKVILT days VPAK doxyci- (SEQID. cline) No.329) LATVNEAEG K (SEQID. No.330) 213567 Y Y Pos No 2 LATVNEAEG K (SEQID. No.331); NDVSEEKPE IK (SEQID. No.332) 453742 Y* Y* Pos No 3 VVILNEATG K (SEQID. No.333); LATVNEAEG K (SEQID. No.334); FVYIGNVDN MGYTINFK (SEQID. No.335); 463256 Y N Pos No 2 NLSLFTDFY EISMMNAYF IK (SEQID. No.336); QKATGAINA VSGEQIL (SEQID. No.337) 459235 Y Y Pos Yes 2 SAKEVINNT (1 STMEK day (SEQID. doxyci- No.338); cline) SSSVDGFVS FKEYKER (SEQID. No.339) 729340 Y Y Pos No 1 FEDAIVLRD K (SEQID. No.340) 310741 Y Y Pos No 2 VNESDLGIK ALDEK (SEQID. No.341); FNVEACFPT LIVEK *developed Y Y Pos (SEQID. after No.342) collection Yes(1day doxycicline) *POS signifies positive
[0263] Tick-borne pathogen peptides are present in the urine of 40% of nonacute patients with clinical suspicion of tick-borne illnesses
[0264] In the validation phase of the study, urine samples from 148 non acute patients (n=36 PTLDS; n=112 clinically suspected of tick-borne illnesses) and 150 new healthy and diseased controls were analyzed. Patients (M/F=0.45, median age=48, IQR=28.1) reported with symptoms including EM rash, fatigue, fever, joint pain/arthritis, brain fog, memory loss and other neurological symptoms. The control set (M/F=1.75, median age=35, IQR=22) included healthy controls and disease control patients with clinical history of Chagas disease, tuberculosis and traumatic brain injury.
[0265] In an embodiment, 279 unique peptides specifically attributed to microorganisms belonging to the genus Borrelia, Babesia, Anaplasma, Ehrlichia, Bartonella, Rickettsia, and known to be pathogenic in humans were identified in n=108/148 patient samples. No peptides from TBEV and Powassan virus were identified in patients or controls. Peptides matching Borrelia sp. (n=160,
[0266] Urinary Pathogen Peptides Revert to Undetectable Levels after Symptom Resolution.
[0267] Longitudinal study of three patients provided anectdotal evidence that urinary peptides revert to undetectable levels after symptom resolution. Pre and post treatment urine collection was obtained from two acute LB patients. In one case (patient No. of 108838), three Borrelia peptides were identified at the time of positive serology and EM rash. Complete clearing of Borrelia peptides was observed after symptoms resolution with two 14-day courses of doxycycline. In the second patient (No. of 453742), urine was collected at different time points: 1) after tick bite and before EM rash, 2) after development of the characteristic EM rash and before antibiotic treatment, 3) after 2 days of doxycycline treatment while the patient was still symptomatic. Three Borrelia peptides were detected in the urine before development of the EM rash. Borrelia peptides were then confirmed in the urine of the untreated, symptomatic patient. Borrelia peptides were also detected after two days of doxycycline treatment while the patient was still symptomatic (Table 13). A decline in peptide numbers following treatment was found for patient No. of 957477, positive for Erhlichia chaffeensis, whose urine was collected the first day of treatment as well as after two and four weeks (Table 13).
[0268] Table 13. Longitudinal study of two Lyme borreliosis patients, and one non-acute tick-borne disease patient. In patient 108838 (acute LB), Borrelia-specific peptides are identified in presence of acute symptoms (EM rash) and no peptide is detected after symptom resolution (4 weeks of doxycycline). In patient 453742 (acute LB), Borrelia-specific peptides were identified after tick bite but before development of an EM rash. Peptides were detectable in the pre-treatment stage and in presence of EM rash. Peptide count decreased during early treatment (2 days of doxycycline) when the patient was still symptomatic. In patient 957477 (non-acute tick-borne disease) 2 Ehrlichia peptides were identified in the presence of symptoms before starting treatment, 1 peptide after 14 days of doxycyxline and no peptides after 4 weeks of doxycycline.
TABLE-US-00013 TABLE 13 Detection of Borrelia-specific peptides Before Before treatment - Resolution EM (after presence During of Sample ID Clinical Status Pathogen tick bite) of EM treatment symptoms 108838 Acute Lyme Borrelia N/A 3 N/A 0 borreliosis 453742 Acute Lyme Borrelia 3 2 2 N/A borreliosis 957477 PTLDS Ehrlichia N/A 2* 1 0 *EM rash was not present
[0269] Borrelia-Specific Urinary Peptides are Associated with Chemotaxis, Transmembrane Transport, Immune Evasion and Metabolism.
[0270] Peptides (N=160) from Borrelia species were the most abundant among the tick-borne infection pathogens investigated. Gene Ontology (GO) analysis of biological functions indicated that a large number of proteins were associated with chemotaxis, biosynthesis, transmembrane transport, immune evasion and DNA metabolism. Chemotaxis and motility are required for Borrelia to establish infection in the mammalian host. In this study, we identified peptides specific for chemotaxis and motility associated proteins including flagellin, CheA, and MotA. Transmembrane transport plays a role in drug resistance, in parasite-host interaction, in cell signaling and virulence. Urinary peptides associated with transmembrane transport proteins included ABC transporter permease, acriflavine resistance protein, and mechanosensitive ion channel. In response to mammalian host immunity, Borrelia modulates its transcriptional activity to facilitate dissemination and immune evasion. In this study, we identified DNA mismatch repair protein, DNA polymerases, and DNA ligases, which are proteins involved in DNA metabolism. Cell envelope proteins are involved in a number of processes required for Borrelia to establish infection in the mammalian host, including cell adhesion, cell invasion and immune escape. Examples of proteins in this category include outer surface protein A (OspA), outer surface protein B, and outer surface protein C (OspC). Among the proteins identified in the urine of non-acute patients there were 6 known seroreactive proteins: OspA, OspB, OspC, Flagellin, Porin, P37 and OppaIV. OspC and Flagellin are also included in the two-tiered Lyme borreliosis serology according to CDC criteria29. 55 identified proteins are known to be localized in the membrane region (of which n=10 are known to be localized in the outer membrane and n=4 in the inner membrane), 54 in the cytoplasm and 12 in the flagellum (
[0271] Borrelia Peptides in the Cerebrospinal Fluid of a Clinically Suspected Neuroborreliosis Patient are Also Detectable in the Urine (Anectdotal).
[0272] The experimental protocol described in
[0273] The Number of Urinary Peptides Correlates with Presence or Absence of Symptoms in Non Acute Tick Borne Disease Patients.
[0274] Symptoms reported by non acute patients (PTLDS and patients with clinical suspicion of tick-borne illnesses) included previous EM rash, joint pain, fatigue, fever, facial palsy, and other neurological symptoms. A score of a 0 and 1 was attributed in absence or presence of any symptom designated in Table 11. Using an ordinal regression model, we found that for those subjects where clinical data were available (N=46), urinary peptide number was positively correlated with presence or absence of symptoms (p-value <0.001).
[0275] Alignment Analysis Informs Verification of Protein Database Annotation and Unambiguous Species Attribution of Urinary Peptides.
[0276] Alignment analysis within evolutionarily related organisms in the clade was conducted to achieve two goals: 1) verification of the protein database annotation, and 2) attribution of the peptide to an organism at the species level. In order to achieve the former, full length sequence of the protein associated with each urinary peptide was retrieved from the highest-ranking species in FASTA format and compared to homologous proteins (data from Basic Local Alignment Search Tool (BLAST)). In the case of Borrelia, annotated species of Borrelia were used, including: Borrelia burgdorferi, Borrelia garinii, Borrelia afzelii, Borrelia bavariensis, Borrelia mayonii, Borrelia miyamotoi, Borrelia hermsii, Borrelia turicatae, Borrelia chilensis, Borrelia duttonii, Borrelia. If the protein demonstrated greater than 60% homology, over the full query length, with other species in the query, then the database annotation was validated. In this study, protein database annotation was validated in all the instances and no rejection was necessary. In order to attribute peptides to an organism at the species level, the peptide sequence was studied in the context of homologous proteins in the clade. A peptide was unambiguously attributed to a species if the peptide sequence had 100% match with the given species and less than 90% sequence identity to any other species investigated. Species variation can be an important cause of diagnostic inaccuracy due to lack of reactivity of detection reagents.
[0277] Orthogonal Technologies Western Blot Analysis and Parallel Reaction Monitoring Confirm Urinary Peptide Identification.
[0278] Pathogen-specific, urinary peptides were confirmed using affinity particle enrichment and two orthogonal approachesParallel Reaction Monitoring (PRM) and western blotting. For the former, N=3 peptides from OspA, OspC, and flagellar proteins were chosen based on the discovery full scan MS/MS results on patient samples and on additional LC-MS/MS analysis of healthy volunteer urine spiked with recombinant proteins. Peptide AVEIKTLDELK (SEQ ID NO. 345) deriving from OspA was confirmed by PRM analysis in four patient samples that yielded this peptide in the discovery MS/MS analysis (
[0279] Babesia microti Derived Peptides are Detected in the Urine and Blood of an Animal Model of Persistent Infection and Correlate with Parasitemia.
[0280] In order to substantiate the hypothesis that peptides derived from a tick-borne pathogen in later phases of infection can be detected in peripheral body fluids such as urine, we analyzed bodily fluids derived from golden hamsters (Mesocricetus auratus) infected with Babesia microti. Six golden hamsters with parasitemia ranging from 0% to 42% and one uninfected control were studied at different times after infection, ranging from 3 to 6 months to mimic chronic infection. PCR to Babesia ITS regions30 was used to confirm infection loads. 870 unique Babesia peptides belonging to 319 proteins were identified in red blood cells (RBC), plasma and urine. The number of Babesia proteins in the RBC compartment correlated with levels of parasitemia by linear regression analysis (p<0.0001). Even though the site of Babesia infection is the blood, Babesia derived peptides were detected in the urine of hamsters at late stage of infection (
[0281] In one embodiment, the 3-tier authentication algorithm, which requires 100% amino acid sequence identity with tick-borne pathogen proteins, evolutionary taxonomic verification for related pathogens, and lack of overlap with human or any other organism, dramatically reduces the number of false positives that would have been otherwise called using direct MS sequencing by conventional MS software. Biologic and technical validation of the algorithm employs CDC criteria, serology positive acute Lyme patients, concomitant urine western blot immunoassays, orthogonal targeted identification using PRM, and an animal model of persistent Babesiosis. PRM is a targeted proteomic approach able to simultaneously monitor all fragment ions derived from selected peptides with high resolution and accuracy. Orthogonality between discovery phase and PRM can be obtained through a different combination of fragmentation strategies and mass analyzers. In discovery, precursors were fragmented with collision induced dissociation (CID), and product ions measured in the ion trap analyzer; in PRM, fragmentation was obtained with high energy collision induced dissociation (HCD) and product ions were measured in the Orbitrap? mass spectrometer. Stringent mass tolerance filters (?1 ppm) were applied to the product ions in the spectra, allowing for a highly confident peptide identification.
[0282] In one embodiment, the method yielded zero false positives in 250 diseased and healthy controls and identified up to five specific urinary Borrelia peptides in 10 acute LB patients, including proteins that are included in the panel for the standard Lyme serological test (Table 13). we were able to anectdotically observe a decrease in the number of peptides during antibiotic treatment and absence of tick-borne pathogen peptides after successful treatment and symptom remission.
[0283] In one embodiment, Addressing the question of persistent infection, 279 different urinary peptides, derived from the surface or subcellular compartments of pathogenic strains of tick-borne pathogens, were identified in non acute patients (PTLDS and patients with clinical suspicion of tick-borne illnesses). In 40% (n=59/148) of them we identified two or more peptides unique for at least one tick-borne pathogen and the number of urinary pathogen derived peptides correlated with the presence or absence of symptoms (p<0.001) reported by the treating physician when available. 32% (n=48/155) of patients presented peptides derived from one pathogen, while 7% presented (n=10/148) peptides from two pathogens, and less than 1% (n=1/148) presented 3 pathogens.
[0284] Borrelia was the most frequently represented organism. A large number of identified proteins are located on the membrane surface and several are known to be antigenic. It is important to note that Borrelia undergoes several changes during host infections which require the production of new membrane proteins that could be used for immune evasion or adaptation to the new environment. Multiple proteins identified herein are currently recognized as antigens in the standard serological test: OspC, Flagellin. Among the Borrelia genus, the highest number of peptides were derived from species related to Lyme borreliosis.
[0285] In this study, at least two different peptides associated with Borrelia were found in n=48/148 non acute patients suspected of tick-borne illnesses. Represented Borrelia species included Lyme-associated as well as TBRF-associated species. In many subjects both were found. 66 unique peptides specific for TBRF Borrelia species were found including 24 peptides from Borrelia miyamotoi which is being diagnosed in the United States in an increasing number of patients. Recent evidence shows that TBRF Borrelia species can also be carried by Ixodes ticks, the same vector that transmits Lyme borreliosis. TBRF is an often-neglected disease and may go underdiagnosed in many patients. In fact, TBRF patients can yield a positive serology for Lyme borreliosis because of proteins with overlapping antigenic similarities with Lyme Borrelia species, thus its true prevalence can be underestimated.
[0286] Method to Design Experiment 4
[0287] Study design. A method consisting of sample pre-analytical concentration, mass spectrometry analysis and a novel peptide authentication algorithm was applied to 408 urine patient specimens (Table 12) in order to discern the presence of peptides belonging to the proteome of selected tick-borne pathogens. Urine samples were subjected to pre-analytical concentration and mass spectrometry analysis. Urine specimens were divided in a training (N=110 patients, 10 cases and 100 controls) and a non-overlapping validation (N=298 patients, 148 cases and 150 controls) set that were used to establish the parameters of the peptide authentication algorithm to ensure that identified peptide sequences were uniquely attributable to tick-borne pathogens. The algorithm included four steps: 1) determination of physical and statistical parameters for mass spectrum matching, 2) BLAST searches of peptides longer 7 amino acids to ensure that the selected peptide sequence has percentage identity lower than 100% with proteins of non-tick pathogen organisms, and 3) validation of protein database annotation via alignment with homologous proteins of evolutionary related organisms in the clade. At the conclusion of the analysis, we performed manual quality check of spectra and we did not find any discrepancy or incorrect attributions. Peptides identified with the method were verified using Western Blot analysis.sup.104, parallel reaction monitoring.sup.22 and an animal model of persistent Babesia microti infection.sup.105. The correlation of urinary peptides derived from tick-borne pathogen with patient symptoms was investigated.
[0288] Patient Study Cohorts.
[0289] Urine samples were collected from consented (IRB Pro00008518, Chesapeake IRB) number patients who were suspected of having tick-borne diseases in different geographic regions at high risk for tick-borne diseases in the US and Europe (clinics: Hope McIntyre, MD, Maryland; Deborah Hoadley MD LLC, Massachusetts; Innatoss Laboratories B.V., Netherlands). Acceptance criteria for 1) acute LB patients (N=10) included the characteristic erythema migrans (EM) rash and positive two-tier LB serology according to CDC criteria. Non acute patients suspected of tick-borne illnesses include: 2) PTLDS patients (N=36); acceptance criteria included previous LB diagnosis and persistence of symptoms following antibiotic therapy for LB according to the Infectious Disease Society of America guidelines; 3) other non acute patients suspected of tick-borne disease (n=112): acceptance criteria for other non acute symptomatic patients included clinical suspicion of tick-borne illnesses by treating physisician based on symptoms including joint pain, fever, neurologic impairment, neuropathy, fatigue, and depression. This study met the requirements for IRB approval (Pro00008518, Chesapeake IRB). An informed consent form was signed by all patients enrolled in this study and by their treating physicians. If the patient was a minor, written consent and assent from the subject, was obtained from a parent or legal guardian. All methods were performed in accordance with relevant guidelines and regulations. Clinical and demographic data included age, sex, previous tick-borne disease diagnosis, self-reported symptoms, and physician assessed symptoms. Urine specimens were collected from 215 diseased controls and 35 healthy volunteers (Table S3) from the US and Peru. Diseased negative controls included hospitalized patient affected by HIV infection, tuberculosis, Chagas disease, and acute respiratory distress syndrome (ARDS) following traumatic brain injury. Diagnosis of pulmonary tuberculosis was verified by sputum smear microscopy and culture methods. HIV infection was confirmed by HIV nucleic acid amplification test and CD4 count. Chagas disease status was determined by microscopy examination of blood smears and quantitative PCR analysis of blood. ARDS patients were diagnosed using the Berlin Definition criteria that include bilateral lung infiltrates detected with chest X-rays, pulmonary capillary pressure ?18 mmHg, and oxygenation levels PaO2/FiO2?200 mmHg.
[0290] Collection of Bio-Fluids from Patients Under Evaluation for Acute Lyme Borreliosis and Non Acute Patients Suspected of Tick-Borne Illnesses
[0291] Matched coded clinical records and LB serology results were also provided under patient consent. Urine samples from US-based collection sites were refrigerated immediately after collection and sent to George Mason University in refrigerated containers within 24 hours from collection; samples were then frozen at ?80? C. upon arrival. Urine samples from European collection sites were immediately frozen upon collection, transferred to George Mason University in dry ice and stored at ?80? C. Cerebrospinal fluid (CSF) was collected by lumbar puncture. The CSF sample was immediately placed in dry ice, shipped from Massachusetts to Mason in dry ice, and kept at ?80? C. until analysis.
[0292] Affinity Particle Processing of Biofluids from Patient Subjects
[0293] 500 ?l of cerebrospinal fluid from patients suspected of tick borne illnesses were centrifuged at 3,750?g for 15 minutes, the pellet was discarded, and supernatant was recovered and diluted with 500 ?l Tris-HCl 50 mM, pH 7.2. Urine samples (at least 42 ml) were thawed in warm water (approx. 37? C.) on an orbital shaker. Urinalysis was performed using a Multistix 10 SG reagent strip. Urine was transferred into 50 ml tubes and centrifuged at 3,700?g for 15 minutes. Urine was decanted into a new tube and the pellet was discarded. pH was adjusted to 5.5 incrementally adding 1 M hydrochloric acid or 1 M sodium hydroxide. 40 ml of urine sample was transferred into a 50 ml polycarbonate tube. Urine and CSF samples were incubated with 200 ?l affinity particles (10 mg/ml) for 30 minutes at RT. CSF samples were centrifuged at 16,100?g for 20 minutes while urine samples at 19,000?g (Beckman Avanti JXN-26 Centrifuge) for 45 minutes. Supernatants from CSF and urine samples were discarded. Particle pellet was washed twice by vigorously resuspending it in 1 ml 18 MQ-cm water followed by centrifugation at 16,100?g for 20 minutes. Supernatant was discarded and particle pellet was resuspended in 20 ?l of elution buffer solution (4% Sodium Dodecyl Sulfate (SDS) in 50 mM ammonium bicarbonate), and incubated for 20 minutes at RT. Samples were centrifuged at 16,100?g for 20 minutes. Eluates were saved and transferred into new tubes and processed for mass spectrometry as described further.
[0294] Mass Spectrometry Analysis
[0295] Eluates were reduced using 200 mM dithiothreitol at room temperature for 15 minutes and alkylated using 50 mM iodacetamide at room temperature in the dark for 20 minutes. The enzymatic digestion ran overnight with 2 ?l of (0.5 ?g/?l) of sequencing grade trypsin (Promega, V5113) in 50 mM ammonium bicarbonate pH 8 at 37? C. Digestion was then stopped by adding 2 ?l of 100% trifluoracetic acid (TFA). Digested samples were then desalted with C-18 spin columns (Pierce, No. of89870). Final eluates were dried with a nitrogen evaporator (Microvap 118, Organomation Associates, Inc). Samples were reconstituted in 10 ?l of 0.1% Formic Acid. LC-MS/MS was performed on an Orbitrap Fusion? Tribrid? Mass Spectrometer (Thermo Scientific) coupled with a nanospray EASY-nLC 1200 UHPLC. Reversed-phase chromatography separation of the peptide mixture was performed using PepMap RSLC 75 ?m i.d.?15 cm long with 2 ?m, C18 resin LC column (ThermoFisher). 0.1% formic acid as mobile phase A, and 0.1% formic acid, 80% acetonitrile mobile phase B were used. Samples were peptides were eluted using a linear gradient of 5% mobile phase B to 50% mobile phase B in 90 min at 300 nL/min, then to 100% mobile phase B for an additional 2 min. The Thermo Orbitrap Fusion? Tribrid? Mass Spectrometer (Thermo Scientific) was operated in a data-dependent mode in which each full MS scan was followed by TopN MS/MS scans of the most abundant molecular ions with charge states form 2+ to 4+ were dynamically selected for collision induced dissociation (CID) using a normalized collision energy of 35%. Tandem mass spectra were searched against microorganism databases with Proteome Discoverer 2.1 software using tryptic cleavage constraints. Databases for the following microorganisms were downloaded from NCBI, UniProt, and PiroplasmaDB: Borrelia burgdorferi, Borrelia mayonii, Borrelia afzelii, Borrelia garinii, Borrelia spielmani, Borrelia bavariensis, Borrelia hermsii, B. turicatae, B. parkeri, B. miyamotoi, Babesia microti, Francisella tularensis, Ehrlichia chaffeensis, Rickettsia rickettsiae, Rickettsia parkeri, Rickettsia species 364D, Rickettsia akari, Anaplasma phagocytophilum, Bartonella henselae, Powassan virus, Tick-borne encephalitis virus, Colorado tick fever virus. In the training phase of the method databases were modified in order to exclude peptide sequences whose spectrum overlaps with sample contaminants.
[0296] Three-Tier Peptide Identification and Authentication Algorithm
[0297] We developed an algorithm to perform peptide authentication, which incorporates stringent filtering criteria in order to minimize the false positive rate. The algorithm includes the following steps: [0298] A) Statistical and physical parameters for spectrum matching. 1) Peptide false discovery rate (FDR) based on forward-reverse decoy <1%, 2) Xcorr >2.0, >3.0 and >4.0 for 2+, 3+, 4+ precursor ions, 3) q-value <0.05, 4) precursor ion mass tolerance <2 ppm and fragment ion mass tolerance <0.5 Da, 5) If precursor is triply-charged: 5.1) Presence of a basic residue (K, R, H) within the sequence (excluding N-terminus and C-terminus residues), and 5.2) Presence of corresponding doubly charged precursor ion in the full mass chromatogram (MS1). [0299] B) Unambiguous peptide attribution to one microorganism. In order to exclude peptides that share amino acid sequence with other organisms, each peptide attributed to a tick-borne pathogen was subjected to BLAST searches against the NCBI Reference Sequence database (RefSeq).sup.109, a comprehensive dataset containing the available protein sequence information for any given species. A peptide showing 100% identity to any additional species included in the RefSeq database beyond the intended tick-borne pathogen was discarded. Peptide sequences shorter than 7 amino acids were discarded in order to minimize random error of attribution when searching for short-peptide sequences.sup.110. Date and time of BLAST search and database download were recorded. [0300] C) Validation of protein database annotation. The full-length protein, to which every peptide was attributed, was aligned with homologous proteins of evolutionary related organisms in the clade. If the full-length protein had greater than 60% identity with proteins in the query, the database annotation was considered valid.
[0301] Attribution of urinary peptides to an organism at the species level was conducted as follows. Full length homologous proteins in related microorganism were aligned using the JalView software. For Borrelia, the following species were taken into consideration: Borrelia burgdorferi, Borrelia garinii, Borrelia afzelii, Borrelia bavariensis, Borrelia mayonii, Borrelia miyamotoi, Borrelia hermsii, Borrelia turicatae, Borrelia recurrentis, Borrelia chilensis, Borrelia crocidurae, Borrelia duttonii, Borrelia bissettii. A peptide showing 100% identity to a single species and <90% to other species was attributed to the microorganism at the species level. A peptide showing 100% identity to one or more species and >90% identity to different species was not attributed to the microorganism at the species level, and all the species with 100% identity were reported.
[0302] Targeted Peptide Identification with Parallel Reaction Monitoring
[0303] LC-MS/MS was performed on an Orbitrap Fusion? Tribrid? Mass Spectrometer (Thermo Scientific) coupled with a nanospray EASY-nLC 1200 UHPLC. Reversed-phase chromatography was performed using PepMap RSLC 75 ?m i.d.?15 cm long with 2 ?m, C18 resin LC column (ThermoFisher). Peptides were eluted using a linear gradient of 5% mobile phase B to 50% mobile phase B in 15 min at 300 nL/min, then to 100% mobile phase B for an additional 2 min. The Orbitrap Fusion was operated in data independent acquisition parallel reaction monitoring mode. A targeted list of precursor ions of the peptides of interest AVEIKTLDELK (SEQ ID NO. 345) (m/z=420.24; z=3), LKNSHAELGVAGNGATTDENAQK SEQ ID. No. 328) (m/z=775.72; z=2), NDVSEEKPEIK (m/z=644.32) were isolated and fragmented by Higher-energy C-trap dissociation (HCD) with 35% normalized collision and detected at a mass resolution of 60,000. The data were then analyzed using Skyline v3.6 (University of Washington, MacCoss Lab) to determine the presence or absence of peptides of interest.
[0304] Propagation of Babesia microti in Hamsters
[0305] Babesia microti GI (BEI Resources NR-44070; ATCC? PRA-398?) was originally isolated from blood obtained from a human case of babesiosis in Nantucket, Massachusetts, USA, in 1983.sup.111,112 The isolate was maintained by in vivo propagation in Golden Syrian hamsters (Harlan Laboratories, stock: HsdHan:AURA) according to published protocols.sup.113,114 and procedures approved by the ATCC? IACUC. Ten hamsters were inoculated with ?10.sup.8 parasitized erythrocytes in 0.5 ml of blood. Blood samples were collected by the peri-orbital route following inhalational anesthesia with isoflurane and parasitemia was determined by microscopic examination of Giemsa-stained blood films at different times of infection. A minimum of 500 erythrocytes were counted to calculate the percent parasitemia of each sample. This included all parasitized cells regardless of intraerythrocytic stage or number of parasites per cell. After 30 days of infection, four hamsters (acute group) were anesthetized by ketamine injection (50 mg/kg) and 0.5 ml of blood with and without heparin was collected from each animal. Urine samples (?0.1 ml) were collected directly from the bladders with a syringe during abdominal surgery and animals were subsequently euthanized using carbon dioxide inhalation. The six remaining hamsters (chronic group) were monitored for 6 months and blood and urine samples were collected as described above.
Statistical Analysis
[0306] Ordinal regression analysis was performed to evaluate correlation between the number of urinary pathogen derived peptides and presence or absence of clinical symptoms in non acute symptomatic patients suspected of tick-borne diseases. Linear regression analysis was performed to evaluate the correlation of the number of Babesia derived peptides with parasitemia in the hamster animal model experiment. T-test was used to test the significance of regression. Statistical analyses were performed using SPSS v.19.0(IBM Corp.). Descriptive statistical analysis of data derived from LD and non acute patients, controls, and hamsters was performed using Python 3 Pandas library and MicrosoftExcel. Visualization were obtained using Python 3 Matplotlib 3.1.1, Seaborn 9.0 libraries and Excel.
INCORPORATION BY REFERENCE
[0307] Throughout this application, various references including publications, patents, and pre-grant patent application publications are referred to. Disclosures of these publications in their entireties are hereby incorporated by reference into this application to more fully describe the state of the art to which this invention pertains. It is specifically not admitted that any such reference constitutes prior art against the present application or against any claims thereof. All publications, patents, and pre-grant patent application publications cited in this specification are herein incorporated by reference, and for any and all purposes, as if each individual publication or patent application were specifically and individually indicated to be incorporated by reference. In the case of inconsistencies, the present disclosure will prevail.
REFERENCES
[0308] 1. Schmidt, R., et al., Single-molecule detection on a protein-array assay platform for the exposure of a tuberculosis antigen. J Proteome Res, 2011. 10(3): p. 1316-22. [0309] 2. Paris, L., et al., Urine lipoarabinomannan glycan in HIV-negative patients with pulmonary tuberculosis correlates with disease severity. Sci Transl Med, 2017. 9(420). [0310] 3. Marais, B. J., Childhood tuberculosis: epidemiology and natural history of disease. Indian J Pediatr, 2011. 78(3): p. 321-7. [0311] 4. Vass all, A., et al., Rapid diagnosis of tuberculosis with the Xpert MTB/RIF assay in high burden countries: a cost-effectiveness analysis. PLoS Med, 2011. 8(11): p. e1001120. [0312] 5. Cruz, A. T., P. A. Revell, and J. R. Starke, Gastric Aspirate Yield For Children With Suspected Pulmonary Tuberculosis. J Pediatric Infect Dis Soc, 2013. 2(2): p. 171-4. [0313] 6. Peter, J., et al., Urine for the diagnosis of tuberculosis: current approaches, clinical applicability, and new developments. Curr Opin Pulm Med, 2010. 16(3): p. 262-70. [0314] 7. Peter, J. G., G. Theron, and K. Dheda, Urine antigen test for diagnosis of HIV-associated tuberculosis. Lancet Infect Dis, 2012. 12(11): p. 825; author reply 826-7. [0315] 8. Shah, S. Biomagnetics Announces the First Urine-Based Test for Tuberculosis. MedGadget 2011; Available from: http://www.medgadget.com/2011/05/biomagnetics_announces_the_first_urinebased_test_for_tub erculosis.html. [0316] 9. Gaur, R. L., et al., LprG-mediated surface expression of lipoarabinomannan is essential for virulence of Mycobacterium tuberculosis. PLoS Pathog, 2014. 10(9): p. e1004376. [0317] 10. Kim, J. S., et al., Crystal structure and functional implications of LprF from Mycobacterium tuberculosis and M. bovis. Acta Crystallogr D Biol Crystallogr, 2014. 70(Pt 10): p. 2619-30. [0318] 11. Heydari, A. A., M. R. Movahhede Danesh, and K. Ghazvini, Urine PCR evaluation to diagnose pulmonary tuberculosis. Jundishapur J Microbiol, 2014. 7(3): p. e9311. [0319] 12. Castro-Sesquen, Y. E., et al., Use of a novel chagas urine nanoparticle test (chunap) for diagnosis of congenital chagas disease. PLoS Negl Trop Dis, 2014. 8(10): p. e3211. [0320] 13. Castro-Sesquen, Y. E., et al., Use of a Chagas Urine Nanoparticle Test (Chunap) to Correlate with Parasitemia Levels in T. cruzi/HIV Co-infected Patients. PLoS Negl Trop Dis, 2016. 10(2): p. e0004407. [0321] 14. Douglas, T. A., et al., The use of hydrogel microparticles to sequester and concentrate bacterial antigens in a urine test for Lyme disease. Biomaterials, 2011. 32(4): p. 1157-66. [0322] 15. Longo, C., et al., Core-Shell Hydrogel Particles Harvest, Concentrate and Preserve Labile Low Abundance Biomarkers. PLoS ONE, 2009. 4(3). [0323] 16. Luchini, A., V. Espina, and L. A. Liotta, Protein painting reveals solvent-excluded drug targets hidden within native protein-protein interfaces. Nat Commun, 2014. 5: p. 4413. [0324] 17. Magni, R., et al., Application of Nanocage technology for high sensitivity measurement of urinary outer surface protein A carboxyl-terminus domain in early stage Lyme borreliosis. J Transl Med, 2015. 13: p. 346. [0325] 18. Shafagati, N., et al., The use of Nanocage particles for biodefense and emerging infectious disease diagnostics. Pathog Dis, 2014. 71(2): p. 164-76. [0326] 19. Paris, L., et al., Urine lipoarabinomannan (LAM) glycan in HIV negative patients with pulmonary tuberculosis correlates with disease severity. Science Translational Medicine. In Press. [0327] 20. Aebischer, T., et al., A critical role for lipophosphoglycan in proinflammatory responses of dendritic cells to Leishmania mexicana. European Journal of Immunology, 2005. 35(2): p. 476-486. [0328] 21. Fredolini, C., et al., Concentration and Preservation of Very Low Abundance Biomarkers in Urine, such as Human Growth Hormone (hGH), by Cibacron Blue F3G-A Loaded Hydrogel Particles. Nano Research, 2008. 1(6): p. 502-518. [0329] 22. Fredolini, C., et al., Nanoparticle technology: amplifying the effective sensitivity of biomarker detection to create a urine test for hGH. Drug Test Anal, 2009. 1(9-10): p. 447-54. [0330] 23. Tamburro, D., et al., Multifunctional Core-Shell Nanoparticles: Discovery of Previously Invisible Biomarkers. J Am Chem Soc, 2011. 133: p. 19178-19188. [0331] 24. Luchini, A., et al., Smart hydrogel nanoparticles for serum cancer biomarkers harvesting. Proceedings of the American Association for Cancer Research Annual Meeting, 2007. 48: p. 587-588. [0332] 25. Nozawa, N., et al., Real-time PCR assay using specimens on filter disks as a template for detection of cytomegalovirus in urine. J Clin Microbiol, 2007. 45(4): p. 1305-7. [0333] 26. McDonough, J. A., et al., The twin-arginine translocation pathway of Mycobacterium smegmatis is functional and required for the export of mycobacterial beta-lactamases. J Bacteriol, 2005. 187(22): p. 7667-79. [0334] 27. Moore, D. A., et al., Microscopic observation drug susceptibility assay, a rapid, reliable diagnostic test for multidrug-resistant tuberculosis suitable for use in resource-poor settings. J Clin Microbiol, 2004. 42(10): p. 4432-7. [0335] 28. Shea, Y. R., et al., High sensitivity and specificity of acid-fast microscopy for diagnosis of pulmonary tuberculosis in an African population with a high prevalence of human immunodeficiency virus. J Clin Microbiol, 2009. 47(5): p. 1553-5. [0336] 29. Tamburro, D., et al., Multifunctional Core-Shell Nanoparticles: Discovery of Previously Invisible Biomarkers. Journal of the American Chemical Society, 2011. 133(47): p. 19178-19188. [0337] 30. Gunther, S., et al., IL-1 Family Cytokines Use Distinct Molecular Mechanisms to Signal through Their Shared Co-receptor. Immunity, 2017. 47(3): p. 510-523.e4. [0338] 31. Steinberg, H. E., et al., Toward detection of toxoplasmosis from urine in mice using hydro-gel nanoparticles concentration and parallel reaction monitoring mass spectrometry. Nanomedicine, 2017. 14(2): p. 461-469. [0339] 32. Shell, S. S., et al., Leaderless Transcripts and Small Proteins Are Common Features of the Mycobacterial Translational Landscape. PLoS Genet, 2015. 11(11): p. e1005641. [0340] 33. Higdon, R. and E. Kolker, A predictive model for identifying proteins by a single peptide match. Bioinformatics, 2007. 23(3): p. 277-80. [0341] 34. Silvanovich, A., et al., The value of short amino acid sequence matches for prediction of protein allergenicity. Toxicol Sci, 2006. 90(1): p. 252-8. [0342] 35. Nicodeme, P., Fast approximate motif statistics. J Comput Biol, 2001. 8(3): p. 235-48. [0343] 36. CDRH, F., USDHHS, Statistical Guidance on Reporting Results from Studies Evaluating Diagnostic Tests. 2007. [0344] 37. Acute Respiratory Distress Syndrome: The Berlin Definition. JAMA 307, 2526-2533 (2012). [0345] 38. Aebischer, T., et al., A critical role for lipophosphoglycan in proinflammatory responses of dendritic cells to Leishmania mexicana. European Journal of Immunology, 2005. 35(2): p. 476-486. [0346] 39. Aucott, J. N., Crowder, L. A. & Kortte, K. B. Development of a foundation for a case definition of post-treatment Lyme disease syndrome. Int. J. Infect. Dis. IJID Off. Publ. Int. Soc. Infect. Dis. 17, e443-449 (2013). [0347] 40. Aucott, J. N., Rebman, A. W., Crowder, L. A. & Kortte, K. B. Post-treatment Lyme disease syndrome symptomatology and the impact on life functioning: is there something here? Qual. Life Res. 22, 75-84 (2013). [0348] 41. Barbour, A. G. et al. A Genome-Wide Proteome Array Reveals a Limited Set of Immunogens in Natural Infections of Humans and White-Footed Mice with Borrelia burgdorferi. Infect. Immun. 76, 3374-3389 (2008). [0349] 42. Barbour, A. G., Adeolu, M. & Gupta, R. S. Division of the genus Borrelia into two genera (corresponding to Lyme disease and relapsing fever groups) reflects their genetic and phenotypic distinctiveness and will lead to a better understanding of these two groups of microbes (Margos et al. (2016) There is inadequate evidence to support the division of the genus Borrelia. Int. J. Syst. Evol. Microbiol. doi: 10.1099/ijsem.0.001717). Int. J. Syst. Evol. Microbiol. 67, 2058-2067 (2017). [0350] 43. Bergmann, A. R., Schmidt, B. L., Derler, A.-M. & Aberer, E. Importance of Sample Preparation for Molecular Diagnosis of Lyme Borreliosis from Urine. J. Clin. Microbiol. 40, 4581-4584 (2002). [0351] 44. Billeter, S. A., Levy, M. G., Chomel, B. B. & Breitschwerdt, E. B. Vector transmission of Bartonella species with emphasis on the potential for tick transmission. Med. Vet. Entomol. 22, 1-15 (2008). [0352] 45. Blanda, V. et al. A retrospective study of the characterization of Rickettsia species in ticks collected from humans. Ticks Tick-Borne Dis. 8, 610-614 (2017). [0353] 46. Bogovic, P. & Strle, F. Tick-borne encephalitis: A review of epidemiology, clinical characteristics, and management. World J. Clin. Cases WJCC 3, 430-441 (2015). [0354] 47. Breitschwerdt, E. B. Bartonellosis: One Health Perspectives for an Emerging Infectious Disease. ILAR J. 55, 46-58 (2014). [0355] 48. Brettschneider, S., Bruckbauer, H., Klugbauer, N. & Hofmann, H. Diagnostic Value of PCR for Detection of Borrelia burgdorferi in Skin Biopsy and Urine Samples from Patients with Skin Borreliosis. J. Clin. Microbiol. 36, 2658-2665 (1998). [0356] 49. Brown, L. D. & Macaluso, K. R. Rickettsia felis, an Emerging Flea-Borne Rickettsiosis. Curr.
[0357] Trop. Med. Rep. 3, 27-39 (2016). [0358] 50. CDRH, F., USDHHS, Statistical Guidance on Reporting Results from Studies Evaluating Diagnostic Tests. 2007. [0359] 51. Cerar, T. et al. Validation of cultivation and PCR methods for diagnosis of Lyme neuroborreliosis. J. Clin. Microbiol. 46, 3375-3379 (2008). [0360] 52. Clinicians I Tick-borne Relapsing Fever (TBRF) I CDC. (2018). Available at: https://www.cdc.gov/relapsing-fever/clinicians/index.html. (Accessed: 13 Apr. 2019) [0361] 53. Cluss, R. G., Silverman, D. A. & Stafford, T. R. Extracellular secretion of the Borrelia burgdorferi Oms28 porin and Bgp, a glycosaminoglycan binding protein. Infect. Immun. 72, 6279-6286 (2004). [0362] 54. Cornillot, E. et al. A targeted immunomic approach identifies diagnostic antigens in the human pathogen Babesia microti. Transfusion (Paris) 56, 2085-2099 (2016). [0363] 55. Crossland, N. A., Alvarez, X. & Embers, M. E. Late Disseminated Lyme Disease: Associated Pathology and Spirochete Persistence Posttreatment in Rhesus Macaques. Am. J. Pathol. 188, 672-682 (2018). [0364] 56. Cruz, A. T., P. A. Revell, and J. R. Starke, Gastric Aspirate Yield For Children With Suspected Pulmonary Tuberculosis. J Pediatric Infect Dis Soc, 2013. 2(2): p. 171-4. [0365] 57. Cullen, J. M. & Levine, J. F. Pathology of experimental Babesia microti infection in the Syrian hamster. Lab. Anim. Sci. 37, 640-643 (1987). [0366] 58. de Sousa, R. et al. Rickettsia slovaca Infection in Humans, Portugal. Emerg. Infect. Dis. 19, 1627-1629 (2013). [0367] 59. Diuk-Wasser, M. A., Vannier, E. & Krause, P. J. Coinfection by the tick-borne pathogens Babesia microti and Borrelia burgdorferi: ecological, epidemiological and clinical consequences. Trends Parasitol. 32, 30-42 (2016). [0368] 60. Donta, S. T. Issues in the Diagnosis and Treatment of Lyme Disease. Open Neurol. J. 6, 140-145 (2012). [0369] 61. Dworkin, M. S., Schwan, T. G., Anderson, D. E. & Borchardt, S. M. Tick-Borne Relapsing Fever. Infect. Dis. Clin. North Am. 22, 449-viii (2008). [0370] 62. Eldin, C., Jaulhac, B., Mediannikov, O., Arzouni, J.-P. & Raoult, D. Values of diagnostic tests for the various species of spirochetes. Med. Mal. Infect. (2019). doi:10.1016/j.medmal.2019.01.009 [0371] 63. Elelu, N. Tick-borne relapsing fever as a potential veterinary medical problem. Vet. Med. Sci. 4, 271-279 (2018). [0372] 64. Elton, C. M., Rodriguez, M., Ben Mamoun, C., Lobo, C. A. & Wright, G. J. A library of recombinant Babesia microti cell surface and secreted proteins for diagnostics discovery and reverse vaccinology. Int. J. Parasitol. 49, 115-125 (2019). [0373] 65. Fatmi, S. S., Zehra, R. & Carpenter, D. O. Powassan Virus-A New Reemerging Tick-Borne Disease. Front. Public Health 5, (2017). [0374] 66. Fredolini, C., et al., Concentration and Preservation of Very Low Abundance Biomarkers in Urine, such as Human Growth Hormone (hGH), by Cibacron Blue F3G-A Loaded Hydrogel Particles. Nano Research, 2008. 1(6): p. 502-518. [0375] 67. Fredolini, C., et al., Nanoparticle technology: amplifying the effective sensitivity of biomarker detection to create a urine test for hGH. Drug Test Anal, 2009. 1(9-10): p. 447-54. [0376] 68. Gasmi, S. et al. Detection of municipalities at-risk of Lyme disease using passive surveillance of Ixodes scapularis as an early signal: A province-specific indicator in Canada. PloS One 14, e0212637 (2019). [0377] 69. Gaur, R. L., et al., LprG-mediated surface expression of lipoarabinomannan is essential for virulence of Mycobacterium tuberculosis. PLoS Pathog, 2014. 10(9): p. e1004376. [0378] 70. Girard, Y. A., Fedorova, N. & Lane, R. S. Genetic Diversity of Borrelia burgdorferi and Detection of B. bissettii-Like DNA in Serum of North-Coastal California Residents o. J. Clin. Microbiol. 49, 945-954 (2011). [0379] 71. Gray, J., Stedingk, L. V. von, Gurtelschmid, M. & Granstr?m, M. Transmission Studies of Babesia microti in Ixodes ricinus Ticks and Gerbils. J. Clin. Microbiol. 40, 1259-1263 (2002). [0380] 72. Guedj, E., Eldin, C., Raoult, D., Azorin, J. M. & Belzeaux, R. Functional neuroimaging in patients presenting with somatoform disorders: A model for investigating persisting symptoms after tick bites and post-treatment Lyme disease syndrome? Med. Mal. Infect. (2019). doi:10.1016/j.medmal.2019.01.002 [0381] 73. Gunther, S., et al., IL-1 Family Cytokines Use Distinct Molecular Mechanisms to Signal through Their Shared Co-receptor. Immunity, 2017. 47(3): p. 510-523.e4. [0382] 74. Halperin, J. J. Chronic Lyme disease: misconceptions and challenges for patient management. Infect. Drug Resist. 8, 119-128 (2015). [0383] 75. Haraldsson, B., Nystram, J. & Deen, W. M. Properties of the glomerular barrier and mechanisms of proteinuria. Physiol. Rev. 88, 451-487 (2008). [0384] 76. Heydari, A. A., M. R. Movahhede Danesh, and K. Ghazvini, Urine PCR evaluation to diagnose pulmonary tuberculosis. Jundishapur J Microbiol, 2014. 7(3): p. e9311. [0385] 77. Higdon, R. and E. Kolker, A predictive model for identifying proteins by a single peptide match. Bioinformatics, 2007. 23(3): p. 277-80. [0386] 78. Hirosue, S. & Dubrot, J. Modes of Antigen Presentation by Lymph Node Stromal Cells and Their Immunological Implications. Front. Immunol. 6, (2015). [0387] 79. Hodzic, E., Feng, S. & Barthold, S. W. Assessment of Transcriptional Activity of Borrelia burgdorferi and Host Cytokine Genes During Early and Late Infection in a Mouse Model. Vector-Borne Zoonotic Dis. 13, 694-711 (2013). [0388] 80. Hossain, M. et al. Enhanced sensitivity for selected reaction monitoring mass spectrometry-based targeted proteomics using a dual stage electrodynamic ion funnel interface. Mol. Cell. Proteomics MCP 10, M000062-MCP201 (2011). [0389] 81. Huber, B. et al. Description of Francisella hispaniensis sp. nov., isolated from human blood, reclassification of Francisella novicida (Larson et al. 1955) Olsufiev et al. 1959 as Francisella tularensis subsp. novicida comb. nov. and emended description of the genus Francisella. Int. J. Syst. Evol. Microbiol. 60, 1887-1896 (2010). [0390] 82. Ivanova, L. B. et al. Borrelia chilensis, a new member of the Borrelia burgdorferi sensu lato complex that extends the range of this genospecies in the Southern Hemisphere. Environ. Microbiol. 16, 1069-1080 (2014). [0391] 83. Jado, I. et al. Rickettsia monacensis and Human Disease, Spain. Emerg. Infect. Dis. 13, 1405-1407 (2007). [0392] 84. Jan, A. T. Outer Membrane Vesicles (OMVs) of Gram-negative Bacteria: A Perspective Update. Front. Microbiol. 8, (2017). [0393] 85. Jannetto, P. J. & Fitzgerald, R. L. Effective Use of Mass Spectrometry in the Clinical Laboratory. Clin. Chem. 62, 92-98 (2016). [0394] 86. Johnson, L., Wilcox, S., Mankoff, J. & Stricker, R. B. Severity of chronic Lyme disease compared to other chronic conditions: a quality of life survey. PeerJ 2, e322 (2014). [0395] 87. Jutras B L, Lochhead R B, Kloos Z A, Biboy J, Strle K, Booth C J, Govers S K, Gray J, Schumann P, Vollmer W, Bockenstedt L K, Steere A C, Jacobs-Wagner C. Borrelia burgdorferi peptidoglycan is a persistent antigen in patients with Lyme arthritis. Proc Natl Acad Sci USA. 2019 Jul. 2; 116(27):13498-13507. doi: 10.1073/pnas.1904170116. Epub 2019 Jun. 17. [0396] 88. Kedl, R. M. et al. Migratory dendritic cells acquire and present lymphatic endothelial cell-archived antigens during lymph node contraction. Nat. Commun. 8, 2034 (2017). [0397] 89. Kentsis, A. et al. Urine proteomics for profiling of human disease using high accuracy mass spectrometry. PROTEOMICSClin. Appl. 3, 1052-1061 (2009). [0398] 90. Kim, B. et al. Affinity enrichment for mass spectrometry: improving the yield of low abundance biomarkers. Expert Rev. Proteomics 15, 353-366 (2018). [0399] 91. Kim, J. S., et al., Crystal structure and functional implications of LprF from Mycobacterium tuberculosis and M. bovis. Acta Crystallogr D Biol Crystallogr, 2014. 70(Pt 10): p. 2619-30. [0400] 92. Knapp, K. L. & Rice, N. A. Human Coinfection with Borrelia burgdorferi and Babesia microti in the United States. J. Parasitol. Res. 2015, (2015). [0401] 93. Kodym, P. et al. Serological Diagnostics of Lyme Borreliosis: Comparison of Universal and Borrelia Species-Specific Tests Based on Whole-Cell and Recombinant Antigens. J. Clin. Microbiol. 56, e00601-18 (2018). [0402] 94. Kornacki, J. A. & Oliver, D. B. Lyme disease-causing Borrelia species encode multiple lipoproteins homologous to peptide-binding proteins of ABC-type transporters. Infect. Immun. 66, 4115-4122 (1998). [0403] 95. Kovalcuka, L. et al. Immunogenetic Manifestations of Lyme Borreliosis/Imuniengtiskas Izpausmes Laimboreliozes Gadijuma. Proc. Latv. Acad. Sci. Sect. B Nat. Exact Appl. Sci. 70, 215-219 (2016). [0404] 96. Krause, P. J. et al. Concurrent Lyme disease and babesiosis. Evidence for increased severity and duration of illness. JAMA 275, 1657-1660 (1996). [0405] 97. Krause, P. J. et al. Disease-specific diagnosis of coinfecting tickborne zoonoses: babesiosis, human granulocytic ehrlichiosis, and Lyme disease. Clin. Infect. Dis. Off. Publ. Infect. Dis. Soc.
[0406] Am. 34, 1184-1191 (2002). [0407] 98. Krause, P. J., Fish, D., Narasimhan, S. & Barbour, A. G. Borrelia miyamotoi Infection in Nature and in Humans. Clin. Microbiol. Infect. Off. Publ. Eur. Soc. Clin. Microbiol. Infect. Dis. 21, 631-639 (2015). [0408] 99. Krause, P. J., Fish, D., Narasimhan, S. & Barbour, A. G. Borrelia miyamotoi Infection in Nature and in Humans. Clin. Microbiol. Infect. Off. Publ. Eur. Soc. Clin. Microbiol. Infect. Dis. 21, 631-639 (2015). [0409] 100. Kruger, H., Heim, E., Schuknecht, B. & Scholz, S. Acute and chronic neuroborreliosis with and without CNS involvement: a clinical, MRI, and HLA study of 27 cases. J. Neurol. 238, 271-280 (1991). [0410] 101. Kugeler, K. J. et al. Discrimination between Francisella tularensis and Francisella-Like Endosymbionts when Screening Ticks by PCR. Appl. Environ. Microbiol. 71, 7594-7597 (2005). [0411] 102. Lacout, A., El Hajjam, M., Marcy, P.-Y. & Perronne, C. The Persistent Lyme Disease: True Chronic Lyme Disease rather than Post-treatment Lyme Disease Syndrome. J. Glob. Infect. Dis. 10, 170-171 (2018). [0412] 103. Lantos, P. M. Chronic Lyme disease. Infect. Dis. Clin. North Am. 29, 325-340 (2015). [0413] 104. Liang, F. T. et al. Borrelia burgdorferi changes its surface antigenic expression in response to host immune responses. Infect. Immun. 72, 5759-5767 (2004). [0414] 105. Lindenbergh, M. F. S. & Stoorvogel, W. Antigen Presentation by Extracellular Vesicles from Professional Antigen-Presenting Cells. Annu. Rev. Immunol. 36, 435-459 (2018). [0415] 106. Longo, C. et al. Core-Shell Hydrogel Particles Harvest, Concentrate and Preserve Labile Low Abundance Biomarkers. PLoS ONE 4, (2009). [0416] 107. Longo, C., et al., Core-Shell Hydrogel Particles Harvest, Concentrate and Preserve Labile Low Abundance Biomarkers. PLoS ONE, 2009. 4(3). [0417] 108. Luchini, A. et al. Smart Hydrogel Particles: Biomarker Harvesting: One-step affinity purification, size exclusion, and protection against degradation. Nano Lett. 8, 350-361 (2008). [0418] 109. Magni, R., Luchini, A., Liotta, L. & Molestina, R. E. Analysis of the Babesia microti proteome in infected red blood cells by a combination of nanotechnology and mass spectrometry. Int. J. Parasitol. 49, 139-144 (2019). [0419] 110. Marais, B. J., Childhood tuberculosis: epidemiology and natural history of disease. Indian J Pediatr, 2011. 78(3): p. 321-7. [0420] 111. Mbow, M. L. et al. Major histocompatibility complex class II-independent generation of neutralizing antibodies against T-cell-dependent Borrelia burgdorferi antigens presented by dendritic cells: regulation by NK and gammadelta T cells. Infect. Immun. 69, 2407-2415 (2001). [0421] 112. McDonough, J. A., et al., The twin-arginine translocation pathway of Mycobacterium smegmatis is functional and required for the export of mycobacterial beta-lactamases. J Bacteriol, 2005. 187(22): p. 7667-79. [0422] 113. McFee, R. B. Tick borne illnessRocky mountain spotted fever. Dis. Mon. 64, 185-194 (2018). [0423] 114. Mead, P. S. Epidemiology of Lyme disease. Infect. Dis. Clin. North Am. 29, 187-210 (2015). [0424] 115. Melenotte, C., Drancourt, M., Gorvel, J. P., Mege, J. L. & Raoult, D. Post-bacterial infection chronic fatigue syndrome is not a latent infection. Med. Mal. Infect. (2019). doi:10.1016/j.medmal.2019.01.006 [0425] 116. Moody K D, Barthold S W, Terwilliger G A, Beck D S, Hansen G M, Jacoby R O. Experimental chronic Lyme borreliosis in Lewis rats. Am J Trop Med Hyg. 1990 February; 42(2):165-74. [0426] 117. Moody, D. B. & Cotton, R. N. Four pathways of CD1 antigen presentation to T cells. Curr. Opin. Immunol. 46, 127-133 (2017). [0427] 118. Moore, D. A., et al., Microscopic observation drug susceptibility assay, a rapid, reliable diagnostic test for multidrug-resistant tuberculosis suitable for use in resource-poor settings. J Clin Microbiol, 2004. 42(10): p. 4432-7. [0428] 119. Moutailler, S. et al. Co-infection of Ticks: The Rule Rather Than the Exception. PLoS Negl. Trop. Dis. 10, e0004539 (2016). [0429] 120. Multiple Acquisitions of Pathogen-Derived Francisella Endosymbionts in Soft Ticks. Available at: https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5804916/. (Accessed: 1 Mar. 2019) [0430] 121. Nanagara, R., Duray, P. H. & Schumacher, H. R. Ultrastructural demonstration of spirochetal antigens in synovial fluid and synovial membrane in chronic Lyme disease: possible factors contributing to persistence of organisms. Hum. Pathol. 27, 1025-1034 (1996). [0431] 122. Nicodeme, P., Fast approximate motif statistics. J Comput Biol, 2001. 8(3): p. 235-48. [0432] 123. Noda, H., Munderloh, U. G. & Kurtti, T. J. Endosymbionts of Ticks and Their Relationship to Wolbachia spp. and Tick-Borne Pathogens of Humans and Animals. APPL Env. MICROBIOL 63, 7 (1997). [0433] 124. Notice to Readers Recommendations for Test Performance and Interpretation from the Second National Conference on Serologic Diagnosis of Lyme Disease. Available at: https://www.cdc.gov/mmwr/preview/mmwrhtml/00038469.htm. (Accessed: 19 Apr. 2019) [0434] 125. Nowalk, A. J., Gilmore, R. D. & Carroll, J. A. Serologic proteome analysis of Borrelia burgdorferi membrane-associated proteins. Infect. Immun. 74, 3864-3873 (2006). [0435] 126. Nozawa, N., et al., Real-time PCR assay using specimens on filter disks as a template for detection of cytomegalovirus in urine. J Clin Microbiol, 2007. 45(4): p. 1305-7. [0436] 127. Oz, H. S. & Hughes, W. T. Acute fulminating babesiosis in hamsters infected with Babesia microti. Int. J. Parasitol. 26, 667-670 (1996). [0437] 128. Padgett, K. A. et al. The Eco-epidemiology of Pacific Coast Tick Fever in California. PLoS Negl. Trop. Dis. 10, e0005020 (2016). [0438] 129. Paris, L. et al. Urine lipoarabinomannan glycan in HIV-negative patients with pulmonary tuberculosis correlates with disease severity. Sci. Transl. Med. 9, (2017). [0439] 130. Paris, L., et al., Urine lipoarabinomannan glycan in HIV-negative patients with pulmonary tuberculosis correlates with disease severity. Sci Transl Med, 2017. 9(420). [0440] 131. Peter, J., et al., Urine for the diagnosis of tuberculosis: current approaches, clinical applicability, and new developments. Curr Opin Pulm Med, 2010. 16(3): p. 262-70. [0441] 132. Peter, J. G., G. Theron, and K. Dheda, Urine antigen test for diagnosis of HIV-associated tuberculosis. Lancet Infect Dis, 2012. 12(11): p. 825; author reply 826-7. [0442] 133. Petnicki-Ocwieja, T. & Kern, A. Mechanisms of Borrelia burgdorferi internalization and intracellular innate immune signaling. Front. Cell. Infect. Microbiol. 4, (2014). [0443] 134. Piesman, J., Karakashian, S. J., Lewengrub, S., Rudzinska, M. A. & Spielmank, A. Development of Babesia microti sporozoites in adult Ixodes dammini. Int. J. Parasitol. 16, 381-385 (1986). [0444] 135. Poljak, A. et al. Identification and characterization of Borrelia antigens as potential vaccine candidates against Lyme borreliosis. Vaccine 30, 4398-4406 (2012). [0445] 136. Pretorius, A.-M. & Birtles, R. J. Rickettsia aeschlimannii: A New Pathogenic Spotted Fever Group Rickettsia, South Africa. Emerg. Infect. Dis. 8, 874 (2002). [0446] 137. Pritt, B. S. et al. Borrelia mayonii sp. nov., a member of the Borrelia burgdorferi sensu lato complex, detected in patients and ticks in the upper midwestern United States. Int. J. Syst. Evol. Microbiol. 66, 4878-4880 (2016). [0447] 138. Pruitt, K. D., Tatusova, T. & Maglott, D. R. NCBI Reference Sequence (RefSeq): a curated non-redundant sequence database of genomes, transcripts and proteins. Nucleic Acids Res. 33, D501-D504 (2005). [0448] 139. Pulkkinen, L. I. A., Butcher, S. J. & Anastasina, M. Tick-Borne Encephalitis Virus: A Structural View. Viruses 10, (2018). [0449] 140. Pulzova, L. & Bhide, M. Outer surface proteins of Borrelia: peerless immune evasion tools. Curr. Protein Pept. Sci. 15, 75-88 (2014). [0450] 141. Rappold, B. A. Mass Spectrometry Selectivity, Specifically. Clin. Chem. 62, 154-156 (2016). [0451] 142. Rebman, A. W. et al. The Clinical, Symptom, and Quality-of-Life Characterization of a Well-Defined Group of Patients with Posttreatment Lyme Disease Syndrome. Front. Med. 4, 224 (2017). [0452] 143. Reche, P. A. & Reinherz, E. L. Definition of MHC supertypes through clustering of MHC peptide-binding repertoires. Methods Mol. Biol. Clifton N J 409, 163-173 (2007). [0453] 144. Reche, P. A. & Reinherz, E. L. Prediction of peptide-MHC binding using profiles. Methods Mol. Biol. Clifton N J 409, 185-200 (2007). [0454] 145. Rudenko, N. et al. Delineation of a new species of the Borrelia burgdorferi Sensu Lato Complex, Borrelia americana sp. nov. J. Clin. Microbiol. 47, 3875-3880 (2009). [0455] 146. Sahni, S. K. & Rydkina, E. Host-cell interactions with pathogenic Rickettsia species. Future Microbiol. 4, 323-339 (2009). [0456] 147. Schmidt, R., et al., Single-molecule detection on a protein-array assay platform for the exposure of a tuberculosis antigen. J Proteome Res, 2011. 10(3): p. 1316-22. [0457] 148. Schroeder, C. L. C. et al. Transcriptional profiling of Rickettsia prowazekii coding and non-coding transcripts during in vitro host-pathogen and vector-pathogen interactions. Ticks Tick-Borne Dis. 8, 827-836 (2017). [0458] 149. Schutzer, S. E. et al. Direct Diagnostic Tests for Lyme Disease. Clin. Infect. Dis. Off. Publ. Infect. Dis. Soc. Am. (2018). doi:10.1093/cid/ciy614 [0459] 150. Schutzer, S. E. et al. Whole-Genome Sequences of Borrelia bissettii, Borrelia valaisiana, and Borrelia spielmanii. J. Bacteriol. 194, 545-546 (2012). [0460] 151. Science, I. of M. (US) C. on L. D. and O. T.-B. D. T. S. of the. Diagnostics and Diagnosis. (National Academies Press (US), 2011). [0461] 152. Scoles, G. A. Phylogenetic Analysis of the Francisella-like Endosymbionts of Dermacentor Ticks. J. Med. Entomol. 41, 277-286 (2004). [0462] 153. Scott, J. D., Foley, J. E., Anderson, J. F., Clark, K. L. & Durden, L. A. Detection of Lyme Disease Bacterium, Borrelia burgdorferi sensu lato, in Blacklegged Ticks Collected in the Grand River Valley, Ontario, Canada. Int. J. Med. Sci. 14, 150-158 (2017). [0463] 154. Sentausa, E. et al. Genome Sequence of Rickettsia tamurae, a Recently Detected Human Pathogen in Japan. Genome Announc. 2, (2014). [0464] 155. Seward, R. J., Drouin, E. E., Steere, A. C. & Costello, C. E. Peptides Presented by HLA-DR Molecules in Synovia of Patients with Rheumatoid Arthritis or Antibiotic-Refractory Lyme Arthritis. Mol. Cell. Proteomics 10, M110.002477 (2011). [0465] 156. Shafagati, N., et al., The use of Nanocage particles for biodefense and emerging infectious disease diagnostics. Pathog Dis, 2014. 71(2): p. 164-76. [0466] 157. Shah, S. Biomagnetics Announces the First Urine-Based Test for Tuberculosis. MedGadget 2011; Available from: http://www.medgadget.com/2011/05/biomagnetics_announces_the_first_urinebased_test_for_tub erculosis.html. [0467] 158. Shapiro, D. S. & Schwartz, D. R. Exposure of Laboratory Workers to Francisella tularensis despite a Bioterrorism Procedure. J. Clin. Microbiol. 40, 2278-2281 (2002). [0468] 159. Sharma, N. et al. Detection of Francisella tularensis-Specific Antibodies in Patients with Tularemia by a Novel Competitive Enzyme-Linked Immunosorbent Assay. Clin. Vaccine Immunol. CVI 20, 9-16 (2013). [0469] 160. Shea, Y. R., et al., High sensitivity and specificity of acid-fast microscopy for diagnosis of pulmonary tuberculosis in an African population with a high prevalence of human immunodeficiency virus. J Clin Microbiol, 2009. 47(5): p. 1553-5. [0470] 161. Shell, S. S., et al., Leaderless Transcripts and Small Proteins Are Common Features of the Mycobacterial Translational Landscape. PLoS Genet, 2015. 11(11): p. e1005641. [0471] 162. Silva, J. C. et al. Genome-wide diversity and gene expression profiling of Babesia microti isolates identify polymorphic genes that mediate host-pathogen interactions. Sci. Rep. 6, 35284 (2016). [0472] 163. Silvanovich, A. et al. The value of short amino acid sequence matches for prediction of protein allergenicity. Toxicol. Sci. Off. J. Soc. Toxicol. 90, 252-258 (2006). [0473] 164. Silvanovich, A., et al., The value of short amino acid sequence matches for prediction of protein allergenicity. Toxicol Sci, 2006. 90(1): p. 252-8. [0474] 165. Silveira, I., Pacheco, R. C., Szab6, M. P. J., Ramos, H. G. C. & Labruna, M. B. Rickettsia parkeri in Brazil. Emerg. Infect. Dis. 13, 1111-1113 (2007). [0475] 166. Singh, S. K. & Girschick, H. J. Lyme borreliosis: from infection to autoimmunity. Clin. Microbiol. Infect. 10, 598-614 (2004). [0476] 167. Stanek, G. & Reiter, M. The expanding Lyme Borrelia complex-clinical significance of genomic species? Clin. Microbiol. Infect. 17, 487-493 (2011). [0477] 168. Steinberg, H. E. et al. Toward detection of toxoplasmosis from urine in mice using hydro-gel nanoparticles concentration and parallel reaction monitoring mass spectrometry. Nanomedicine Nanotechnol. Biol. Med. 14, 461-469 (2018). [0478] 169. Steinberg, H. E., et al., Toward detection of toxoplasmosis from urine in mice using hydro-gel nanoparticles concentration and parallel reaction monitoring mass spectrometry. Nanomedicine, 2017. 14(2): p. 461-469. [0479] 170. Sun, L. V., Scoles, G. A., Fish, D. & O'Neill, S. L. Francisella-like Endosymbionts of Ticks. J. Invertebr. Pathol. 76, 301-303 (2000). [0480] 171. Swanson, S. J., Neitzel, D., Reed, K. D. & Belongia, E. A. Coinfections acquired from ixodes ticks. Clin. Microbiol. Rev. 19, 708-727 (2006). [0481] 172. Sze, C. W., Zhang, K., Kariu, T., Pal, U. & Li, C. Borrelia burgdorferi Needs Chemotaxis To Establish Infection in Mammals and To Accomplish Its Enzootic Cycle. Infect. Immun. 80, 2485-2492 (2012). [0482] 173. Tan, K. E. et al. Prospective Evaluation of a Matrix-Assisted Laser Desorption Ionization-Time of Flight Mass Spectrometry System in a Hospital Clinical Microbiology Laboratory for Identification of Bacteria and Yeasts: a Bench-by-Bench Study for Assessing the Impact on Time to Identification and Cost-Effectiveness. J. Clin. Microbiol. 50, 3301-3308 (2012). [0483] 174. Telford, S. R. & Wormser, G. P. Bartonella spp. Transmission by Ticks Not Established. Emerg. Infect. Dis. 16, 379-384 (2010). [0484] 175. Thomas, S. N. & Zhang, H. Targeted proteomic assays for the verification of global proteomics insights. Expert Rev. Proteomics 13, 897-899 (2016). [0485] 176. Tickborne Diseases of the United States I Tick-borne Diseases I Ticks I CDC. (2018). Available at: https://www.cdc.gov/ticks/tickbomediseases/index.html. (Accessed: 1 Dec. 2018) [0486] 177. Tracy, K. E. & Baumgarth, N. Borrelia burgdorferi Manipulates Innate and Adaptive Immunity to Establish Persistence in Rodent Reservoir Hosts. Front. Immunol. 8, (2017). [0487] 178. Vassall, A., et al., Rapid diagnosis of tuberculosis with the Xpert MTB/RIF assay in high burden countries: a cost-effectiveness analysis. PLoS Med, 2011. 8(11): p. e1001120. [0488] 179. Vitale, G., Mansueto, S., Rolain, J.-M. & Raoult, D. Rickettsia massiliae Human Isolation. Emerg. Infect. Dis. 12, 174-175 (2006). [0489] 180. Wagemakers, A., Staarink, P. J., Sprong, H. & Hovius, J. W. R. Borrelia miyamotoi: a widespread tick-borne relapsing fever spirochete. Trends Parasitol. 31, 260-269 (2015). [0490] 181. Wang, J. et al. Lipid binding orientation within CDId affects recognition of Borrelia burgorferi antigens by NKT cells. Proc. Natl. Acad. Sci. 107, 1535-1540 (2010). [0491] 182. Wieser, A., Schneider, L., Jung, J. & Schubert, S. MALDI-TOF MS in microbiological diagnostics-identification of microorganisms and beyond (mini review). Appl. Microbiol. Biotechnol. 93, 965-974 (2012). [0492] 183. Wilson, N. S., El-Sukkari, D. & Villadangos, J. A. Dendritic cells constitutively present self antigens in their immature state in vivo and regulate antigen presentation by controlling the rates of MHC class II synthesis and endocytosis. Blood 103, 2187-2195 (2004). [0493] 184. Wormser, G. P., Shapiro, E. D. & Fish, D. Borrelia miyamotoi: An Emerging Tick-Borne Pathogen. Am. J. Med. 132, 136-137 (2019). [0494] 185. Yakimchuk, K. et al. Borrelia burgdorferi infection regulates CD1 expression in human cells and tissues via IL1-?. Eur. J. Immunol. 41, 694-705 (2011).