FRATAXIN-SENSITIVE LIPID MARKERS FOR MONITORING FRATAXIN REPLACEMENT THERAPY
20240142476 ยท 2024-05-02
Inventors
- Joan David Bettoun (Elkins Park, PA, US)
- Christine DES ROSIERS (Rigaud, CA)
- Anik Forest (Sainte-Lucie-Des-Laurentides, CA)
Cpc classification
G01N33/92
PHYSICS
International classification
Abstract
The present disclosure is based, at least in part, on providing a set of markers, also referred to herein as FXN-sensitive lipid markers (or FSLMs), the respective levels of which are positively or negatively correlated to frataxin (FXN) levels in a cell. Therefore, these FSLMs can be used to determine, evaluate, and/or monitor the effectiveness of FXN replacement therapy in a subject.
Claims
1. (canceled)
2. A method for evaluating efficacy of a frataxin (FXN) replacement therapy, the method comprising: (a) determining an FXN replacement lipid profile for one or more FXN-sensitive lipid markers (FSLMs) in a sample obtained from an FXN deficient subject following administration of an FXN replacement therapy; (b) comparing the subject FXN replacement lipid profile determined in step (a) with a reference FXN lipid profile for the one or more FSLMs; and (c) determining efficacy of the FXN replacement therapy based on the comparison in step (b); wherein the one or more FSLMs are selected from a group consisting of one or more of: triglycerides (TGs), wherein the three acyl groups in each triglyceride molecule contain less than 56 carbons and/or wherein the three acyl groups in each triglyceride molecule contain 7 or less unsaturations; ether phospholipids; phosphatidylcholines (PCs); cholesteryl esters (CEs); and diglycerides (DGs).
3. The method of claim 2, wherein the reference FXN lipid profile is a baseline FXN(?) lipid profile for the one or more FSLMs.
4. The method of claim 3, wherein the baseline FXN(?) lipid profile for the one or more FSLMs is determined in a sample obtained from an FXN deficient subject prior to administration of an FXN replacement therapy.
5. The method of claim 4, further comprising determining a baseline FXN(?) lipid profile for the one or more FXN-sensitive lipid markers (FSLMs) in a sample obtained from the FXN deficient subject prior to administration of the FXN replacement therapy.
6. The method of claim 2, wherein the one or more FSLMs are selected from a group consisting of one or more triglycerides (TGs), wherein the three acyl groups in each triglyceride molecule contain less than 56 carbons and/or wherein the three acyl groups in each triglyceride molecule contain 7 or less unsaturations.
7. The method of claim 6, wherein the one or more FSLMs are selected from the group consisting of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7.
8. (canceled)
9. The method of claim 2, wherein the one or more FSLMs are selected from one or more ether phospholipids.
10. The method of claim 9, wherein the one or more ether phospholipids comprise one or more ether diacylglycerophosphocholines (PCO-).
11. The method of claim 10, wherein the one or more PCO- are selected from the group consisting of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, and PCO-44:7 and PCO-46.8.
12. (canceled)
13. The method of claim 9, wherein the one or more ether phospholipids comprise one or more phosphatidylethanolamine ethers (PEO-).
14. The method of claim 2, wherein the one or more FSLMs are selected from one or more phosphatidylcholines (PCs).
15. The method of claim 14, wherein the one or more PCs are selected from the group consisting of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6 and PC42:7.
16-18. (canceled)
19. The method of claim 2, wherein the one or more FSLMs are selected from one or more cholesteryl esters (CEs).
20. The method of claim 19, wherein the one or more CEs are selected from the group consisting of CE16:0, CE20:5 and CE14:1.
21. (canceled)
22. The method of claim 2, wherein the one or more FSLMs are selected from one or more diglycerides (DGs).
23. The method of claim 22, wherein the one or more DGs is DG18:1/18:2.
24. The method of claim 3, wherein the amount of at least one or more FSLMs is increased in the subject following treatment with FXN replacement therapy, wherein the one or more FSLMs are selected from the group consisting of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, and PCO-44:7, PCO-46.8, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE16:0 and CE20:5.
25. (canceled)
26. The method of claim 3, wherein the amount of at least one or more FSLMs is decreased in the subject following treatment with FXN replacement therapy, wherein the one or more FSLMs are selected from the group consisting of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, DG18:1/18:2 and CE14:1.
27-29. (canceled)
30. The method of claim 3, wherein the FXN replacement therapy is determined to be effective when the amount of one or more FSLMs is increased in the FXN replacement lipid profile as compared to the baseline FXN(?) lipid profile, wherein the one or more FSLMs are selected from the group consisting of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, and PCO-44:7, PCO-46.8, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE16:0 and CE20:5.
31. The method of claim 3, wherein the FXN replacement therapy is determined to be effective when the amount of one or more FSLMs is decreased in the FXN replacement lipid profile as compared to the baseline FXN(?) lipid profile, wherein the one or more FSLMs are selected from the group consisting of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, DG18:1/18:2 and CE14:1.
32-38. (canceled)
39. The method of claim 2, wherein the FXN lipid profile is determined by mass spectrometry.
40. (canceled)
41. The method of claim 2, wherein the subject has Friedreich's Ataxia (FRDA).
42. (canceled)
43. The method of claim 2, wherein the sample is selected from the group consisting of a buccal sample, a skin sample, a hair follicle or a blood-derived sample.
44. (canceled)
45. The method of claim 43, wherein the blood-derived sample is a plasma sample.
46. A method of monitoring treatment of a subject with a frataxin (FXN) replacement therapy, the method comprising: (a) determining a first FXN replacement lipid profile for one or more FXN-sensitive lipid markers (FSLMs) in a first sample obtained from an FXN deficient subject at a first time point following administration of an FXN replacement therapy to the subject, (b) determining a second FXN replacement lipid profile for the one or more FXN-sensitive lipid markers (FSLMs) in a second sample obtained from the subject at a second time point that is later than the first time point; (c) comparing the second FXN replacement lipid profile with the first FXN replacement profile; thereby monitoring treatment of the subject with the FXN replacement therapy; wherein the one or more FSLMs are selected from a group consisting of one or more of: triglycerides (TGs), wherein the three acyl groups in each triglyceride molecule contain less than 56 carbons and/or wherein the three acyl groups in each triglyceride molecule contain 7 or less unsaturations; ether phospholipids; phosphatidylcholines (PCs) cholesteryl esters (CEs); and diglycerides (DGs).
47-61. (canceled)
62. A method for treating an FXN deficiency, the method comprising: (a) determining an FXN lipid profile in a sample obtained from an FXN deficient subject for one or more FXN-sensitive lipid markers (FSLMs), (b) comparing the FXN lipid profile of the sample with at least one other lipid profile selected from the group consisting of normal FXN lipid profile for the one or more FSLMs, baseline FXN(?) lipid profile for the one or more FSLMs, and FXN replacement lipid profile for the one or more FSLMs, (c) classifying the FXN lipid profile determined in step (a) as corresponding to a normal FXN lipid profile, baseline FXN(?) lipid profile or an FXN replacement lipid profile, and (d) initiating or modulating an FXN replacement therapy based on the classification of the FXN lipid profile of the sample.
63. The method of claim 62, wherein modulating an FXN replacement therapy comprises increasing the dosage, decreasing the dosage, increasing the administration frequency, or decreasing the administration frequency, of the FXN replacement therapy.
64. The method of claim 62, wherein the FXN deficient subject has Friedreich's Ataxia (FRDA).
65. A method of treating an FXN deficiency in a subject, comprising: (a) determining an FXN lipid profile for one or more FXN-sensitive lipid markers (FSLMs) in a sample from an FXN deficient subject; and (b) recommending to a healthcare provider to administer an FXN replacement therapy to the subject based on the subject FXN lipid profile determined in step (a).
66. A method of treating an FXN deficiency in a subject, comprising: (a) obtaining an FXN lipid profile for one or more FSLMs in a sample obtained from an FXN deficient subject; and (b) administering an FXN replacement therapy to the subject based on the subject FXN lipid profile.
67-68. (canceled)
69. A method of detecting one or more frataxin-sensitive lipid markers (FSLMs) in a sample from a frataxin (FXN) deficient subject, comprising subjecting the sample, or a portion thereof, to analysis by mass spectrometry, wherein the one or more FSLMs are selected from a group consisting of: triglycerides (TGs), wherein the three acyl groups in each triglyceride molecule contain less than 56 carbons and/or wherein the three acyl groups in each triglyceride molecule contain 7 or less unsaturations; ether phospholipids; phosphatidylcholines (PCs); cholesteryl esters (CEs); and diglycerides (DGs).
70. The method of claim 69, wherein the subject is being treated or is scheduled to be treated with an FXN replacement therapy.
71. The method of claim 69, further comprising obtaining the sample from the FXN deficient subject.
72. (canceled)
73. The method of claim 69, wherein the one or more FSLMs are selected from a group consisting of one or more triglycerides (TGs), wherein the three acyl groups in each triglyceride molecule contain less than 56 carbons and/or wherein the three acyl groups in each triglyceride molecule contain 7 or less unsaturations.
74. The method of claim 73, wherein the one or more FSLMs are selected from the group consisting of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7.
75. The method of claim 69, wherein the one or more FSLMs are selected from one or more ether phospholipids.
76. The method of claim 75, wherein the one or more ether phospholipids comprise one or more ether diacylglycerophosphocholines (PCO-).
77. The method of claim 76, wherein the one or more PCO- are selected from the group consisting of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, and PCO-44:7 and PCO-46.8.
78. The method of claim 75, wherein the one or more ether phospholipids comprise one or more phosphatidylethanolamine ethers (PEO-).
79. The method of claim 69, wherein the one or more FSLMs are selected from one or more phosphatidylcholines (PCs).
80. The method of claim 79, wherein the one or more PCs are selected from the group consisting of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0).
81. The method of claim 69, wherein the one or more FSLMs are selected from one or more cholesteryl esters (CEs).
82. The method of claim 81, wherein the one or more CEs are selected from the group consisting of CE14:1, CE16:0 and CE20:5.
83. The method of claim 69, wherein the one or more FSLMs are selected from one or more diglycerides (DGs).
84. The method of claim 83, wherein the one or more DGs is DG18:1/18:2.
85. The method of claim 69, wherein the FXN lipid profile is determined by mass spectrometry.
86. The method of claim 69, wherein the subject has Friedreich's Ataxia (FRDA).
87. The method of claim 69, further comprising obtaining a sample from the FXN deficient subject, wherein the sample is selected from the group consisting of a buccal sample, a skin sample, a hair follicle or a blood-derived sample.
88-90. (canceled)
91. The method of claim 69, wherein the FXN replacement therapy comprises administration of an FXN fusion protein.
92. The method of claim 91, wherein the FXN fusion protein comprises or consists of the amino acid sequence set forth in SEQ ID NO: 12.
93. A kit for detecting one or more frataxin-sensitive lipid markers (FSLMs) in a sample obtained from a frataxin (FXN) deficient subject, comprising one or more isotopically labeled lipids for use as internal standards in a mass spectrometry-based analysis for detecting one or more FSLMs in the sample, and a set of instructions for detecting the level of the one or more FSLMs in the sample from the subject by mass spectrometry.
94. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0144]
[0145]
[0146]
[0147]
[0148]
[0149]
[0150]
[0151]
[0152]
[0153]
[0154]
[0155]
[0156]
[0157]
[0158]
[0159]
[0160]
[0161]
[0162]
[0163]
[0164]
[0165]
[0166]
[0167]
[0168]
[0169]
[0170]
[0171]
[0172]
[0173]
[0174]
[0175]
[0176]
[0177]
[0178]
[0179]
[0180]
[0181]
[0182]
[0183]
[0184]
[0185]
[0186]
[0187]
[0188]
[0189]
[0190]
[0191]
[0192]
[0193]
[0194]
[0195]
[0196]
[0197]
[0198]
[0199]
DETAILED DESCRIPTION
Overview
[0200] In one aspect, the present disclosure is based, at least in part, on providing a set of markers, also referred to herein as FXN-sensitive lipid markers (or FSLMs), whose respective levels are positively or negatively correlated to frataxin (FXN) levels in a cell. In some embodiments, the FSLMs of the present disclosure are contrary regulated by FXN gene ablation or deficiency, followed by FXN protein replacement. Thus, said FSLMs of the present disclosure are both associated with FXN deficiency in a subject and conversely associated with FXN replacement. The FSLMs disclosed herein were found to be sensitive to FXN and are considered markers of FXN replacement. Therefore, these FSLMs can be used to determine and/or monitor efficacy of FXN replacement therapy in a subject, as described herein.
[0201] In some embodiments, the FSLMs comprise one or more triglycerides (triacylglycerols, TGs). In some embodiments, the FSLMs comprise one or more triglycerides, wherein the three acyl groups in each triglyceride molecule contain 45 carbons to 55 carbons, e.g., 45, 46, 47, 48, 49, 50, 51, 52, 53, 54 or 55 carbons.
[0202] In some embodiments, the FSLMs comprise one or more triglycerides, wherein the three acyl groups in each triglyceride molecule contain less than 56 carbons. In some embodiments, the FSLMs comprise one or more triglycerides, wherein the three acyl groups in each triglyceride molecule contain 7 or less unsaturations. In some embodiments, the FSLMs comprise one or more of triacylglycerol 45:1 (TG45:1), triacylglycerol 46:1 (TG46:1), triacylglycerol 46:3 (TG46:3), triacylglycerol 47:1 (TG47:1), triacylglycerol 47:2 (TG47:2), triacylglycerol 48:0 (TG48:0), triacylglycerol 48:1 (TG48:1), triacylglycerol 48:2 (TG48:2), triacylglycerol 49:1 (TG49:1), triacylglycerol 49:2 (TG49:2), triacylglycerol 49:3 (TG49:3), triacylglycerol 49:4 (TG49:4), triacylglycerol 50:1 (TG50:1), triacylglycerol 50:2 (TG50:2), triacylglycerol 50:3 (TG50:3), triacylglycerol 50:4 (TG50:4), triacylglycerol 51:1 (TG51:1), triacylglycerol 51:2 (TG51:2), triacylglycerol 51:3 (TG51:3), triacylglycerol 51:4 (TG51:4), triacylglycerol 52:3 (TG52:3), triacylglycerol 52:5 (TG52:5), triacylglycerol 53:2 (TG53:2), triacylglycerol 53:3 (TG53:3), triacylglycerol 53:4 (TG53:4), triacylglycerol 54:5 (TG54:5), triacylglycerol 54:6 (TG54:6) and triacylglycerol 54:7 (TG54:7). In some embodiments, the FSLMs comprise two or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG51:1, TG51:2, TG51:3, TG51:4, TG52:3, TG52:5, TG53:2, TG53:3, TG53:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the FSLMs comprise three or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG51:1, TG51:2, TG51:3, TG51:4, TG52:3, TG52:5, TG53:2, TG53:3, TG53:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the FSLMs comprise five or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG51:1, TG51:2, TG51:3, TG51:4, TG52:3, TG52:5, TG53:2, TG53:3, TG53:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the FSLMs comprise ten or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG51:1, TG51:2, TG51:3, TG51:4, TG52:3, TG52:5, TG53:2, TG53:3, TG53:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the FSLMs comprise fifteen or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG51:1, TG51:2, TG51:3, TG51:4, TG52:3, TG52:5, TG53:2, TG53:3, TG53:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the FSLMs comprise twenty or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG51:1, TG51:2, TG51:3, TG51:4, TG52:3, TG52:5, TG53:2, TG53:3, TG53:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the FSLMs comprise twenty-five or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG51:1, TG51:2, TG51:3, TG51:4, TG52:3, TG52:5, TG53:2, TG53:3, TG53:4, TG54:5, TG54:6 and TG54:7.
[0203] In some embodiments, the FSLMs comprise one or more of cholesteryl esters (CEs), such as 16:0 (CE16:0) and cholesteryl ester 20:5 (CE20:5). In some embodiments, the FSLMs comprise one or more of ether phospholipids, e.g., one or more ether diacylglycerophosphocholines (PCO-), one or more phosphatidylethanolamine ethers (PEO-) or one or more phosphatidylcholine ethers, such as phosphatidylcholine ether PC(O-17:0/20:4). In some embodiments, the FSLMs comprise one or more of cholesteryl ester CE16:0, CE20:5 and 0-17:0/20:4. In some embodiments, the FSLMs comprise two or more of cholesteryl ester CE16:0, CE20:5 and 0-17:0/20:4. In some embodiments, the FSLMs comprise cholesteryl ester CE16:0, CE20:5 and 0-17:0/20:4.
[0204] In some embodiments, the efficacy of FXN replacement therapy in a subject can be determined, evaluated, and/or monitored based on the analysis of one or more FSLM lipid profiles before and after administration or initiation of FXN replacement therapy in the subject. Based on the results of the FSLM lipid profile analysis, adjustments can be made to the FXN replacement therapy in a subject to, e.g., initiate, increase, decrease or cease FXN replacement therapy in the subject.
Definitions
[0205] Unless defined otherwise, all technical and scientific terms used herein have the meaning commonly understood by a person skilled in the art to which this disclosure belongs. The following references, the entire disclosures of which are incorporated herein by reference, provide one of skill with a general definition of many of the terms (unless defined otherwise herein) used in this disclosure: Singleton et al., Dictionary of Microbiology and Molecular Biology (2.sup.nd ed. 1994); The Cambridge Dictionary of Science and Technology (Walker ed., 1988); The Glossary of Genetics, 5.sup.th Ed., R. Rieger et al. (eds.), Springer Verlag (1991); and Hale & Marham, the Harper Collins Dictionary of Biology (1991). Generally, the procedures of molecular biology methods described or inherent herein and the like are common methods used in the art. Such standard techniques can be found in reference manuals such as for example Sambrook et al., (2000, Molecular CloningA Laboratory Manual, Third Edition, Cold Spring Harbor Laboratories); and Ausubel et al., (1994, Current Protocols in Molecular Biology, John Wiley & Sons, New-York).
[0206] The following terms may have meanings ascribed to them below, unless specified otherwise. However, it should be understood that other meanings that are known or understood by those having ordinary skill in the art are also possible, and within the scope of the present disclosure.
[0207] As used herein, the singular forms a, and, and the include plural references unless the context clearly dictates otherwise. All technical and scientific terms used herein have the same meaning.
[0208] Unless specifically stated or obvious from context, as used herein, the term about is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from context, all numerical values provided herein can be modified by the term about.
[0209] As used herein, the term marker or biomarker is a biological molecule, or a panel of biological molecules, whose lipid level is correlated, e.g., either positively or negatively, with FXN levels. In some embodiments, a marker or a biomarker is an expressed gene, whose lipid level may be measured by measuring levels of the corresponding mRNA or a protein.
[0210] As used herein, a marker or biomarker of the disclosure whose respective levels are positively or negatively correlated to frataxin (FXN) levels in a cell or a sample obtained from a subject is referred to as a Frataxin-sensitive lipid marker or FSLM.
[0211] In some embodiments, an FSLM is a marker or a biomarker, e.g., a lipid, that is present in different amounts in samples obtained from a healthy subject as compared to a sample obtained from an FXN-deficient subject, e.g., a subject with FRDA. In further embodiments, an FSLM is contrary regulated by FXN gene ablation or deficiency, followed by FXN replacement therapy. For example, an FSLM may be a lipid, e.g., a triglyceride, wherein the three acyl groups in the triglyceride molecule contain less than 56 carbon atoms, e.g., TG53:2, that is present at a higher level in a sample obtained from an FXN-deficient subject as compared to a sample obtained from a healthy subject, and levels of which decrease in a sample from an FXN-deficient subject following FXN replacement therapy. Alternatively, for example, an FSLM may be PCO-, e.g., PC(?16:0/20:3), that is present at a lower level in a sample obtained an FXN-deficient subject as compared to a sample obtained from a healthy subject, and levels of which increase in a sample from an FXN-deficient subject following FXN replacement therapy.
[0212] In some embodiments, the FSLMs of the present disclosure are contrary regulated by FXN gene ablation or deficiency, followed by FXN protein replacement. Thus, in some embodiments, the FSLMs of the present disclosure are both associated with FXN deficiency in a subject and conversely associated with FXN replacement. An FSLM of the disclosure can be used to detect and/or monitor (e.g., serve as a surrogate for) FXN levels in a sample, e.g., a cell or tissue sample. In some embodiments, the FSLMs comprise one or more triglycerides (e.g., one or more triglycerides, wherein the three acyl groups in each triglyceride molecule contain 45 carbons to 58 carbons, or wherein the three acyl groups in each triglyceride molecule contain less than 56 carbons, or wherein the three acyl groups in each triglyceride molecule contain 56 or more carbons), ether phospholipids (e.g., PCO- and PEO-), phosphatidylcholines (PCs), cholesteryl esters (CEs); and diglycerides (DGs).
[0213] The term control sample or control, as used herein, refers to any clinically relevant comparative sample, or comparative lipid profile, including, for example, a sample from an FXN healthy subject (i.e., a subject with a normal FXN level), a normal FXN lipid profile, a sample obtained from an FXN deficient subject (i.e., a subject completely or partially lacking FXN lipid), a baseline FXN(?) lipid profile, or a sample obtained from an FXN-deficient subject following administration of FXN replacement therapy, or an FXN replacement lipid profile. A control sample can also be a sample from a subject from an earlier time point, e.g., prior to treatment with FXN replacement therapy. A control sample can be a purified sample, and/or a lipid provided with a kit. Such control samples can be diluted, for example, in a dilution series to allow for quantitative measurement of levels of analytes, e.g., markers, in test samples. A control sample may include a sample derived from one or more subjects. A control sample may also be a sample taken at an earlier time point from the subject to be assessed. For example, the control sample could be a sample taken from the subject to be assessed before treatment with FXN replacement therapy. The control sample may also be a sample from an animal model, or from a tissue or cell line derived from the animal model of a mitochondrial disease such as FRDA. The level of one or more FSLMs (e.g., 1, 2, 3, 4, 5, 6, 7, 8, or 9 or more FSLMs) in a control sample consists of a group of measurements that may be determined, e.g., based on any appropriate statistical measurement, such as, for example, measures of central tendency including average, median, or modal values. In one embodiment, different from a control is preferably statistically significantly different from a control.
[0214] As used herein, changed, altered, increased or decreased is understood as having a level of the one or more FSLM to be detected at a level that is statistically different, e.g., increased or decreased, as compared to a control sample or to a predetermined threshold value, e.g., from an FXN healthy subject (i.e., a subject with a normal FXN level), or a sample from an FXN deficient subject (e.g., a subject completely or partially lacking FXN lipid or having a reduced level of FXN lipid as compared to a normal control subject). Changed, altered, increased or decreased, as compared to control or threshold value, can also include a difference in the rate of change of the level of one or more FSLMs obtained in a series of at least two subject samples obtained over time. Determination of statistical significance is within the ability of those skilled in the art and can include any acceptable means for determining and/or measuring statistical significance, such as, for example, the number of standard deviations from the mean that constitute a positive or negative result, an increase in the detected level of an FSLM in a sample versus a control, wherein the increase is above some threshold value, or a decrease in the detected level of an FSLM in a sample versus a control, wherein the decrease is below some threshold value.
[0215] As used herein, detecting, detection, determining, and the like are understood to refer to identification of the presence and/or level of one or more FSLMs, such as one or more triglycerides (e.g., one or more triglycerides, wherein the three acyl groups in each triglyceride molecule contain 45 carbons to 55 carbons, or wherein the three acyl groups in each triglyceride molecule contain less than 56 carbons, CE16:0, CE20:5 and PC(O-17:0/20:4.
[0216] As used herein, the terms FXN deficient patient or FXN deficient subject, used interchangeably herein, refer to a subject who has been determined to have an FXN deficiency, e.g., been diagnosed with Friedreich's Ataxia (FRDA). In some embodiments, an FXN deficient subject has a reduced level of FXN lipid or activity, e.g., partially or completely lacking FXN expression or activity, as compared to a normal control subject (e.g., has less than 70%, 60%, 50%, 40%, 30%, 20%, or 10% of the FXN expression level or activity of a normal control subject). In some embodiments, an FXN deficient subject has not yet received FXN replacement therapy and is, therefore, therapy naive. In some embodiments, an FXN deficient subject is scheduled to receive FXN replacement therapy. In some embodiments, an FXN deficient subject is currently undergoing FXN replacement therapy. In some embodiments, an FXN deficient subject has already undergone an FXN replacement therapy. In some embodiments, an FXN deficient subject who is undergoing or has already undergone FXN replacement therapy has FXN levels that are partially or completely restored to FXN levels of a healthy subject.
[0217] Certain diseases result in FXN deficiencies in subjects, including mitochondrial diseases such as Friedreich's Ataxia (FRDA). As used herein, the term FXN replacement therapy refers to replacement of frataxin in a subject which results in increased level or activity of frataxin in the subject. The FXN replacement therapy may be carried out by FXN protein delivery or through delivery of a nucleic acid encoding FXN to a subject. FXN protein delivery to the subject can include delivery of FXN protein or delivery of a FXN fusion protein. As used herein, the term FXN fusion protein refers to full length FXN or a fragment of FXN fused to a full length or a fragment of a different protein, or to a peptide. In some embodiments, an FXN fusion protein comprises full-length hFXN (SEQ ID NO: 1) or mature hFXN (SEQ ID NO: 2), as described herein. In some embodiments, the FXN protein or fragment thereof is fused to a cell penetrating peptide (CPP). In some embodiments, the CPP is an HIV-TAT polypeptide. In some embodiments, FXN replacement therapy comprises administering to an FXN-deficient subject an FXN fusion protein comprising or consisting of SEQ ID NO: 12.
[0218] As used herein, the terms disorders, diseases, and abnormal state are used inclusively and refer to any deviation from the normal structure or function of any part, organ, or system of the body (or any combination thereof). A specific disease is manifested by characteristic symptoms and signs, including biological, chemical, and physical changes, and is often associated with a variety of other factors including, but not limited to, demographic, environmental, employment, genetic, and medically historical factors. An early stage disease state includes a state wherein one or more physical symptoms are not yet detectable. Certain characteristic signs, symptoms, and related factors can be quantitated through a variety of methods to yield important diagnostic information.
[0219] As used herein, the term mitochondrial disease refers to a disease which is the result of either inherited or spontaneous mutations in mtDNA or nDNA which leads to altered functions of the proteins or RNA molecules that normally reside in mitochondria, which decreases the functions of the mitochondria to induce diseases of various types in, for example, the central nervous system, skeletal muscles, heart, eyes, liver, kidneys, large intestine (colon), small intestine, internal ear and pancreas; as well as blood, skin and endocrine glands. In one non-limiting embodiment, the mitochondrial disease is Friedreich's Ataxia (FRDA).
[0220] As used herein, a sample obtained at an earlier time point is a sample that was obtained at a sufficient time in the past such that clinically relevant information could be obtained in the sample from the earlier time point as compared to the later time point. In certain embodiments, an earlier time point is at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23 hours, or 1, 2, 3, 4, 5, 6, or 7 days earlier. In some embodiments, an earlier time point is at least one, two, three or four weeks earlier. In certain embodiments, an earlier time point is at least six weeks earlier. In certain embodiments, an earlier time point is at least two months earlier. In certain embodiments, an earlier time point is at least three months earlier. In certain embodiments, an earlier time point is at least six months earlier. In certain embodiments, an earlier time point is at least nine months earlier. In certain embodiments, an earlier time point is at least one year earlier. Multiple subject samples (e.g., 3, 4, 5, 6, 7, or more) can be obtained at regular or irregular intervals over time and analyzed for trends in changes in FSLM levels. Appropriate intervals for testing for a particular subject can be determined by one of skill in the art based on ordinary considerations.
[0221] The term lipid profile as used herein, refers to a set of data obtained as a result of measuring levels of one or more lipids, such as one or more triglycerides (e.g., one or more triglycerides, wherein the three acyl groups in each triglyceride molecule contain 45 carbons to 55 carbons, or wherein the three acyl groups in each triglyceride molecule contain less than 56 carbons, ether phospholipids, such as PCO- or PEC, e.g., PC(O-17:0/20:4), cholesteryl esters, such as, CE16:0, CE20:5 and CE14:1, and diglycerides, such as DE(18:1/18:2), in a sample, e.g., a sample obtained from a subject. The term lipid profile may refer to the raw data, e.g., m/z values and/or retention times, obtained as a result of LC/MS analysis, or to the normalized lipid values. Lipid profiles may be determined by any convenient means for measuring a level of a lipid, such as LC/MS, and other techniques known to a person skilled in the art or described herein. Lipid profiles enable analysis of differential lipid levels between two or more samples, between samples and control, as well as between samples and thresholds. A lipid profile can also be determined by any means known to a person skilled in the art or described herein for measuring the level of a lipid, e.g., mass spectrometry, such as LC/MS, etc.
[0222] As referred to herein, the term FXN lipid profile includes any one of the following three FXN lipid profiles: a normal FXN lipid profile, a baseline FXN(?) lipid profile, or an FXN replacement lipid profile. In some embodiments, the baseline FXN(?) lipid profile can be used as a control. In some embodiments, the normal FXN lipid profile can be used as a control.
[0223] In some embodiments, the term FXN lipid profile for one or more FSLMs refers to the lipid level of the one or more FSLMs or to a value or set of values indicative of the lipid level of the one or more FSLMs. In some embodiments, an FXN lipid profile comprises a feature vector of values indicative of level of the one or more FSLMs. In some embodiments, determining an FXN lipid profile for one or more FSLMs comprises detecting the level of the one or more FSLMs. In some embodiments, determining an FXN lipid profile for one or more FSLMs comprises determining a lipid feature vector of values indicative of the level of the one or more FSLMs.
[0224] As referred to herein, the term normal FXN lipid profile refers to a lipid profile of one or more FSLMs in a sample obtained from a normal, healthy subject or subjects (i.e., a subject that is not FXN deficient). In some embodiments, a normal FXN lipid profile also encompasses an average of multiple, e.g., two or more, normal FXN lipid profiles (e.g., from two or more subjects). As referred to herein, the term baseline FXN(?) lipid profile refers to the lipid profile of one or more FSLMs in a sample from an FXN deficient subject prior to treatment with an FXN replacement therapy. In some embodiments, the term baseline FXN(?) lipid profile encompasses an average of multiple, e.g., two or more, baseline FXN(?) lipid profiles (e.g., from two more subjects).
[0225] An average FXN lipid profile, e.g., an average normal FXN lipid profile or an average baseline FXN(?) lipid profile, may be determined by methods known in the art, e.g., by determining the level of one or more FSLMs in a sample obtained from each of two or more subjects, e.g., normal subjects or FXN-deficient subjects, and then calculating an average lipid level of the one or more FSLMs.
[0226] As referred to herein, the term reference FXN lipid profile encompasses a normal FXN lipid profile and a baseline FXN(?) lipid profile, i.e., can be either one. The reference lipid profile, e.g., reference normal FXN lipid profile or reference baseline FXN(?) lipid profile, can be used as a control, e.g., for comparing to an FXN replacement lipid profile to evaluate response of a subject to an FXN replacement therapy.
[0227] As referred to herein, the term FXN replacement lipid profile refers to the lipid profile for one or more FSLMs in a sample obtained from an FXN-deficient subject subsequent to administration of at least one dose of an FXN replacement therapy.
[0228] As used herein, the term treatment with FXN replacement therapy refers to administration to a subject of at least one dose of an FXN replacement therapy. The terms following treatment with FXN replacement therapy, subsequent to treatment with FXN replacement therapy, following administration of FXN replacement therapy or subsequent to administration of FXN replacement therapy, as used herein, refers to at least 1 day, e.g., at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, or more days after administration of a dose of an FXN replacement therapy.
[0229] As referred to herein, the term evaluate response of a subject to FXN replacement therapy encompasses evaluating efficacy of FXN replacement therapy by (a) determining an FXN replacement lipid profile in a sample from an FXN deficient subject following treatment with FXN replacement therapy; (b) comparing the FXN replacement lipid profile with a reference FXN lipid profile; and (c) using the comparison in step (b) to evaluate or determine efficacy of the FXN replacement therapy.
[0230] In some embodiments, the reference FXN lipid profile is a baseline FXN(?) lipid profile, i.e., the lipid profile of one or more FSLMs in a sample obtained from an FXN deficient subject prior to treatment with FXN replacement therapy. In some embodiments, a difference between the FXN replacement lipid profile and the baseline FXN(?) lipid profile is indicative of the efficacy of or response to the FXN replacement therapy.
[0231] In some embodiments, the reference FXN lipid profile is a normal FXN lipid profile, i.e., the lipid profile of one or more FSLMs in a sample obtained from a normal subject. In some embodiments, a comparison between the FXN replacement lipid profile and the normal FXN lipid profile, e.g., a similarity between the two profiles, is indicative of the efficacy of or response to the FXN replacement therapy.
[0232] A higher level of lipid, higher lipid level, higher level, increased level, and the like of an FSLM refers to a lipid level in a test sample that is greater than the standard error of the assay employed to assess lipid level, and is preferably at least 25% more, at least 50% more, at least 75% more, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten times the lipid level of the FSLM in a control sample (e.g., a sample obtained from a healthy subject, a sample obtained from an FXN deficient subject, or a sample obtained from a subject following FXN replacement therapy) and preferably, the average lipid level of the FSLM or FSLMs in several control samples.
[0233] The term including is used herein to mean, and is used interchangeably with, the phrase including but not limited to.
[0234] As used herein, one or more is understood as encompassing each value 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, and any value greater than 10.
[0235] The term or is used inclusively herein to mean, and is used interchangeably with, the term and/or, unless context clearly indicates otherwise.
[0236] As used herein, patient or subject can mean either a human or non-human animal, preferably a mammal. By subject is meant any animal, including horses, dogs, cats, pigs, goats, rabbits, hamsters, monkeys, guinea pigs, rats, mice, lizards, snakes, sheep, cattle, fish, and birds. A human subject may be referred to as a patient.
[0237] As used herein, a reference level of an FSLM may be an absolute or relative amount or concentration of the FSLM, a presence or absence of the FSLM, a range of amount or concentration of the FSLM, a minimum and/or maximum amount or concentration of the FSLM, a mean amount or concentration of the FSLM, and/or a median amount or concentration of the FSLM; and, in addition, reference levels of combinations of FSLMs may also be ratios of absolute or relative amounts or concentrations of two or more FSLMs with respect to each other. Appropriate positive and negative reference levels of FSLMs for a particular disease state, phenotype, or lack thereof may be determined by measuring levels of desired FSLMs in one or more appropriate subjects, and such reference levels may be tailored to specific populations of subjects (e.g., a reference level may be age-matched so that comparisons may be made between FSLM levels in samples from subjects of a certain age and reference levels for a particular disease state, phenotype, or lack thereof in a certain age group). Such reference levels may also be tailored to specific techniques that are used to measure levels of FSLMs in biological samples (e.g., LC-MS, GC-MS, etc.), where the levels of FSLMs may differ based on the specific technique that is used.
[0238] As used herein, sample or biological sample includes a specimen or culture obtained from any source. In some embodiments, a sample includes any specimen or culture that comprises cells in which FXN lipid profile may be analyzed. In some embodiments, a sample includes any specimen or culture from a subject deficient in FXN or a subject being treated with FXN replacement therapy. For example, biological samples can be obtained from a solid tissue sample, preferably a buccal sample, alternatively a skin biopsy sample, skin strip, hair follicle, muscle biopsy sample, or a body fluid sample such as blood (including any blood product, such as whole blood, plasma, serum, or specific types of cells of the blood, e.g., platelets), urine, saliva, or seminal fluid. In one embodiment, the biological sample is a buccal sample. In another embodiment, the biological sample is a skin sample, e.g., a skin biopsy sample or a skin strip. In one embodiment, the biological sample is a platelet sample. Alternatively, a sample can comprise exosomes which may be harvested in order to be tested for FSLMs.
[0239] The term such as is used herein to mean, and is used interchangeably, with the phrase such as but not limited to.
[0240] The term triglyceride, which may be used herein interchangeably with the term triacylglycerol, refers to a molecule represented by Formula I:
##STR00001##
wherein each of R.sub.1, R.sub.2 and R.sub.3 is independently a hydrocarbon chain that may comprise one or more double bonds. As will be readily understood by one of ordinary skill in the art, a term used in reference to specific triglycerides, such asTG50:4, refers to triglycerides of Formula I in which R.sub.1, R.sub.2 and R.sub.3 together contain a total of 50 carbons and 4 double bonds. Similarly, the term TG51:1 refers to a triglyceride of Formula I in which R.sub.1, R.sub.2 and R.sub.3 together contain a total of 51 carbons and 1 double bond, etc. All other references to specific triglycerides listed below are understood accordingly.
[0241] It will also be understood by one of ordinary skill in the art that each term used in reference to specific triglycerides as listed below may encompass more than one triglyceride species. For example, the term TG50:4 may encompass more than one triglyceride species in which R.sub.1, R.sub.2 and R.sub.3 together contain a total of 56 carbons and 6 double bonds e.g., TG(18:3/16:0/16:1), and TG(18:2/18:2/14:0). Additionally, the term TG(18:3/16:0/16:1) encompasses triglycerides in which the positions of the double bonds in R.sub.1 and R.sub.3 may vary.
[0242] In some embodiments, the term triglyceride refers to a group of lipids that encompasses TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, TG56:4, TG56:5, TG56:6, TG56:7, TG56:8, TG56:9, TG56:10, TG58:5, TG58:6, TG58:7, TG58:8, TG58:11. In some embodiments, the term triglyceride refers to a group of triglycerides, wherein the three acyl groups in each triglyceride molecule contain less than 56 carbons and/or wherein the three acyl groups in each triglyceride molecule contain 7 or less unsaturations, e.g., TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7.
[0243] In some embodiments, the term triglyceride also encompasses epoxy-TGs, i.e., triglycerides in which one or more double bonds, if present, has been oxidized to form an epoxide.
[0244] As used herein, the term unsaturation, as used herein, refers to a double bond present in a triglyceride. In some embodiments, the language three acyl groups in each triglyceride molecule contain 7 unsaturations or less means that the three acyl groups in each triglyceride molecule contain a total of 7, or less than 7, double bonds. In some embodiments, the language three acyl groups in each triglyceride molecule contain more than 7 unsaturations means that the three acyl groups in each triglyceride molecule contain more than 7 double bonds. In some embodiments, the language three acyl groups in each triglyceride molecule contain 6 or more unsaturations means that the three acyl groups in each triglyceride molecule contain 6 or more double bonds.
[0245] As used herein, the term ether phospholipid refers to a group of lipids that encompasses ether diacylglycerophosphocholines (PCO-) and phosphatidylethanolamine ethers (PEO-).
[0246] The term ether diacylglycerophosphocholine, which may be used interchangeably with the term PCO-, the term ether phosphatidylcholine, the term phosphatidylcholine ether or the term PC ether, refers to a molecule represented by Formula (II):
##STR00002##
wherein each of R.sub.1 and R.sub.2 is independently a hydrocarbon chain that may comprise one or more double bonds. The term ether diacylglycerophosphocholines encompasses, but is not limited to, 1-alkyl, 2-acylglycerophosphocholines representing group GP0102 of the LIPID MAPS? Lipid Classification System (http://lipidmaps.org). The term ether diacyglycerophosphocholines also encompasses PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:1/22:6), PC(O-22.2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7 and PCO-46.8.
[0247] As will be readily understood by one of ordinary skill in the art, the term PC(O-18:0/18:1), for example, refers to a molecule of Formula (II) in which R.sub.1 contains a total of 18 carbons and no double bonds and R.sub.2 contains a total of 18 carbons and 1 double bond. As will also be readily understood by one of ordinary skill in the art, the term PCO-40:6, for example, refers to a molecule of Formula (II) in which R.sub.1 and R.sub.2 together contain a total of 40 carbons and a total of 6 double bonds. All other references to specific triglycerides listed above are understood accordingly. It will also be understood by one of ordinary skill in the art that each term used in reference to PCO- as listed above may encompass more than one PCO- species. For example, the term PCO-40:6 may encompass PCO- species in which the number of carbons and the positions of the double bonds in R.sub.1 and R.sub.2 vary. For example, the term PCO-(18:0/18:1) may encompass PCO- species in which the position of the double bond in R.sub.2 varies.
[0248] The term phosphatidylethanolamine ether, which may be used interchangeably with the term ether phosphatidylethanolamine, the term PEO- or the term PE ether, refers to a molecule represented by Formula (III):
##STR00003##
The term phosphatidylethanolamine ethers encompasses 1-alkyl, 2-acylglycerophosphoethanolamines, which represent group GP0202 of the LIPID MAPS? Lipid Classification System (http://lipidmaps.org). Exemplary PEO- species include, e.g., PEO-38:5, PEO-36:0, PEO-38:0, PEO-40:0, PEO-34:1, PEO-38:6, etc. It will also be understood by one of ordinary skill in the art that each term used in reference to PEO- as listed above may encompass more than one PEO- species. For example, the term PEO-38:6 may encompass PEO- species in which the number of carbons and the positions of the double bonds in R.sub.1 and R.sub.2 vary.
[0249] The term phosphatidylcholine, which may be used interchangeably with the term PC, encompasses lipids of the structure comprising a glycerol backbone covalently bonded to two fatty acids and a phosphocholine molecule. The fatty acids can be of variable length, hydroxylated, and contain double bonds. In some embodiments, the term phosphatidylcholines encompasses the following species: PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC (16:1/20:4), PC(16:1/22:5), PC(17:0/20:5), PC(17:1/20:4), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:1/24:1), PC(18:2/18:2), PC(18:2/18:3), PC(18:2/20:5), PC(20:4/15:0), PC(20:4/20:0), PC(40:6), and PC(42:7).
[0250] As will be readily understood by one of ordinary skill in the art, the term PC(18:1/20:3), for example, refers to a phosphatidylcholine in which one fatty acid contains a total of 18 carbons and 1 double bond, and the second fatty acid contains a total of 20 carbons and 3 double bonds. As will also be readily understood by one of ordinary skill in the art, the term PC(42:7), for example, refers to a phosphatidylcholine containing a total of 42 carbon atoms in its two fatty acids and a total of 7 double bonds. All other references to specific PCs listed above are understood accordingly. It will also be understood by one of ordinary skill in the art that each term used in reference to PCs as listed above may encompass more than one PC species.
[0251] The term cholesteryl ester, which may be used interchangeably with the term CE, encompasses lipids of the structure comprising cholesterol covalently bonded to a fatty acid via an ester bond. The ester bond is formed between the carboxylate group of the fatty acid and the hydroxyl group of cholesterol. In some embodiments, the term cholesteryl ester encompasses CE14:1, CE16:0 and CE20:5. As will be readily understood by one of ordinary skill in the art, the term CE14:1, for example, refers to a cholesteryl ester containing 14 carbon atoms in its fatty acid and one double bond. All other references to specific PCs listed above are understood accordingly. It will also be understood by one of ordinary skill in the art that each term used in reference to PC as listed above may encompass more than one PC species. For example, the term CE14:1 may encompass species in which the position of the double bond in the fatty acid varies.
[0252] The term diglyceride, which may be used interchangeably with the term DGs, encompasses lipids of the structure comprising two fatty acid chains covalently bonded to a glycerol molecule through ester linkages. The term diglyceride encompasses 1,2-diacylglycerols and 1,3-diacylglycerols. In some embodiments, the term diglycerides encompasses DG(18:1/18:2), in which one fatty acid contains a total of 18 carbons and 1 double bond, and the second fatty acid contains a total of 18 carbons and 2 double bonds. It will also be understood by one of ordinary skill in the art that each term used in reference to DGs, e.g., DG(18:1/18:2) may encompass more than one DG species. For example, the term DG(18:1) may encompass DG species in which the locations of one or more double bonds vary.
[0253] As used herein, the term progression of FXN deficiency refers to worsening of a condition of an FXN-deficient subject over time. This term encompasses an increase in severity and/or duration of existing symptoms of FXN deficiency and/or appearance of one or more new symptoms of FXN deficiency in an FXN-deficient subject.
[0254] As used herein, internal standard is understood as a chemical substance that is added in a known amount directly to each sample containing an analyte. The amount of analyte present is then determined relative to the internal standard as a calibrant. In some embodiments, the internal standard is an isotopically labeled internal standard, and is an isotopically labeled version of the analyte molecule. The mass spectrometric signal produced by the analyte differs from the mass spectrometric signal produced by the isotopically labeled standard, the difference being dependent on the type and the number of the isotope atoms incorporated into the isotopically labeled version of the analyte. In some embodiments, isotopically labeled version of one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG51:1, TG51:2, TG51:3, TG51:4, TG52:3, TG52:5, TG53:2, TG53:3, TG53:4, TG54:5, TG54:6, TG54:7, TG56:6, TG56:7, TG56:8, TG56:9, TG56:10, TG58:8, TG58:11, CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4) may function as an internal standard.
[0255] As used herein, the term mass spectrometry or MS refers to an analytical technique to identify compounds by their mass. MS refers to methods of filtering, detecting, and measuring ions based on their mass-to-charge ratio, or m/z. MS technology generally includes (1) ionizing the compounds to form charged compounds; and (2) detecting the molecular weight of the charged compounds and calculating a mass-to-charge ratio. The compounds may be ionized and detected by any suitable means. A mass spectrometer generally includes an ionizer and an ion detector. In general, one or more molecules of interest are ionized, and the ions are subsequently introduced into a mass spectrometric instrument where, due to a combination of magnetic and electric fields, the ions follow a path in space that is dependent upon mass (m) and charge (z).
[0256] As used herein, the term operating in negative ion mode refers to those mass spectrometry methods where negative ions are generated and detected. The term operating in positive ion mode as used herein, refers to those mass spectrometry methods where positive ions are generated and detected.
[0257] As used herein, the term ionization or ionizing refers to the process of generating an analyte ion having a net electrical charge equal to one or more electron units. Negative ions are those having a net negative charge of one or more electron units, while positive ions are those having a net positive charge of one or more electron units.
[0258] Any compositions or methods provided herein can be combined with one or more of any of the other compositions and methods provided herein.
[0259] Ranges provided herein are understood to be shorthand for all of the values within the range. For example, a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, and 50.
[0260] Reference will now be made in detail to exemplary embodiments of the disclosure. While the disclosure will be described in conjunction with the exemplary embodiments, it will be understood that it is not intended to limit the disclosure to those embodiments. To the contrary, it is intended to cover alternatives, modifications, and equivalents as may be included within the spirit and scope of the disclosure as defined by the appended claims.
FSLMs of the Disclosure
[0261] The present disclosure provides a set of markers, also referred to herein as FXN-sensitive lipid markers (FSLMs), whose respective levels are positively or negatively correlated to frataxin (FXN) levels in a cell or a subject (e.g., a sample from a subject). In some embodiments, the FSLMs of the present disclosure are contrary regulated by FXN gene ablation or deficiency, followed by FXN protein replacement. Thus, said FSLMs of the present disclosure are both associated with FXN deficiency in a subject and conversely associated with FXN replacement. All of the FSLMs disclosed herein were found to be sensitive to FXN levels and are considered markers of FXN replacement therapy. Therefore, these FSLMs can be used to evaluate and/or monitor progression of FXN deficiency in a subject, as described herein. These FSLMs can also be used to evaluate and/or monitor an FXN replacement therapy, e.g., evaluate, monitor, or determine efficacy of an FXN replacement therapy, in a subject, as described herein.
[0262] For example, in one aspect, the present disclosure provides a method for determining, evaluating, and/or monitoring the effectiveness of FXN replacement therapy comprising determining: (i) a baseline FXN(?) lipid profile for one or more FSLMs in a sample from an FXN deficient subject prior to treatment with FXN replacement therapy; and (ii) determining a subject FXN replacement lipid profile for the one or more FSLMs in a sample from an FXN deficient subject undergoing FXN replacement therapy or subsequent to treatment with FXN replacement therapy; comparing the subject FXN replacement lipid profile with the baseline FXN(?) lipid profile; and using the results of the comparison to determine, evaluate, or monitor effectiveness of the FXN replacement therapy. Based on the results of the FSLM lipid profile analysis, adjustments can be made to the FXN replacement therapy in the subject to, e.g., initiate, increase (e.g., increase dose and/or frequency of administration), decrease (e.g., decrease dose and/or frequency of administration) or cease FXN replacement therapy in the subject.
[0263] Another aspect of the disclosure relates to providing a method for identifying one or more FSLMs, which are markers whose levels is sensitive to FXN levels in a cell of a subject, e.g., an FXN deficient subject. The method comprises determining the lipid profile in a sample from a healthy subject, having normal FXN levels, referred to herein as a normal FXN lipid profile; determining the lipid profile in a sample from a subject having deficient FXN levels, referred to herein as a baseline FXN(?) lipid profile; and comparing the normal FXN lipid profile with the baseline FXN(?) lipid profile; wherein the lipid markers whose level is altered in the baseline FXN(?) lipid profile compared to the normal FXN lipid profile are identified as FSLMs. Additionally, or alternatively, the method for determining FSLMs may comprise a comparison between the lipid profiles obtained from a sample from an FXN deficient subject receiving FXN replacement therapy (baseline FXN(?) lipid profile) and the lipid profiles obtained from a sample from the FXN deficient subject during or after receiving FXN replacement therapy. The lipid profile from a sample obtained from an FXN deficient subject during or after FXN replacement therapy is also referred to herein as an FXN replacement lipid profile. In embodiments, the lipids whose level is altered in the FXN replacement lipid profile as compared to the baseline FXN(?) lipid profile, are identified as FSLMs.
[0264] In some embodiments, the FSLMs of the disclosure comprise any combination of one or more TGs (e.g., one or more triglycerides, wherein the three acyl groups in each triglyceride molecule contain 45 carbons to 55 carbons, or wherein the three acyl groups in each triglyceride molecule contain less than 56 carbons, or wherein the three acyl groups in each triglyceride molecule contain 7 or less unsaturations), cholesteryl esters, e.g., CE16:0 or CE20:5; and ether phospholipids, e.g., PCO- or PEO, including phosphatidylcholine ethers, such as PC(O-17:0/20:4, phosphatidylcholines (PCs) and diglycerides (DGs). In some embodiments, the FSLMs of the disclosure comprise any combination of one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG51:1, TG51:2, TG51:3, TG51:4, TG52:3, TG52:5, TG53:2, TG53:3, TG53:4, TG54:5, TG54:6, TG54:7, CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4). In some embodiments, the FSLMs of the disclosure comprise any combination of one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, CE16:0, CE20:5, CE14:1 and DG18:1/18:2. In some embodiments of the present disclosure, other markers known in the art for measuring FXN lipid or efficacy of FXN replacement therapy can be used in connection with the methods of the present disclosure.
[0265] In some embodiments, the one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more) FSLMs is selected, e.g., from TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2.
[0266] In some embodiments, the term one or more FSLMs is intended to mean that one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more) FSLMs is selected, e.g., from the following groups: (a) triglycerides (TGs), wherein the three acyl groups in each triglyceride molecule contain less than 56 carbons and/or wherein the three acyl groups in each triglyceride molecule contain 7 or less unsaturations; (b) ether phospholipids (e.g., PCO- and PEO-); (c) phosphatidylcholines (PCs); (d) cholesteryl esters (CEs); and (e) diglycerides (DGs). In some embodiments, the one or more FSLMs may be selected from the group consisting of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2.
[0267] Methods provided herein include one or any combination of, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more FSLMs selected from one or more TGs wherein the three acyl groups in each TG molecule contain less than 56 carbon atoms, and/or wherein the three acyl groups in each TG molecule contain 7 or less unsaturations, cholesteryl esters, e.g., CE16:0 or CE20:5, and ether phospholipids, e.g., PCO- or PEO, including phosphatidylcholine ethers, such as PC(O-17:0/20:4).
[0268] In some embodiments, the one or more FSLMs of the disclosure comprise one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more) lipid markers selected from one or more TGs (e.g., one or more triglycerides, wherein the three acyl groups in each triglyceride molecule contain less than 56 carbon atoms, or wherein the three acyl groups in each TG molecule contain 7 or less unsaturations, cholesteryl esters, e.g., CE16:0 or CE20:5 and ether phospholipids, e.g., PCO- or PEO, including phosphatidylcholine ethers, such as PC(O-17:0/20:4.
[0269] In some embodiments, the one or more FSLMs comprise one or any combination of one or more TGs, wherein the three acyl groups in each TG molecule contain less than 56 carbon atoms. In some embodiments, the one or more FSLMs comprise one or any combination of one or more TGs, wherein the three acyl groups in each TG molecule contain 7 or less unsaturations. In some embodiments, the one or more FSLMs comprise one or any combination of CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4). In some embodiments, the one or more FSLMs comprise one or any combination of one or more TGs, wherein the three acyl groups in each TG molecule contain less than 56 carbon atoms, CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4). In some embodiments, the one or more FSLMs comprise one or any combination of one or more TGs, wherein the three acyl groups in each TG molecule contain 7 or less unsaturations, CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4).
[0270] In some embodiments, the one or more FSLMs comprise one or any combination of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG51:1, TG51:2, TG51:3, TG51:4, TG52:3, TG52:5, TG53:2, TG53:3, TG53:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise one or any combination of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7.
[0271] In some embodiments, the one or more FSLMs comprise TG45:1. In some embodiments, the one or more FSLMs comprise TG46:1. In some embodiments, the one or more FSLMs comprise TG46:3. In some embodiments, the one or more FSLMs comprise TG47:1. In some embodiments, the one or more FSLMs comprise TG47:2. In some embodiments, the one or more FSLMs comprise TG48:0. In some embodiments, the one or more FSLMs comprise TG48:1. In some embodiments, the one or more FSLMs comprise TG48:2. In some embodiments, the one or more FSLMs comprise TG48:1. In some embodiments, the one or more FSLMs comprise TG48:3. In some embodiments, the one or more FSLMs comprise TG49:1. In some embodiments, the one or more FSLMs comprise TG49:2. In some embodiments, the one or more FSLMs comprise TG49:3. In some embodiments, the one or more FSLMs comprise TG49:4. In some embodiments, the one or more FSLMs comprise TG50:1. In some embodiments, the one or more FSLMs comprise TG50:2. In some embodiments, the one or more FSLMs comprise TG50:3. In some embodiments, the one or more FSLMs comprise TG50:4. In some embodiments, the one or more FSLMs comprise TG50:5. In some embodiments, the one or more FSLMs comprise TG51:1. In some embodiments, the one or more FSLMs comprise TG51:2. In some embodiments, the one or more FSLMs comprise TG51:3. In some embodiments, the one or more FSLMs comprise TG51:4. In some embodiments, the one or more FSLMs comprise TG52:2. In some embodiments, the one or more FSLMs comprise TG52:3. In some embodiments, the one or more FSLMs comprise TG52:4. In some embodiments, the one or more FSLMs comprise TG52:5. In some embodiments, the one or more FSLMs comprise TG52:6. In some embodiments, the one or more FSLMs comprise TG53:2. In some embodiments, the one or more FSLMs comprise TG53:3. In some embodiments, the one or more FSLMs comprise TG53:4. In some embodiments, the one or more FSLMs comprise TG53:5. In some embodiments, the one or more FSLMs comprise TG54:4. In some embodiments, the one or more FSLMs comprise TG54:5. In some embodiments, the one or more FSLMs comprise TG54:6. In some embodiments, the one or more FSLMs comprise TG54:7.
[0272] In some embodiments, the one or more FSLMs comprise one or any combination of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, and PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0), CE14:1, CE16:0 and CE20:5 and DG18:1/18:2.
[0273] In some embodiments, the one or more FSLMs comprise 2 or more, e.g., 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, 10 or more, 11 or more, 12 or more, 13 or more, 14 or more, 15 or more, 16 or more, 17 or more, 18 or more, 19 or more, 20 or more, or 25 or more, of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, and PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0), CE14:1, CE16:0 and CE20:5 and DG18:1/18:2, in any combination.
[0274] In some embodiments, the one or more FSLMs comprise CE16:0. In some embodiments, the one or more FSLMs comprise CE20:5. In some embodiments, the one or more FSLMs comprise PC(O-16:0/18:2). In some embodiments, the one or more FSLMs comprise PC(O-16:0/22:6). In some embodiments, the one or more FSLMs comprise PC(O-18:0/18:2). In some embodiments, the one or more FSLMs comprise PC(O-18:1/20:5). In some embodiments, the one or more FSLMs comprise PCO-36:3. In some embodiments, the one or more FSLMs comprise PCO-34:2. In some embodiments, the one or more FSLMs comprise PCO-40:2. In some embodiments, the one or more FSLMs comprise PCO-44:7. In some embodiments, the one or more FSLMs comprise PC(O-17:0/20:4).
[0275] In some embodiments, the one or more FSLMs comprise one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise two or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise three or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise four or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise five or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise six or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise seven or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise eight or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise nine or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise ten or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise eleven or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise twelve or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise thirteen or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise fourteen or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise fifteen or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise sixteen or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise seventeen or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise eighteen or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise nineteen or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise twenty or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise twenty-one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise twenty-two or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise twenty-three or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise twenty-four or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise twenty-five or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise twenty-six or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise twenty-seven or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, the one or more FSLMs comprise TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7.
[0276] In some embodiments, the one or more FSLMs comprise one or more of CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4). In some embodiments, the one or more FSLMs comprise two or more of CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4). In some embodiments, the one or more FSLMs comprise three or more of CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4). In some embodiments, the one or more FSLMs comprise four or more of CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4). In some embodiments, the one or more FSLMs comprise five or more of CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4). In some embodiments, the one or more FSLMs comprise six or more of CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4). In some embodiments, the one or more FSLMs comprise seven or more of CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4). In some embodiments, the one or more FSLMs comprise eight or more of CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4). In some embodiments, the one or more FSLMs comprise nine or more of CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4). In some embodiments, the one or more FSLMs comprise ten or more of CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4). In some embodiments, the one or more FSLMs comprise CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4).
[0277] In some embodiments, the one or more FSLMs comprise CE16:0. In some embodiments, the one or more FSLMs comprise CE20:5. In some embodiments, the one or more FSLMs comprise PC(O-16:0/18:2). In some embodiments, the one or more FSLMs comprise PC(O-16:0/22:6). In some embodiments, the one or more FSLMs comprise PC(O-18:0/18:2). In some embodiments, the one or more FSLMs comprise PC(O-18:1/20:5). In some embodiments, the one or more FSLMs comprise PCO-36:3. In some embodiments, the one or more FSLMs comprise PCO-34:2. In some embodiments, the one or more FSLMs comprise PCO-40:2. In some embodiments, the one or more FSLMs comprise PCO-44:7. In some embodiments, the one or more FSLMs comprise PC(O-17:0/20:4). In some embodiments, the one or more FSLMs comprise CE16:0 and CE20:5. In some embodiments, the one or more FSLMs comprise CE16:0 and PC(O-17:0/20:4). In some embodiments, the one or more FSLMs comprise CE20:5 and PC(O-17:0/20:4). In some embodiments, the one or more FSLMs comprise CE16:0, CE20:5 and PC(O-17:0/20:4).
[0278] By way of example, an FXN lipid profile may be determined through the measurement of lipid levels of at least one or any combination of more than one FSLM. Hereinafter a lipid profile may also be referred to as a signature.
[0279] In one embodiment of the disclosure, a baseline FXN(?) lipid profile comprises altered levels of at least one or any combination of more than one FSLM, such as one or more triglycerides (e.g., one or more triglycerides, wherein the three acyl groups in each triglyceride molecule contain 45 carbons to 55 carbons, or wherein the three acyl groups in each triglyceride molecule contain less than 56 carbons), ether phospholipids, e.g., PCO- and PEO-, phosphatidylcholines (PCs), cholesteryl esters (CEs) and diglycerides (DGs), e.g., CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4.
[0280] In one embodiment of the disclosure, a baseline FXN(?) lipid profile may comprise the downregulated lipid levels of at least one of CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4), or any combination thereof. In one embodiment of the disclosure, a baseline FXN(?) lipid profile may comprise the downregulated lipid levels of at least one of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE16:0 and CE20:5. A measure of effectiveness of FXN replacement therapy may be indicated by a pattern of upregulation of levels of any one or more of these FSLMs.
[0281] In one embodiment of the disclosure, a baseline FXN(?) lipid profile may comprise the upregulated lipid levels of at least one of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG51:1, TG51:2, TG51:3, TG51:4, TG52:3, TG52:5, TG53:2, TG53:3, TG53:4, TG54:5, TG54:6 and TG54:7, or any combination thereof. In one embodiment of the disclosure, a baseline FXN(?) lipid profile may comprise the upregulated lipid levels of at least one of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, DG18:1/18:2, and CE14:1. A measure of effectiveness of FXN replacement therapy may be indicated by a pattern of downregulation of levels of any one or more of these FSLMs.
[0282] In one embodiment, an FXN replacement lipid profile comprises the reversed lipid levels of a baseline FXN(?) lipid profile.
[0283] In another embodiment, an FXN replacement lipid profile for use as an indicator of FXN replacement treatment effectiveness may comprise one or any combination of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG51:1, TG51:2, TG51:3, TG51:4, TG52:3, TG52:5, TG53:2, TG53:3, TG53:4, TG54:5, TG54:6, TG54:7, CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4). In another embodiment, an FXN replacement lipid profile for use as an indicator of FXN replacement treatment effectiveness may comprise one or any combination of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2.
[0284] In some embodiments, an FXN replacement lipid profile is characterized by the contrary regulation of FSLMs, which is defined by any FSLMs that were downregulated in FXN depletion conditions, e.g., in a subject with FRDA, that become upregulated following FXN replacement therapy; and the reverse is also valid, such that any FSLMs that were upregulated in FXN depletion conditions, e.g., in a subject with FRDA, become downregulated following FXN replacement therapy. Accordingly, detection of altered lipid of one or more FSLMs in a sample following FXN replacement therapy allows for monitoring of efficacy of the FXN replacement therapy in a subject. For example, in one embodiment, a lack of altered lipid of one or more FSLMs in a sample following FXN replacement therapy indicates that the FXN replacement therapy may not have been successful and/or that increased FXN replacement therapy may be needed. Likewise, in another embodiment, altered lipid of one or more FSLMs in a sample following FXN replacement therapy indicates that FXN replacement therapy was successful.
[0285] As referred to herein, lipid feature vectors are a set of values that characterize a lipid profile. Lipid feature vectors may comprise a set of n FSLMs, n being the number of different lipids whose levels were measured in a sample. By way of example, n may be all triglycerides (e.g., one or more triglycerides, wherein the three acyl groups in each triglyceride molecule contain 45 carbons to 55 carbons, or wherein the three acyl groups in each triglyceride molecule contain less than 56 carbons; or wherein the three acyl groups in each triglyceride molecule contain 7 or less unsaturations), CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4). Alternatively, n may be at least one, two, or three, or four, or five, or six, or any number of triglycerides, wherein the three acyl groups in each triglyceride molecule contain less than 56 carbon atoms and/or 7 or less unsaturations (e.g., TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7).
[0286] In one embodiment, a set of FSLMs may comprise at least one or any combination of more than one FSLM, e.g., triglycerides, CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 and PC(O-17:0/20:4). In one embodiment, one or more of FSLMs comprise one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2, in any combination.
[0287] In one embodiment, methods provided by the present disclosure comprise determining an FXN lipid profile for the one or more FSLMs described above. In one embodiment, the one or more FSLMs comprise CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 or PC(O-17:0/20:4). In one embodiment, the one or more FSLMs comprise one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2.
[0288] By way of example, a normal FXN lipid profile, obtained from samples of healthy subjects, may be comprised of lipid levels of a set of FSLMs, and may be represented by and referred to as a normal FXN lipid feature vector. As described in the following examples, FSLMs when measured in FXN deficient samples, e.g., samples from subject with FRDA, may present lipid levels that are different from the levels of lipid of FSLMs in healthy subjects, and thus may be represented by and referred to as a deficient FXN lipid feature vector. In one embodiment, the difference between a deficient FXN lipid feature vector and a normal FXN lipid feature vector may be detected and quantified by the distance between the two lipid feature vectors. In an alternative scenario, lipid levels of FSLMs from a sample from an FXN deficient subject, e.g., subject with FRDA, following FXN replacement treatment may present yet different lipid levels, and may be represented by and referred to as an FXN replacement lipid feature vector. As for the previous two lipid feature vectors, the difference between an FXN replacement lipid feature vector and either a normal FXN lipid feature vector or a deficient FXN lipid feature vector may be detected and quantified by the distance between the replacement FXN lipid feature vector and the normal FXN lipid feature vector or the deficient FXN lipid feature vector.
[0289] As such, having a sample from an FXN deficient subject obtained prior to treatment and a sample obtained post-FXN replacement treatment, a first FXN lipid feature vector may be determined for the FXN replacement lipid profile and a second FXN lipid feature vector may be determined for the baseline FXN(?) lipid profile; wherein determining a distance, or scalar product, between the first and the second lipid feature vectors may be used for determining effectiveness of the FXN replacement therapy. In an embodiment of the disclosure, a third lipid feature vector may be determined for the normal FXN lipid profile, the normal lipid profile being established for the FSLMs in a sample from a healthy subject. In an embodiment, the distance between the second (baseline FXN(?) lipid profile) and third (normal FXN lipid profile) FXN lipid feature vectors may be determined. In another embodiment, the distance between the first (FXN replacement lipid profile) and third (normal FXN lipid profile) FXN lipid feature vectors may be determined, and may be used for determining effectiveness of the FXN replacement therapy. In an embodiment, the distance between the first and third lipid feature vectors may be normalized to the distance between the second and third lipid feature vectors, and the resulting normalized distance may be used to determine effectiveness of the FXN replacement therapy. In an embodiment, the resulting normalized distance may be a value ranging from 0 (zero) to 1 (one), wherein the smaller the value (closest to zero) the more effective the therapy.
[0290] The biomarkers of the disclosure, such as one or more triglycerides (e.g., one or more of triglycerides (TGs), wherein the three acyl groups in each triglyceride molecule contain less than 56 carbons and/or wherein the three acyl groups in each triglyceride molecule contain 7 or less unsaturations; ether phospholipids (e.g., PCO- and PEO-), phosphatidylcholines (PCs), cholesteryl esters (CEs); and diglycerides (DGs), are correlated with FXN levels in a subject. Accordingly, in one aspect, the present disclosure provides methods for using, measuring, detecting, quantifying, and the like of one or more FSLMs, such as one or more of triglycerides (TGs), wherein the three acyl groups in each triglyceride molecule contain less than 56 carbons and/or wherein the three acyl groups in each triglyceride molecule contain 7 or less unsaturations; ether phospholipids (e.g., PCO- and PEO-), phosphatidylcholines (PCs), cholesteryl esters (CEs); and diglycerides (DGs), for determining and/or monitoring the FXN status in a subject or for determining, evaluating, and/or monitoring FXN replacement therapy in a subject.
[0291] In another aspect, the present disclosure relates to using, measuring, detecting, quantifying, and the like of one or more of the FSLMs, such as one or more of triglycerides (TGs), wherein the three acyl groups in each triglyceride molecule contain less than 56 carbons and/or wherein the three acyl groups in each triglyceride molecule contain 7 or less unsaturations; ether phospholipids (e.g., PCO- and PEO-), phosphatidylcholines (PCs), cholesteryl esters (CEs); and diglycerides (DGs) as a surrogate for measuring FXN expression levels.
[0292] In addition, in another embodiment, the FSLMs may be used in combination with one or more additional markers for a mitochondrial disease, e.g., FRDA. Other markers that may be used in combination with the one or more FSLMs, such as one or more of triglycerides (TGs), wherein the three acyl groups in each triglyceride molecule contain less than 56 carbons and/or wherein the three acyl groups in each triglyceride molecule contain 7 or less unsaturations; ether phospholipids (e.g., PCO- and PEO-), phosphatidylcholines (PCs), cholesteryl esters (CEs); and diglycerides (DGs), include any measurable characteristic described herein that reflects in a quantitative or qualitative manner the physiological state of an organism, e.g., whether the organism has a mitochondrial disease, e.g., FRDA. The physiological state of an organism is inclusive of any disease or non-disease state, e.g., a subject having a mitochondrial disease, e.g., FRDA, or a subject who is otherwise healthy. The FSLMs of the disclosure that may be used in combination with one or more additional markers include characteristics that can be objectively measured and evaluated as indicators of normal processes, pathogenic processes, or pharmacologic responses to a therapeutic intervention. Such combination markers can be clinical parameters (e.g., age, performance status), laboratory measures (e.g., molecular markers), or genetic or other molecular determinants. In other embodiments, the present disclosure also involves the analysis and consideration of any clinical and/or subject-related health data, for example, data obtained from an Electronic Medical Record (e.g., collection of electronic health information about individual subjects or populations relating to various types of data, such as, demographics, medical history, medication and allergies, immunization status, laboratory test results, radiology images, vital signs, personal statistics like age and weight, and billing information).
[0293] The present disclosure also contemplates the use of particular combinations of the FSLMs disclosed herein, e.g., one or more of triglycerides, wherein the three acyl group in each triglyceride molecule contain less than 56 carbons and/or wherein the three acyl groups in each triglyceride molecule contain 7 or less unsaturations, ether phospholipids, phosphatidylcholines (PCs), cholesteryl esters (CEs) and diglycerides (DGs) (e.g., TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2), in any combination. In one embodiment, the disclosure contemplates FSLM sets with at least two (2) members, which may include any two of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2). In another embodiment, the disclosure contemplates FSLM sets with at least three (3) members, which may include any three of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2. In another embodiment, the disclosure contemplates FSLM sets with at least four (4) members, which may include any four of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2. In another embodiment, the disclosure contemplates FSLM sets with at least five (5) members, which may include any five of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2. In another embodiment, the disclosure contemplates FSLM sets with at least six (6) members, which may include any six of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2. In another embodiment, the disclosure contemplates FSLM sets with at least seven (7) members, which may include any seven of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2. In another embodiment, the disclosure contemplates FSLM sets with at least eight (8) members, which may include any eight of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2. In another embodiment, the disclosure contemplates FSLM sets with at least nine (9) members, which may include any nine of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2. In another embodiment, the disclosure contemplates FSLM sets with at least ten (10) members, which may include any ten of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2. In another embodiment, the disclosure contemplates FSLM sets with at least eleven (11) members, which may include any eleven of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2. In another embodiment, the disclosure contemplates FSLM sets with at least twelve (12) members, which may include any twelve of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2.
[0294] In other embodiments, the disclosure contemplates an FSLM set comprising at least 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 70, 80, 90, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, or 138 of the FSLMs, such as TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2.
[0295] In certain embodiments, the level of one or more FSLMs is increased following treatment of a subject with an FXN replacement therapy, e.g., a subject deficient in FXN. In some embodiments, the one or more FSLMs is selected from the group consisting of cholesteryl esters, e.g., CE16:0 or CE20:5 and ether phospholipids, e.g., PCO-, PEO-, including phosphatidylcholine ethers, such as PC(O-17:0/20:4). In some embodiments, the one or more FSLMs include one or more of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE16:0 and CE20:5.
[0296] In certain embodiments, the level of one or more FSLMs is decreased following treatment of a subject with FXN replacement, e.g., a subject deficient in FXN. In some embodiments, the one or more FSLM is selected from the group consisting of triglycerides, wherein the three acyl groups in each triglyceride molecule contain less than 56 carbon atoms, e.g., TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7. In some embodiments, the FSLMs are selected from the group consisting of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, DG18:1/18:2 and CE14:1.
[0297] In another aspect, the present disclosure provides for the identification of a diagnostic lipid signature or diagnostic lipid profile based on the levels of the FSLMs of the disclosure in a biological sample, that correlates with FXN in the sample. The levels of the FSLMs can refer to the lipid level of an FSLM in a biological sample.
[0298] In certain embodiments, the diagnostic signature is obtained by (1) detecting the level of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more FSLMs, such as TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2, in a biological sample from a subject receiving FXN replacement therapy; (2) comparing the levels of the at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more FSLMs, to the levels of the same FSLMs from a control sample, such as a baseline FXN(?) lipid profile; and (3) determining if the at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more FSLMs detected in the biological sample are above or below the levels of the FSLMs in the control (e.g., baseline FXN(?) lipid profile). If the at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more FSLMs are above or below the control (e.g., baseline FXN(?) lipid profile), then the diagnostic signature is indicative of the effectiveness of FXN replacement therapy.
[0299] In accordance with various embodiments, algorithms may be employed to predict whether or not a biological sample from a subject comprises FXN, or to evaluate or monitor whether the subject has effectively received FXN replacement therapy. The skilled artisan will appreciate that an algorithm can be any computation, formula, statistical survey, nomogram, look-up Tables, decision tree method, or computer program which processes a set of input variables (e.g., number of markers (n) which have been detected at a level exceeding some threshold level, or number of markers (n) which have been detected at a level below some threshold level) through a number of well-defined successive steps to eventually produce a score or output. Any suitable algorithm-whether computer-based or manual-based (e.g., look-up Tables)is contemplated herein.
[0300] The disclosure provides for the use of various combinations and sub-combinations of FSLMs. For example, one or more of FSLMs, such as triglycerides, wherein the three acyl groups in each triglyceride molecule contain less than 56 carbons and/or wherein the three acyl groups in each triglyceride molecule contain 7 or less unsaturations (e.g., TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7), may be used alone or in combination with one or more of ether phospholipids (e.g., PCO- and PEO-), phosphatidylcholines (PCs), cholesteryl esters (CEs); and diglycerides (DGs), in any combination. It is understood that any single FSLM or combination of the FSLMs provided herein can be used in the disclosure unless clearly indicated otherwise.
Samples
[0301] The present disclosure may be practiced with any suitable biological sample that potentially contains, expresses, includes, a detectable FSLM. For example, the biological sample may be obtained from a solid tissue sample, such as a skin biopsy sample, muscle biopsy sample, preferably a buccal sample, or a body fluid sample such as blood (including any blood product, such as whole blood, plasma, serum, or specific types of cells of the blood), urine, saliva, or seminal fluid.
[0302] In some embodiments, a sample which may be used for measuring an FXN lipid profile in the context of the present disclosure may be selected from the group consisting of a buccal sample, a skin sample, a hair follicle and a muscle biopsy sample. In one embodiment, the sample is a buccal sample. In another embodiment, the sample is a skin sample.
[0303] In some embodiments, a sample which may be used for measuring an FXN lipid profile in the context of the present disclosure may be a blood sample or a blood-derived sample, e.g., a whole plasma sample, a serum sample or a platelet sample. In one embodiment, the sample is a plasma sample. In another embodiment, the sample is a platelet sample.
[0304] In some embodiments, a sample which may be used for measuring an FXN lipid profile may be obtained from an FXN deficient subject prior to administration of FXN replacement therapy, during administration of FXN replacement therapy or after administration of FXN replacement therapy. In some embodiments, a sample may be obtained from an FXN deficient subject at least 5 days following the last administration of the FXN replacement therapy. In some embodiments, a sample may be obtained from an FXN deficient subject at least 10 days following the last administration of the FXN replacement therapy. In some embodiments, a sample may be obtained from an FXN deficient subject at least 15 days following the last administration of the FXN replacement therapy. In some embodiments, a sample may be obtained from an FXN deficient subject 5-25 days, 10-40 days or 15 to 45 days following the last administration of the FXN replacement therapy, e.g., 5 to 15 days, 10 to 25 days, 15 to 20 days, 20 to 35 days or 25 to 45 days after the last administration of the FXN replacement therapy. In some embodiments, a sample may be obtained from an FXN deficient subject 20 to 25 days, e.g., 20, 21, 22, 23 or 25 days, after the last administration of the FXN replacement therapy. In some embodiments, a sample may be obtained from an FXN deficient subject at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49 or 50 days after the last administration of the FXN replacement therapy.
[0305] Any commercial device or system for isolating and/or obtaining tissue and/or blood or other biological products, and/or for processing said materials prior to conducting a detection reaction is contemplated.
Detection and/or Measurement of FSLMs
[0306] Various methodologies may be utilized for measuring the distance between lipid feature vectors. Once the data is normalized, the distance may be achieved for example by calculating the mean squared error, which may be extracted from the difference in the levels of each gene measured in two different profiles, such as baseline FXN(?) and FXN replacement for example. Alternatively, the distance may be achieved by calculating a correlation coefficient or applying a t-test.
[0307] The present disclosure contemplates any suitable means, techniques, and/or procedures for detecting and/or measuring the FSLMs of the disclosure. For example, levels of FSLMs in a sample may be measured using liquid chromatography-mass spectrometry (LC-MS), an analytical chemistry technique that combines the physical separation capabilities of liquid chromatography with the mass analysis capabilities of mass spectrometry. LC-MS is a powerful technique that has very high sensitivity, making it useful for the separation, general detection and potential identification of chemicals of particular masses in the presence of other chemicals (i.e., in complex mixtures). LC-MS includes targeted LC-MS and untargeted LC-MS. Targeted LC-MS can be performed when standards required for the quantification of the target analytes are available. Alternatively, surrogate analytes can be used to facilitate quantification of the target analytes if their standards are not commercially available. Examples of surrogate analytes include but are not limited to stable isotope-labeled standards of the target analytes, such as stable-isotope-labeled analogues of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG51:1, TG51:2, TG51:3, TG51:4, TG52:3, TG52:5, TG53:2, TG53:3, TG53:4, TG54:5, TG54:6, TG54:7 CE16:0, CE20:5, PC(O-16:0/18:2), PC(O-16:0/22:6), PC(O-18:0/18:2), PC(O-18:1/20:5), PCO-36:3, PCO-34:2, PCO-40:2, PCO-44:7 or PC(O-17:0/20:4.
[0308] Exemplary workflow that may be used to detect and measure levels of lipids in the context of the present disclosure are described, e.g., in Forest et al., J. of Proteome Research 2018, 17(11):3657-3670 and Wu et al., Advanced Drug Delivery Reviews 2020, 159:294-307, the entire contents of each of which are hereby incorporated herein by reference.
Frataxin Replacement Therapy
[0309] In some aspects, the methodology provided in the present disclosure refers to the determination of a lipid profile associated with FXN replacement therapy. FXN replacement therapy involves the administration of a therapeutic compound capable of increasing levels of FXN in a subject in need thereof, e.g., an FXN replacement therapeutic, to a subject in need thereof. A number of alternatives for delivery of exogenous FXN may be envisioned. The FXN replacement therapeutic may be provided by FXN protein delivery or through delivery of a nucleic acid capable of increasing FXN levels in a subject, e.g., a nucleic acid encoding FXN. FXN protein delivery may be delivery of full length FXN or delivery of a FXN fusion protein.
[0310] In some embodiments, the FXN replacement therapy comprises administration to a subject in need thereof a nucleic acid capable of increasing levels of FXN in the subject. In some embodiments, the nucleic acid may be a nucleic acid encoding FXN, e.g., FXN mRNA. In some embodiments, the nucleic acid may be an antisense oligonucleotide, e.g., an antisense oligonucleotide that activates expression of FXN protein as described, e.g., in Li et al., Nucleic Acid Ther. 2018, 28(1): 23-33 or in Mikaeili et al., Scientific Reports 2018, 8:17217, the entire contents of each of which are hereby incorporated herein by reference. In some embodiments, the nucleic acid may be siRNA capable of activating expression of FXN protein as described, e.g., in Shen et al., Bioorganic & Medicinal Chemistry Letters 2018, 28(17):2850-2855, the entire contents of which are hereby incorporated herein by reference.
[0311] In some embodiments, the FXN replacement therapy comprises administration of an FXN fusion protein. As used herein, the term FXN fusion protein refers to FXN or a fragment of FXN fused to a full length or a fragment of a different protein, or to a peptide. In some embodiments, an FXN fusion protein comprises a polypeptide that comprises FXN, e.g., full-length hFXN (SEQ ID NO: 1) or mature hFXN (SEQ ID NO: 2). The full-length hFXN protein (amino acids 1-210) has the amino acid sequence of SEQ ID NO: 1.
TABLE-US-00001 SEQIDNO:1 MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTD Full-length IDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSL hFXN DETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKL hFXN.sub.1-210 GGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGV SLHELLAAELTKALKTKLDLSSLAYSGKDA
[0312] In the mitochondrial matrix, the full-length hFXN protein it is cleaved at amino acid 81, resulting in the mature form of FXN, having 130 aa and a predicted molecular weight of 14.2 kDa (SEQ ID NO: 2).
TABLE-US-00002 SEQIDNO:2 SGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSF MaturehFXN GSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKN hFXN.sub.81-210 WVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
[0313] The full-length hFXN (SEQ ID NO: 1) comprises mature hFXN (SEQ ID NO: 2) and a mitochondrial targeting sequence (MTS) having the amino acid sequence
TABLE-US-00003 (SEQIDNO:3) MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDAT CTPRRASSNQRGLNQIWNVKKQSVYLMNLRK.
[0314] In some embodiments, the FXN fusion protein also comprises a cell penetrating peptide (CPP). The term cell penetrating peptide or CPP, as used herein, refers to a short peptide sequence, typically between 5 and 30 amino acids long, that can facilitate cellular intake of various molecular cargo, such as proteins. Within the context of the present disclosure, a CPP present in an FXN fusion protein facilitates the delivery of the FXN fusion protein into a cell, e.g., a recipient cell. CPPs may be polycationic, i.e., have an amino acid composition that either contains a high relative abundance of positively charged amino acids, such as lysine or arginine. CCPs may also be amphipathic, i.e., have sequences that contain an alternating pattern of polar/charged amino acids and non-polar, hydrophobic amino acids. CPPs may also be hydrophobic, i.e., contain only apolar residues with low net charge, or have hydrophobic amino acid groups that are crucial for cellular uptake.
[0315] A CPP that may be comprised in the FXN fusion protein may be any CPP known to a person skilled in the art. For example, the CPP may be any CPP listed in the Database of Cell-Penetrating Peptides CPPsite 2.0, the entire contents of which are hereby incorporated herein by reference. For examples, a CPP useful in the context of the present disclosure may be a cell penetrating peptide derived from a protein selected from the group consisting of HIV Trans-Activator of Transcription peptide (HIV-TAT), galanin, mastoparan, transportan, penetratin, polyarginine, VP22, transportan, amphipathic peptides such as MAP, KALA, ppTG20, proline-rich peptides, MPG-derived peptides, Pep-1, and also loligomers, arginine-rich peptides and calcitonin-derived peptides.
[0316] In some embodiments, a CPP of the present disclosure comprises a TAT protein domain comprising amino acids 47-57 of the 86 amino acid full length HIV-TAT protein (which 11 amino acid peptide may also be referred to herein as HIV-TAT; SEQ ID NO: 4). In one embodiment, the CPP consists of HIV-TAT (SEQ ID NO: 4). In some embodiments, the CPP comprises amino acids 47-57 of the 86 amino acid full length HIV-TAT protein with a methionine added at the amino terminus for initiation (12 AA; HIV-TAT+M): MYGRKKRRQRRR (SEQ ID NO: 5). Table 1 below lists amino acid sequences of exemplary CPPs.
TABLE-US-00004 TABLE1 ExemplaryCPPsandcorrespondingsequences SEQIDNO. CPP AminoAcidSequence 4 HIV-TAT YGRKKRRQRRR 5 HIV-TAT+M MYGRKKRRQRRR 6 Galanin GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS 7 Mastoparan INLKALAALAKKIL-NH.sub.2 8 Transportan GWTLNSAGYLLGKINLKALAALAKKIL 9 Penetratin RQIKIWFQNRRMKWKK 10 Polyarginine RRRRRRRRR 11 VP22 DAATATRGRSAASRPTERPRAPARSASRPRRPVE
[0317] In some embodiments, the CPP comprised in the FXN fusion protein is HIV-TAT (SEQ ID NO: 4). In some embodiments, the CPP comprised in the FXN fusion protein is HIV-TAT+M (SEQ ID NO: 5). In some embodiments, the FXN fusion protein comprises full-length FXN, e.g., SEQ ID NO: 1, and HIV-TAT, e.g., SEQ ID NO: 4, as CPP. In some embodiments, the FXN fusion protein comprises full-length FXN, e.g., SEQ ID NO: 1, and HIV-TAT+M, e.g., SEQ ID NO: 5, as CPP.
[0318] In some embodiments, in a FXN fusion protein of the present disclosure, the CPP may be fused together with the FXN, e.g., full-length FXN, via a linker to form a single polypeptide chain. Examples of FXN fusion proteins include TAT-FXN fusion proteins, where TAT or a fragment of TAT may be directly or indirectly (through a linker) linked to either the N- or the C-terminus of FXN. In one specific example, the linker may comprise the amino acid sequence GG.
[0319] In some aspects, the CPP, e.g., HIV-TAT, that is present in an FXN fusion protein of the present disclosure facilitates delivery of the FXN fusion protein into a cell, e.g., a cell that may be present in vitro, ex vivo, or in a subject. Once inside the cell, the FXN fusion protein may be processed by cellular machinery to remove the CPP, e.g., HIV-TAT, from the FXN.
[0320] One specific example of a TAT-FXN fusion protein is referred to as an exemplary FXN fusion protein. The exemplary FXN fusion protein is a 24.9 kDa fusion protein currently under investigation as an FXN replacement therapy to restore functional levels of FXN in the mitochondria of subjects with FRDA. The exemplary FXN fusion protein includes the HIV-TAT peptide linked to the N-terminus of the full-length hFXN protein. The mechanism of action of the exemplary FXN fusion protein relies on the cell-penetrating ability of the HIV-TAT peptide to deliver the exemplary FXN fusion protein into cells and the subsequent processing into mature hFXN after translocation into the mitochondria. The exemplary FXN fusion protein is described, e.g., in US 2021/0047378, the entire contents of which are hereby incorporated herein by reference. The exemplary FXN fusion protein comprises the following amino acid sequence (224 amino acids):
TABLE-US-00005 (SEQIDNO:12) MYGRKKRRQRRRGGMWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAP LCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTL GHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLT VKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSL HELLAAELTKALKTKLDLSSLAYSGKDA.
[0321] FXN replacement may also be delivered by viral gene replacement, which may utilize retroviral, lentiviral, and adeno-associated viral vectors, as well as adenoviruses. Alternatively, FXN replacement therapy may be achieved by upregulation of endogenous mutant FXN gene, which depending on the number of GAA repeats is expressed in varying levels in carriers of the mutant FXN allele.
FSLM Applications
Methods for Evaluating Efficacy of a FXN Replacement Therapy
[0322] In some aspects, the present disclosure provides methods for evaluating and/or monitoring efficacy of FXN replacement therapy in a subject. The disclosure further provides methods for determining whether a subject is in need of FXN replacement therapy or a change in FXN replacement therapy, e.g., determining whether FXN replacement therapy should be initiated, increased, decreased or ceased in a subject. In some embodiments, the methods are carried out by the subject using a sample obtained from the same subject or as a point of care test, and results can be assessed by the subject or by a physician.
[0323] In some embodiments, the present disclosure provides methods for evaluating efficacy of a frataxin replacement therapy, the method comprising: (a) determining a baseline FSLM(?) lipid profile for one or more FXN-sensitive lipid markers (FSLMs) in a sample obtained from an FXN deficient subject prior to administration of the FXN replacement therapy; (b) determining an FXN replacement lipid profile for the one or more FXN-sensitive lipid markers (FSLMs) in a sample obtained from the FXN deficient subject following administration of the FXN replacement therapy; (c) comparing the FXN replacement lipid profile determined in step (b) with the baseline FXN(?) lipid profile determined in step (a); and (d) determining efficacy of the FXN replacement therapy based on the comparison in step (c).
[0324] In some embodiments, comparing the FXN replacement lipid profile with the baseline FXN(?) lipid profile comprises comparing the amount of one or more FSLMs in the FXN replacement lipid profile with the amount of lipid of the corresponding one or more FSLMs in the baseline FXN(?) lipid profile.
[0325] In some embodiments, the present disclosure also provides a method for evaluating efficacy of a frataxin (FXN) replacement therapy, the method comprising: (a) determining an FXN replacement lipid profile for one or more FXN-sensitive lipid markers (FSLMs) in a sample obtained from an FXN deficient subject following administration of an FXN replacement therapy; (b) comparing the subject FXN replacement lipid profile determined in step (a) with a reference FXN lipid profile for the one or more FSLMs; and (c) determining efficacy of the FXN replacement therapy based on the comparison in step (b). In some embodiments, the reference FXN lipid profile is a baseline FXN(?) lipid profile for the one or more FSLMs. In some embodiments, the baseline FXN(?) lipid profile for the one or more FSLMs is determined in a sample obtained from an FXN deficient subject prior to administration of an FXN replacement therapy.
[0326] In some embodiments, comparing the FXN replacement lipid profile with the reference FXN lipid profile comprises comparing the amount of one or more FSLMs in the FXN replacement lipid profile with the amount of lipid of the corresponding one or more FSLMs in the reference FXN lipid profile.
[0327] In some embodiments, the one or more FSLMs comprise one or any combination of one or more TGs, ether phospholipids (e.g., PCO- or PEO-), PCs, DGs or CEs as described herein. For example, the one or more FSLMs may comprise one or more TGs, wherein the three acyl groups in each TG molecule contain less than 56 carbon atoms, e.g., one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7
[0328] In certain embodiments, a decrease in the amount of one or more TGs, wherein the three acyl groups in each TG molecule contain less than 56 carbon atoms (e.g., TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7), in a FXN replacement lipid profile, as compared to a reference FXN lipid profile, e.g., a baseline FXN(?) lipid profile, is an indication that the FXN replacement therapy is effective.
[0329] In certain embodiments, a decrease in the amount of one or more TGs, wherein the three acyl groups in each TG molecule contain less than 56 carbon atoms (e.g., TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7) in a sample obtained from an FXN-deficient subject following administration of FXN replacement therapy, as compared to the amount of the one or more FSLMs in a reference sample, e.g., a sample obtained from the FXN-deficient subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0330] In certain embodiments, a decrease in the amount of one or more TGs, wherein the three acyl groups in each TG molecule contain 7 or less unsaturations (e.g., TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7), in a FXN replacement lipid profile, as compared to a reference FXN lipid profile, e.g., a baseline FXN(?) lipid profile, is an indication that the FXN replacement therapy is effective.
[0331] In certain embodiments, a decrease in the amount of TGs, wherein the three acyl groups in each TG molecule contain 7 or less unsaturations (e.g., TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7) in a sample obtained from an FXN-deficient subject following administration of FXN replacement therapy, as compared to the amount of the one or more FSLMs in a reference sample, e.g., a sample obtained from the FXN-deficient subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0332] Specifically, in some embodiments, a decrease in the amount of TG45:1 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG45:1 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0333] Specifically, in some embodiments, a decrease in the amount of TG46:1 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG46:1 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0334] Specifically, in some embodiments, a decrease in the amount of TG46:3 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG46:3 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0335] Specifically, in some embodiments, a decrease in the amount of TG47:1 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG47:1 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0336] Specifically, in some embodiments, a decrease in the amount of TG47:2 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG47:2 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0337] Specifically, in some embodiments, a decrease in the amount of TG48:0 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG48:0 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0338] Specifically, in some embodiments, a decrease in the amount of TG48:1 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG48:1 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0339] Specifically, in some embodiments, a decrease in the amount of TG48:2 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG48:2 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0340] Specifically, in some embodiments, a decrease in the amount of TG48:3 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG48:3 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0341] Specifically, in some embodiments, a decrease in the amount of TG49:1 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG49:1 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0342] Specifically, in some embodiments, a decrease in the amount of TG49:2 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG49:2 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0343] Specifically, in some embodiments, a decrease in the amount of TG49:3 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG49:3 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0344] Specifically, in some embodiments, a decrease in the amount of TG49:4 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG49:4 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0345] Specifically, in some embodiments, a decrease in the amount of TG50:1 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG50:1 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0346] Specifically, in some embodiments, a decrease in the amount of TG50:2 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG50:2 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0347] Specifically, in some embodiments, a decrease in the amount of TG50:3 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG50:3 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0348] Specifically, in some embodiments, a decrease in the amount of TG50:4 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG50:4 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0349] Specifically, in some embodiments, a decrease in the amount of TG50:5 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG50:5 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0350] Specifically, in some embodiments, a decrease in the amount of TG51:1 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG51:1 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0351] Specifically, in some embodiments, a decrease in the amount of TG51:2 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG51:2 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0352] Specifically, in some embodiments, a decrease in the amount of TG51:3 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG51:3 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0353] Specifically, in some embodiments, a decrease in the amount of TG51:4 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG51:4 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0354] Specifically, in some embodiments, a decrease in the amount of TG52:2 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG52:2 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0355] Specifically, in some embodiments, a decrease in the amount of TG52:3 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG52:3 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0356] Specifically, in some embodiments, a decrease in the amount of TG52:4 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG52:4 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0357] Specifically, in some embodiments, a decrease in the amount of TG52:5 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG52:5 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0358] Specifically, in some embodiments, a decrease in the amount of TG52:6 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG52:6 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0359] Specifically, in some embodiments, a decrease in the amount of TG53:2 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG53:2 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0360] Specifically, in some embodiments, a decrease in the amount of TG53:3 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG53:3 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0361] Specifically, in some embodiments, a decrease in the amount of TG53:4 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG53:4 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0362] Specifically, in some embodiments, a decrease in the amount of TG53:5 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG53:5 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0363] Specifically, in some embodiments, a decrease in the amount of TG54:4 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG54:4 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0364] Specifically, in some embodiments, a decrease in the amount of TG54:5 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG54:5 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0365] Specifically, in some embodiments, a decrease in the amount of TG54:6 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG54:6 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0366] Specifically, in some embodiments, a decrease in the amount of TG54:7 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of TG54:7 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0367] In certain embodiments, an increase in the amount of one or more PCO-, e.g., one or more of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7 and PCO-46.8, in a FXN replacement lipid profile, as compared to a reference FXN lipid profile, e.g., a baseline FXN(?) lipid profile, is an indication that the FXN replacement therapy is effective.
[0368] In certain embodiments, an increase in the amount of one or more PCO-, e.g., one or more of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7 and PCO-46.8, in a sample obtained from an FXN-deficient subject following administration of FXN replacement therapy, as compared to the amount of the one or more FSLMs in a reference sample, e.g., a sample obtained from the FXN-deficient subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0369] In some embodiments, an increase in the amount of PC(O-16:0/14:0) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-16:0/14:0) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0370] In some embodiments, an increase in the amount of PC(O-16:0/18:2) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-16:0/18:2) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0371] In some embodiments, an increase in the amount of PC(O-16:0/20:3) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-16:0/20:3) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0372] In some embodiments, an increase in the amount of PC(O-16:0/20:4) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-16:0/20:4) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0373] In some embodiments, an increase in the amount of PC(O-16:0/22:6) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-16:0/22:6) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0374] In some embodiments, an increase in the amount of PC(O-17:0/20:4) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-17:0/20:4) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0375] In some embodiments, an increase in the amount of PC(O-18:0/18:1) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-18:0/18:2) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0376] In some embodiments, an increase in the amount of PC(O-18:0/18:2) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-18:0/18:2) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0377] In some embodiments, an increase in the amount of PC(O-18:0/22:6) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-18:0/22:6) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0378] In some embodiments, an increase in the amount of PC(O-18:1/18:2) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-18:1/18:2) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0379] In some embodiments, an increase in the amount of PC(O-18:1/20:4) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-18:1/20:4) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0380] In some embodiments, an increase in the amount of PC(O-18:1/20:5) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-18:1/20:5) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0381] In some embodiments, an increase in the amount of PC(O-18:1/22:6) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-18:1/22:6) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0382] In some embodiments, an increase in the amount of PC(O-(20:0/22:6) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-(20:0/22:6) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0383] In some embodiments, an increase in the amount of PC(O-20:1/22.6) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-20:1/22.6) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0384] In some embodiments, an increase in the amount of PC(O-20:2/20:4) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-20:2/20:4) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0385] In some embodiments, an increase in the amount of PC(O-22:2/20:4) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-22:2/20:4) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0386] In some embodiments, an increase in the amount of PC(O-22:1/22:6) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-22:1/22:6) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0387] In some embodiments, an increase in the amount of PC(O-22:2/20:4) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-22:2/20:4) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0388] In some embodiments, an increase in the amount of PC(O-(24:1/22:6) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-(24:1/22:6) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0389] In some embodiments, an increase in the amount of PC(O-24:2/20:4) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(O-24:2/20:4) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0390] In some embodiments, an increase in the amount of PCO-34:2 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PCO-34:2 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0391] In some embodiments, an increase in the amount of PCO-36:3 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PCO-36:3 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0392] In some embodiments, an increase in the amount of PCO-34:2 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PCO-34:2 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0393] In some embodiments, an increase in the amount of PCO-38:3 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PCO-38:3 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0394] In some embodiments, an increase in the amount of PCO-40:2 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PCO-40:2 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0395] In some embodiments, an increase in the amount of PCO-40:6 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PCO-40:6 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0396] In some embodiments, an increase in the amount of PCO-44:7 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PCO-44:7 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
amountamount
[0397] In some embodiments, an increase in the amount of PCO-46:8 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PCO-46.8 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0398] In certain embodiments, a decrease in the amount of one or more PCs selected from the group consisting of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, in a FXN replacement lipid profile, as compared to a reference FXN lipid profile, e.g., a baseline FXN(?) lipid profile, is an indication that the FXN replacement therapy is effective.
[0399] In certain embodiments, a decrease in the amount of one or more PCs selected from the group consisting of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, in a sample obtained from an FXN-deficient subject following administration of FXN replacement therapy, as compared to the amount of the one or more FSLMs in a reference sample, e.g., a sample obtained from the FXN-deficient subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0400] In some embodiments, a decrease in the amount of PC(15:0/20:3) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(15:0/20:3) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0401] In some embodiments, a decrease in the amount of PC(15:0/22:6) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(15:0/22:6) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0402] In some embodiments, a decrease in the amount of PC(16:0/14:0) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(16:0/14:0) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0403] In some embodiments, a decrease in the amount of PC(16:0/22:4) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(16:0/22:4) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0404] In some embodiments, a decrease in the amount of PC(16:1/16:0) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(16:1/16:0) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0405] In some embodiments, a decrease in the amount of PC(16:1/20:4) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(16:1/20:4) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0406] In some embodiments, a decrease in the amount of PC(16:1/22.5) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(16:1/22.5) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0407] In some embodiments, a decrease in the amount of PC(17:0/20:5) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(17:0/20:5) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0408] In some embodiments, a decrease in the amount of PC(18:0/20:3) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(18:0/20:3) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0409] In some embodiments, a decrease in the amount of PC(18:0/22:4) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(18:0/22:4) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0410] In some embodiments, a decrease in the amount of PC(18:1/20:3) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(18:1/20:3) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0411] In some embodiments, a decrease in the amount of PC(18:2/18:2) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(18:2/18:2) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0412] In some embodiments, a decrease in the amount of PC(20:4/15:0) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(20:4/15:0) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0413] In some embodiments, a decrease in the amount of PC40:6 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC40:6 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0414] In some embodiments, a decrease in the amount of PC42:7 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC42:7 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0415] In certain embodiments, an increase in the amount of one or more PCs selected from the group consisting of PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0), in a FXN replacement lipid profile, as compared to a reference FXN lipid profile, e.g., a baseline FXN(?) lipid profile, is an indication that the FXN replacement therapy is effective.
[0416] In certain embodiments, an increase in the amount of one or more PCs selected from the group consisting of PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0), in a sample obtained from an FXN-deficient subject following administration of FXN replacement therapy, as compared to the amount of the one or more FSLMs in a reference sample, e.g., a sample obtained from the FXN-deficient subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0417] In some embodiments, an increase in the amount of PC(17:1/20:4) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(17:1/20:4) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0418] In some embodiments, an increase in the amount of PC(18:2/18:3) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(18:2/18:3) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0419] In some embodiments, an increase in the amount of PC(18:1/24:1) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(18:1/24:1) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0420] In some embodiments, an increase in the amount of PC(18:2/20:5) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(18:2/20:5) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0421] In some embodiments, an increase in the amount of PC(20:4/20:0) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of PC(20:4/20:0) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0422] In some embodiments, a decrease in the amount of DG(18:1/18:2) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of DG(18:1/18:2) in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0423] In some embodiments, a decrease in the amount of CE14:1 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of CE14:1 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0424] In some embodiments, an increase in the amount of CE16:0 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of CE16:0 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0425] In some embodiments, an increase in the amount of CE20:5 in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of CE20:5 in a sample obtained from the subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is effective.
[0426] In certain embodiments of the methods provided herein, lack of an increase or decrease in the amount of one or more FSLMs, e.g., one or any combination of one or more TGs, ether phospholipids (e.g., PCO- or PEO-), PCs, DGs or CEs as described herein, in a sample obtained from an FXN-deficient subject following administration of an FXN replacement therapy, as compared to the amount of the one or more FSLMs in a control sample, e.g., a sample from the FXN-deficient subject prior to administration of the FXN replacement therapy, is an indication that the FXN replacement therapy is ineffective, e.g., at the current dose, and should be modified. For example, the FXN replacement therapy may be modified by increasing the dose and/or administration frequency of the FXN replacement therapy.
[0427] In certain embodiments, the methods provided herein may also include monitoring a subject being administered FXN replacement therapy. In some embodiments, lack of an increase or decrease in the detected amount of one or more FSLMs, e.g., one or any combination of one or more TGs, ether phospholipids (e.g., PCO- or PEO-), PCs, DGs or CEs as described herein, in a second sample obtained from a subject after administration of FXN replacement therapy, as compared to the amount of the one or more FSLMs in a first sample obtained from the subject before administration of FXN replacement therapy, is an indication that the FXN replacement therapy is not efficacious and/or the subject is not responsive FXN replacement therapy. The method may further include the step of adjusting the FXN replacement therapy, e.g., by increasing the dose and/or administration frequency of the FXN replacement therapy.
[0428] In other embodiments, an increased or decreased lipid amount of one or more FSLMs, e.g., one or any combination of one or more TGs, ether phospholipids (e.g., PCO- or PEO-), PCs, DGs or CEs as described herein, in a second sample obtained from a subject after administration of FXN replacement therapy, as compared to the amount of the one or more FSLMs in a first sample obtained from the subject before administration of FXN replacement therapy, is an indication that the FXN replacement therapy is efficacious and/or the subject is responsive to the FXN replacement therapy. The method may further include the step of adjusting the FXN replacement therapy, e.g., by decreasing the dose and/or administration frequency of the FXN replacement therapy, or ceasing the therapy.
amount
[0429] In certain embodiments, the amount of one or more TGs, wherein the three acyl groups in each TG molecule contain less than 56 carbon atoms, or contain 7 or less unsaturations, is decreased in an FXN deficient subject following treatment with an FXN replacement. In some embodiments, the one or more TGs are selected from the group consisting of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7.
[0430] In some embodiments, the amount of TG45:1 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG46:1 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG46:3 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG47:1 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG47:2 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG48:0 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG48:1 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG48:2 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG48:3 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG49:1 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG49:2 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG49:3 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG49:4 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG50:1 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG50:2 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG50:3 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG50:4 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG50:5 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG51:1 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG51:2 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG51:3 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG51:4 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG52:2 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG52:3 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG52:4 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG52:5 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG52:6 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG53:2 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG53:3 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG53:4 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG53:5 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG54:4 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG54:5 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG54:6 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of TG54:7 is decreased following treatment of an FXN deficient subject with FXN replacement therapy.
[0431] In certain embodiments, the amount of one or more PCO- is increased in an FXN deficient subject following treatment with an FXN replacement therapy. In some embodiments, the one or more PCO- are selected from the group consisting of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, and PCO-44:7 and PCO-46.8.
[0432] In some embodiments, the amount of PC(O-16:0/14:0) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(O-16:0/18:2) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(O-16:0/20:3) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(O-16:0/20:4) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(O-16:0/22:6) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(O-17:0/20:4) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(O-18:0/18:1) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(O-18:0/22:6) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(O-18:0/18:2) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(O-18:1/18:2) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(O-18:1/20:4) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(O-18:1/20:5) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(O-18:1/22:6) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(O-(20:0/22:6) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(O-20:1/22.6) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(O-20:2/20:4) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(O-22:2/20:4) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(O-22:1/22:6) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(O-22:2/20:4) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(O-(24:1/22:6) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PCO-34:2 is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PCO-36:3 is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PCO-34:2 is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PCO-38:3 is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PCO-40:2 is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PCO-40:6 is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PCO-44:7 is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PCO-46.8 is increased following treatment of an FXN deficient subject with FXN replacement therapy.
[0433] In certain embodiments, the amount of one or more PCs selected from the group consisting of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7 is decreased in an FXN deficient subject following treatment with an FXN replacement.
[0434] In some embodiments, the amount of PC(15:0/20:3) is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(15:0/22:6) is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(16:0/14:0) is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(16:0/22:4) is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(16:1/16:0) is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(16:1/20:4) is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(16:1/22.5) is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(17:0/20:5) is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(18:0/20:3) is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(18:0/22:4) is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(18:1/20:3) is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(18:2/18:2) is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(20:4/15:0) is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC40:6 is decreased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC42:7 is decreased following treatment of an FXN deficient subject with FXN replacement therapy.
[0435] In certain embodiments, the amount of one or more PCs selected from the group consisting of PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0) is increased in an FXN deficient subject following treatment with an FXN replacement.
[0436] In some embodiments, the amount of PC(17:1/20:4) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(18:2/18:3) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(18:1/24:1) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(18:2/20:5) is increased following treatment of an FXN deficient subject with FXN replacement therapy. In some embodiments, the amount of PC(20:4/20:0) is increased following treatment of an FXN deficient subject with FXN replacement therapy.
[0437] In some embodiments, the amount of DG(18:1/18:2) is decreased following treatment of an FXN deficient subject with FXN replacement therapy.
[0438] In some embodiments, the amount of CE14:1 is decreased following treatment of an FXN deficient subject with FXN replacement therapy.
[0439] In some embodiments, the amount of CE16:0 is increased following treatment of an FXN deficient subject with FXN replacement therapy.
[0440] In some embodiments, the amount of CE20:5 is increased following treatment of an FXN deficient subject with FXN replacement therapy.
Methods for Monitoring Treatment with FXN Replacement Therapy
[0441] In some aspects, the present disclosure also provides a method of monitoring treatment of a subject with a frataxin (FXN) replacement therapy, the method comprising: (a) determining a first FXN replacement lipid profile for one or more FXN-sensitive lipid markers (FSLMs) in a first sample obtained from an FXN deficient subject at a first time point following administration of an FXN replacement therapy to the subject, (b) determining a second FXN replacement lipid profile for the one or more FXN-sensitive lipid markers (FSLMs) in a second sample obtained from the subject at a second time point that is later than the first time point; and (c) comparing the second FXN replacement lipid profile with the first FXN replacement lipid profile; thereby monitoring treatment of the subject with the FXN replacement therapy.
[0442] In some embodiments, comparing the second FXN replacement lipid profile with the first FXN replacement lipid profile comprises comparing the amount of one or more FSLMs in the second FXN replacement lipid profile with the amount of the corresponding one or more FSLMs in the first FXN replacement lipid profile.
[0443] In some embodiments, the one or more FSLMs comprise one or any combination of one or more TGs, ether phospholipids (e.g., PCO- or PEO-), PCs, DGs or CEs as described herein. For example, the one or more FSLMs may comprise one or more TGs, wherein the three acyl groups in each TG molecule contain less than 56 carbon atoms, e.g., one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7
[0444] In certain embodiments, a decrease in the amount of one or more of TGs, wherein the three acyl groups in each TG molecule contain less than 56 carbon atoms (e.g., TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7), in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the FXN replacement therapy is effective.
[0445] In certain embodiments, a decrease in the amount of one or more TGs, wherein the three acyl groups in each TG molecule contain 7 or less unsaturations (e.g., TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7), in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the FXN replacement therapy is effective. In certain embodiments, lack of a decrease in the amount of one or more TGs, wherein the three acyl groups in each TG molecule contain 7 or less unsaturations (e.g., TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7), in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the FXN replacement therapy is not effective.
[0446] In certain embodiments, an increase in the amount of one or more PCO-, e.g., one or more of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7 and PCO-46.8, in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the FXN replacement therapy is effective. In certain embodiments, lack an increase in the amount of one or more PCO-, e.g., one or more of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7 and PCO-46.8, in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the FXN replacement therapy is not effective.
[0447] In certain embodiments, a decrease in the amount of one or more PCs selected from the group consisting of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the FXN replacement therapy is effective. In certain embodiments, lack of a decrease in the amount of one or more PCs selected from the group consisting of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the FXN replacement therapy is not effective.
[0448] In certain embodiments, an increase in the amount of one or more PCs selected from the group consisting of PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0), in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the FXN replacement therapy is effective. In certain embodiments, lack of an increase in the amount of one or more PCs selected from the group consisting of PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0), in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the FXN replacement therapy is not effective.
[0449] In some embodiments, a decrease in the amount of DG(18:1/18:2) in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the FXN replacement therapy is effective. In some embodiments, lack of a decrease in the amount of DG(18:1/18:2) in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the FXN replacement therapy is not effective.
[0450] In some embodiments, a decrease in the amount of CE14:1 in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the FXN replacement therapy is effective. In some embodiments, lack of a decrease in the amount of CE14:1 in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the FXN replacement therapy is not effective.
[0451] In some embodiments, an increase in the amount of CE16:0 in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the FXN replacement therapy is effective. In some embodiments, lack of an increase in the amount of CE16:0 in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the FXN replacement therapy is not effective.
[0452] In some embodiments, an increase in the amount of CE20:5 in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the FXN replacement therapy is effective. In some embodiments, lack of an increase in the amount of CE20:5 in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the FXN replacement therapy is not effective.
[0453] In some embodiments, the method for monitoring treatment with FXN replacement therapy further comprises making a determination, or making a recommendation to a healthcare provider, to maintain the FXN replacement therapy regimen based on the comparison in step (c). In some embodiments, the method further comprises making a determination, or making a recommendation to a healthcare provider, to alter the FXN replacement therapy regimen based on the comparison in step (c). In some embodiments, the method further comprises making a determination to maintain the dose and/or administration frequency, increase the dose and/or administration frequency, or decrease the dose and/or administration frequency of the FXN replacement therapy based on the comparison in step (c). In some embodiments, the method further comprises making a recommendation, e.g., to a healthcare provider, to maintain the dose and/or administration frequency, increase the dose and/or administration frequency, or decrease the dose and/or administration frequency of the FXN replacement therapy based on the comparison in step (c).
[0454] For example, in some embodiments, the method comprises continuing to administer the FXN replacement therapy regimen (e.g., without changing the regimen, e.g., maintaining the dose and/or administration frequency) to the subject based on the comparison in step (c). In some embodiments, the method further comprises altering the FXN replacement therapy regimen based on the comparison in step (c). In some embodiments, the method further comprises administering an altered FXN replacement therapy regimen based on the comparison in step (c). In some embodiments, administering an altered FXN replacement therapy regimen comprises administering an increased dose and/or administration frequency, or administering a decreased dose and/or administration frequency of the FXN replacement therapy.
[0455] For example, the method for monitoring treatment of a subject with FXN replacement therapy may further comprise the step of continuing administering the FXN replacement therapy to the subject without adjustments, or decreasing the dose and/or administration frequency of the FXN replacement therapy if the FXN replacement therapy is determined to be effective. In other embodiments, the method for monitoring treatment of a subject with FXN replacement therapy may further comprise a step of adjusting FXN replacement therapy by increasing the dose and/or administration frequency of the FXN replacement therapy if the FXN replacement therapy is determined to be not effective.
[0456] It will be appreciated that following administration of FXN replacement therapy to an FXN deficient subject, the level of FXN achieved in the subject may reach a desired or target level of FXN, e.g., similar to levels of FXN present in a normal, healthy subject, or similar to levels of FXN present in hFXN heterozygotes. In such instances, it is beneficial for the dose and/or frequency of administration of the FXN replacement therapy to then be maintained. Further, when such a desired level of FXN in the subject is achieved and maintained constant over time, it is beneficial for the dose and/or frequency of administration of the FXN replacement therapy to be maintained. It will be further appreciated that following administration of FXN replacement therapy to an FXN deficient subject, the level of FXN achieved in the subject may be higher than the desired or target level of FXN, e.g., higher than the level of FXN present in a normal, healthy subject, or higher than the level of FXN present in hFXN heterozygotes. In such instances, it is beneficial for the dose and/or frequency of administration of the FXN replacement therapy to be decreased. Alternatively, the level of FXN achieved in the subject may be lower than the desired or target level of FXN, e.g., lower than the level of FXN present in a normal, healthy subject, or lower than the level of FXN present in hFXN heterozygotes. In such instances, it is beneficial for the dose and/or frequency of administration of the FXN replacement therapy to be increased.
[0457] Accordingly, a decrease in the amount of one or more TGs, wherein the three acyl groups in each TG molecule contain 7 or less unsaturations (e.g., TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7), in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the dose and/or administration schedule of the FXN replacement therapy should be maintained or decreased.
[0458] In some embodiments, lack of a decrease in the amount of one or more TGs, wherein the three acyl groups in each TG molecule contain 7 or less unsaturations (e.g., TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7), in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the dose and/or administration schedule of the FXN replacement therapy should be maintained or increased.
[0459] In certain embodiments, an increase in the amount of one or more PCO-, e.g., one or more of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7 and PCO-46.8, is an indication that the dose and/or administration schedule of the FXN replacement therapy should be maintained or decreased.
[0460] In certain embodiments, lack of an increase in the amount of one or more PCO-, e.g., one or more of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7 and PCO-46.8, is an indication that the dose and/or administration schedule of the FXN replacement therapy should be maintained or increased.
[0461] In certain embodiments, a decrease in the amount of one or more PCs selected from the group consisting of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, is an indication that the dose and/or administration schedule of the FXN replacement therapy should be maintained or decreased.
[0462] In certain embodiments, lack a decrease in the amount of one or more PCs selected from the group consisting of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, is an indication that the dose and/or administration schedule of the FXN replacement therapy should be maintained or increased.
[0463] In certain embodiments, an increase in the amount of one or more PCs selected from the group consisting of PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0), in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the dose and/or administration schedule of the FXN replacement therapy should be maintained or decreased.
[0464] In certain embodiments, lack of an increase in the amount of one or more PCs selected from the group consisting of PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0), in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the dose and/or administration schedule of the FXN replacement therapy should be maintained or increased.
[0465] In some embodiments, a decrease in the amount of DG(18:1/18:2) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of DG(18:1/18:2) in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the dose and/or administration schedule of the FXN replacement therapy should be maintained or decreased.
[0466] In some embodiments, lack of a decrease in the amount of DG(18:1/18:2) in a sample obtained from an FXN deficient subject following administration of FXN replacement therapy, as compared to the amount of DG(18:1/18:2) in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the dose and/or administration schedule of the FXN replacement therapy should be maintained or increased.
[0467] In some embodiments, a decrease in the amount of CE14:1 in a sample in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the dose and/or administration schedule of the FXN replacement therapy should be maintained or decreased.
[0468] In some embodiments, lack of a decrease in the amount of CE14:1 in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the dose and/or administration schedule of the FXN replacement therapy should be maintained or increased.
[0469] In some embodiments, an increase in the amount of CE16:0 in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the dose and/or administration schedule of the FXN replacement therapy should be maintained or decreased.
[0470] In some embodiments, lack of an increase in the amount of CE16:0 in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the dose and/or administration schedule of the FXN replacement therapy should be maintained or increased.
[0471] In some embodiments, an increase in the amount of CE20:5 in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the dose and/or administration schedule of the FXN replacement therapy should be maintained or decreased.
[0472] In some embodiments, lack of an increase in the amount of CE20:5 in the second FXN replacement lipid profile, as compared to the first FXN replacement lipid profile, is an indication that the dose and/or administration schedule of the FXN replacement therapy should be maintained or increased.
[0473] Methods of the present disclosure for evaluating efficacy of a frataxin replacement therapy or for detecting and/or measuring one or more FSLM of the present disclosure, e.g., TGs, ether phospholipids (e.g., PCO- or PEO-), PCs, DGs or CEs as described herein, involve detection and/or quantification of one or more FSLMs using mass spectrometry (MS). During analysis using MS, an FSLM may be ionized and thereby converted into an ionized FSLM (e.g., a positively charged ionized FSLM or a negatively charged ionized FSLM). Ionization of FSLM makes it possible to detect the ionized FSLM by MS by identifying its corresponding m/z value. In some embodiments, one or more FSLMs may be detected and/or quantified using tandem mass spectrometry (MS/MS). During analysis using MS/MS, an FSLM may be ionized and subsequently fragmented in a mass spectrometer, thereby forming an ionized FSLM fragment (e.g., a positively charged ionized FSLM fragment or a negatively charged ionized FSLM fragment). Ionization and fragmentation of FSLM makes it possible to detect and identify the ionized FSLM by MS/MS by identifying m/z of FSLM fragments. Thus, the method of the disclosure transforms the FSLMs of the disclosure, e.g., TGs, ether phospholipids (e.g., PCO- or PEO-), PCs, DGs or CEs, to an ionized FSLM or an ionized FSLM fragment. Forming an ionized FSLM or an ionized FSLM fragment is required in order to identify, detect and/or quantify the presence of the FSLM of interest and necessarily changes the physical characteristics and properties of the FSLM of interest as a result of conducting the methods of the disclosure.
[0474] An exemplary method for detecting the presence or absence of a lipid, or determining an amount of a lipid, e.g., FSLM, in a biological sample involves obtaining a biological sample from a subject and subjecting the biological sample to liquid chromatography and mass spectrometry (LC/MS). It is understood that the methods provided herein for detecting a lipid or determining an amount of a lipid in a biological sample includes the steps to perform the assay.
[0475] In certain embodiments, all FSLMs are detected using the same method. In certain embodiments, all FSLMs are detected using the same biological sample (e.g., same body fluid or tissue). In certain embodiments, different FSLMs are detected using various methods. In certain embodiments, FSLMs are detected in different biological samples. In some embodiments, a biological sample is a solid tissue sample, preferably a buccal sample, alternatively a skin biopsy sample, skin strip, hair follicle, muscle biopsy sample, or a body fluid sample such as blood (including any blood product, such as whole blood, plasma, serum, or specific types of cells of the blood), urine, saliva, or seminal fluid. In one embodiment, the biological sample is a skin sample. In one embodiment, the biological sample is a buccal sample. In one embodiment, the biological sample is a blood-derived sample, e.g., a plasma sample or a platelet sample.
[0476] FSLM levels can be detected based on the absolute level or a normalized or relative level. Detection of absolute FSLM levels may be preferable when monitoring the treatment of a subject or in determining if there is a change in the FXN status of a subject. For example, the levels of one or more FSLMs can be monitored in a subject undergoing treatment with an FXN replacement therapy, e.g., at regular intervals, such as a monthly intervals. A modulation in the levels of one or more FSLMs can be monitored over time to observe trends in changes of the FSLM levels. Levels of the FSLMs of the disclosure in the subject may be higher than the levels of those FSLMs in a normal sample, but may be lower than the prior levels, thus indicating a lack of efficacy of the FXN replacement therapy in the subject. Changes, or not, in FSLM levels may be more relevant to treatment decisions for the subject than FSLM levels present in the population. Rapid changes in FSLM levels in a subject may be indicative of an abnormal FXN levels, even if the FSLMs are within normal ranges for the population.
[0477] As an alternative to making determinations based on the absolute level of the FSLM, determinations may be based on the normalized level of the FSLM. FSLM levels are normalized by correcting the absolute level of an FSLM by comparing its level to the level of a lipid that is not an FSLM, e.g., a lipid that is not sensitive to FXN levels. This normalization allows the comparison of the FSLM level in one sample, e.g., a sample from an FXN deficient subject, to another sample, e.g., a normal sample, or between samples from different sources.
[0478] Any one of the FXN lipid profiles described herein may be part of one or more algorithms which may be used to analyze the FXN lipid profile of a sample and determine whether the sample represents a sample of a normal subject, a sample from a subject prior to FXN replacement therapy or a sample from a subject after FXN replacement therapy. The one or more algorithms may be used to analyze a sample from a subject treated with an FXN-replacement therapy and determine whether the subject has reacted effectively to the treatment, and therefore expresses a profile characteristic of an FXN replacement lipid profile or not. Thus an algorithm for analyzing the lipid profile of a sample may use any one of a baseline FXN(?) lipid profile, an FXN replacement lipid profile, or a normal FXN lipid profile, or a combination of profiles. Where a sample having FXN signature lipid patterns consistent with baseline FXN(?) lipid profile represents lack of effectiveness of FXN replacement therapy; and the sample having FXN lipid profile consistent with FXN replacement lipid profile and/or normal FXN lipid profile represents effectiveness of FXN replacement therapy. In an embodiment, a classifier may be applied to FXN lipid profiles obtained from subject samples in order to obtain information about the samples, for example to characterize the status of the FXN lipid profile, or to define whether the subject was administered FXN replacement therapy or not. Alternatively or additionally, a classifier may be applied for evaluating whether the FXN lipid profile of the subject sample reached a certain threshold necessary for FXN replacement treatment to be considered effective.
Methods of for Treating FXN Deficiency
[0479] Provided in the disclosure is also a method of treatment of a subject suffering from a mitochondrial disease having FXN deficiency, the method comprising determining an FXN lipid profile in a sample from the subject, and comparing the FXN lipid profile obtained from the sample with at least one of a normal FXN lipid profile, a baseline FXN(?) lipid profile, or an FXN replacement lipid profile. The sample may be further classified as having a normal FXN, a baseline FXN(?) or an FXN replacement profile. Using the results of the comparison of the sample FXN profile with the FXN profiles described herein, a therapy regime using FXN replacement therapy may be initiated, paused or ceased. Alternatively, an FXN replacement therapy dosage regime may be modified, e.g., increased or decreased. In one embodiment, the method further comprises obtaining or providing a sample from a subject, e.g., an FXN-deficient subject, such as a subject with FRDA.
[0480] In some embodiments, the present disclosure provides a method for treating an FXN deficiency, the method comprising: (a) determining an FXN lipid profile in a sample obtained from an FXN deficient subject for one or more FXN-sensitive lipid markers (FSLMs), (b) comparing the FXN lipid profile of the sample with at least one other lipid profile selected from the group consisting of normal FXN lipid profile for the one or more FSLMs, baseline FXN(?) lipid profile for the one or more FSLMs, and FXN replacement lipid profile for the one or more FSLMs, (c) classifying the FXN lipid profile determined in step (a) as corresponding to a normal FXN lipid profile, baseline FXN(?) lipid profile or an FXN replacement lipid profile, and (d) maintaining, initiating or modulating an FXN replacement therapy based on the classification of the FXN lipid profile of the sample.
[0481] In some embodiments, modulating an FXN replacement therapy comprises increasing the dosage, decreasing the dosage, increasing the administration frequency, decreasing the administration frequency, or any combination thereof, of the FXN replacement therapy.
[0482] In some embodiments, the one or more FSLMs comprise one or any combination of one or more TGs, ether phospholipids (e.g., PCO- or PEO-), PCs, DGs or CEs as described herein.
[0483] In some embodiments, when there is an increase in the amount of one or more of TGs, wherein the three acyl groups in each TG molecule contain less than 56 carbon atoms or contain 7 or less unsaturations (e.g., TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7) in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, the FXN lipid profile determined in step (a) is classified as corresponding to a baseline FXN(?) lipid profile.
[0484] In some embodiments, when there is a decrease in the amount of one or more PCO-, (e.g., one or more of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7 and PCO-46.8) in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, the FXN lipid profile determined in step (a) is classified as corresponding to a baseline FXN(?) lipid profile.
[0485] In some embodiments, when there is an increase in the amount of one or more PCs selected from the group consisting of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7 in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, the FXN lipid profile determined in step (a) is classified as corresponding to a baseline FXN(?) lipid profile.
[0486] In some embodiments, when there is a decrease in the amount of one or more PCs selected from the group consisting of PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0) in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, the FXN lipid profile determined in step (a) is classified as corresponding to a baseline FXN(?) lipid profile.
[0487] In some embodiments, when there is an increase in the amount of DG(18:1/18:2) in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, the FXN lipid profile determined in step (a) is classified as corresponding to a baseline FXN(?) lipid profile.
[0488] In some embodiments, when there is an increase in the amount of CE14:1 in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, the FXN lipid profile determined in step (a) is classified as corresponding to a baseline FXN(?) lipid profile.
[0489] In some embodiments, when there is a decrease in the amount of CE16:0 in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, the FXN lipid profile determined in step (a) is classified as corresponding to a baseline FXN(?) lipid profile.
[0490] In some embodiments, when there is a decrease in the amount of CE20:5 in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, the FXN lipid profile determined in step (a) is classified as corresponding to a baseline FXN(?) lipid profile.
[0491] In some embodiments, when the FXN lipid profile in the sample is classified as a baseline FXN(?) lipid profile, administration of an FXN replacement therapy is initiated in the FXN deficient subject. In some embodiments, when the FXN lipid profile in the sample is classified as a baseline FXN(?) lipid profile, and the FXN deficient subject is already undergoing FXN replacement therapy, the FXN replacement therapy regiment is altered, e.g., the dose and/or administration frequency of the FXN replacement therapy is increased.
[0492] In some embodiments, when there is a lack of change in the amount of any one of TGs, ether phospholipids (e.g., PCO- or PEO-), PCs, DGs or CEs as described herein in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, the FXN lipid profile determined in step (a) is classified as corresponding to a normal FXN lipid profile.
[0493] In some embodiments, when the FXN lipid profile in the sample is classified as a normal FXN lipid profile, administration of an FXN replacement therapy is not initiated in the FXN deficient subject. In some embodiments, when the FXN lipid profile in the sample is classified as a normal FXN lipid profile, and the FXN deficient subject is already undergoing FXN replacement therapy, the FXN replacement therapy regimen is maintained (i.e., not changed), e.g., the dose and/or administration frequency of the FXN replacement therapy is maintained.
[0494] In some aspects, the present disclosure also provides a method of treating an FXN deficiency in a subject, the method comprising: (a) determining an FXN lipid profile for one or more FSLMs in a sample from an FXN deficient subject; and (b) recommending to a healthcare provider to administer an FXN replacement therapy to the subject based on the subject FXN lipid profile determined in step (a). In some aspects, the present disclosure also provides a method of treating an FXN deficiency in a subject, the method comprising: (a) obtaining an FXN lipid profile for one or more FSLMs in a sample obtained from an FXN deficient subject; and (b) administering an FXN replacement therapy to the subject based on the subject FXN lipid profile.
[0495] In some embodiments, the method further comprises comparing the FXN lipid profile for the one or more FSGMs in the sample with at least one other lipid profile selected from the group consisting of normal FXN lipid profile for the one or more FSGMs, baseline FXN(?) lipid profile for the one or more FSGMs, and FXN replacement lipid profile for the one or more FSGMs. In some embodiments, the method further comprises classifying the FXN lipid profile for the one or more FSGMs in the sample as corresponding to a normal FXN lipid profile for the one or more FSGMs, baseline FXN(?) lipid profile for the one or more FSGMs, or FXN replacement lipid profile for the one or more FSGMs. In some embodiments, the one or more FSLMs comprise one or any combination of one or more TGs, ether phospholipids (e.g., PCO- or PEO-), PCs, DGs or CEs as described herein.
[0496] In some embodiments, when there is an increase in the amount of one or more of TGs, wherein the three acyl groups in each TG molecule contain less than 56 carbon atoms or contain 7 or less unsaturations (e.g., TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7) in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, then an FXN replacement therapy is administered to the FXN deficient subject, or a recommendation to a healthcare provider is made to administer an FXN replacement therapy to the FXN deficient subject. In some embodiments, when there is an increase in the amount of one or more of TGs, wherein the three acyl groups in each TG molecule contain less than 56 carbon atoms or contain 7 or less unsaturations (e.g., TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7) in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, and the FXN deficient subject is undergoing an FXN replacement therapy, then the FXN replacement therapy regimen is altered (e.g., the dosage and/or administration frequency is increased), or a recommendation to a healthcare provider is made to alter the FXN replacement therapy regimen.
[0497] In some embodiments, when there is lack of an increase in the amount of one or more of TGs, wherein the three acyl groups in each TG molecule contain less than 56 carbon atoms or contain 7 or less unsaturations (e.g., TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7) in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, then an FXN replacement therapy is not administered to the FXN deficient subject, or a recommendation to a healthcare provider is made to not administer an FXN replacement therapy to the subject. In some embodiments, when there is a lack of an increase in the amount of one or more of TGs, wherein the three acyl groups in each TG molecule contain less than 56 carbon atoms or contain 7 or less unsaturations (e.g., TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7) in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, and wherein the FXN deficient subject is undergoing an FXN replacement therapy, the FXN replacement therapy regimen is maintained (i.e., not changed), or a recommendation to a healthcare provider is made to maintain the FXN replacement therapy regimen.
[0498] In some embodiments, when there is a decrease in the amount of one or more PCO-, (e.g., one or more of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7 and PCO-46.8) in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, then an FXN replacement therapy is administered to the FXN deficient subject, or a recommendation to a healthcare provider is made to administer an FXN replacement therapy to the FXN deficient subject. In some embodiments, when there is a decrease in the amount of one or more PCO-, (e.g., one or more of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7 and PCO-46.8) in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, and the FXN deficient subject is undergoing an FXN replacement therapy, then the FXN replacement therapy regimen is altered (e.g., the dosage and/or administration frequency is increased), or a recommendation to a healthcare provider is made to alter the FXN replacement therapy regimen.
[0499] In some embodiments, when there is lack of a decrease in the amount of one or more PCO-, (e.g., one or more of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7 and PCO-46.8) in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, then an FXN replacement therapy is not administered to the FXN deficient subject, or a recommendation to a healthcare provider is made to not administer an FXN replacement therapy to the subject. In some embodiments, when there is a lack of a decrease in the amount of one or more PCO-, (e.g., one or more of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7 and PCO-46.8) in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, and wherein the FXN deficient subject is undergoing an FXN replacement therapy, the FXN replacement therapy regimen is maintained (i.e., not changed), or a recommendation to a healthcare provider is made to maintain the FXN replacement therapy regimen.
[0500] In some embodiments, when there is an increase in the amount of one or more PCs selected from the group consisting of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7 in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, then an FXN replacement therapy is administered to the FXN deficient subject, or a recommendation to a healthcare provider is made to administer an FXN replacement therapy to the FXN deficient subject. In some embodiments, when there is an increase in the amount of one or more PCs selected from the group consisting of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7 in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, and the FXN deficient subject is undergoing an FXN replacement therapy, then the FXN replacement therapy regimen is altered (e.g., the dosage and/or administration frequency is increased), or a recommendation to a healthcare provider is made to alter the FXN replacement therapy regimen.
[0501] In some embodiments, when there is lack of an increase in the amount of one or more PCs selected from the group consisting of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7 in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, then an FXN replacement therapy is not administered to the FXN deficient subject, or a recommendation to a healthcare provider is made to not administer an FXN replacement therapy to the subject. In some embodiments, when there is a lack of an increase in the amount of one or more PCs selected from the group consisting of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7 in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, and wherein the FXN deficient subject is undergoing an FXN replacement therapy, the FXN replacement therapy regimen is maintained (i.e., not changed), or a recommendation to a healthcare provider is made to maintain the FXN replacement therapy regimen.
[0502] In some embodiments, when there is a decrease in the amount of one or more PCs selected from the group consisting of PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0) in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, then an FXN replacement therapy is administered to the FXN deficient subject, or a recommendation to a healthcare provider is made to administer an FXN replacement therapy to the FXN deficient subject. In some embodiments, when there is a decrease in the amount of one or more PCs selected from the group consisting of PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0) in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, and the FXN deficient subject is undergoing an FXN replacement therapy, then the FXN replacement therapy regimen is altered (e.g., the dosage and/or administration frequency is increased), or a recommendation to a healthcare provider is made to alter the FXN replacement therapy regimen.
[0503] In some embodiments, when there is lack of a decrease in the amount of one or more PCs selected from the group consisting of PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0) in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, then an FXN replacement therapy is not administered to the FXN deficient subject, or a recommendation to a healthcare provider is made to not administer an FXN replacement therapy to the subject. In some embodiments, when there is a lack of a decrease in the amount of one or more PCs selected from the group consisting of PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0) in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, and wherein the FXN deficient subject is undergoing an FXN replacement therapy, the FXN replacement therapy regimen is maintained (i.e., not changed), or a recommendation to a healthcare provider is made to maintain the FXN replacement therapy regimen.
[0504] In some embodiments, when there is an increase in the amount of DG(18:1/18:2) in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, then an FXN replacement therapy is administered to the FXN deficient subject, or a recommendation to a healthcare provider is made to administer an FXN replacement therapy to the FXN deficient subject. In some embodiments, when there is an increase in the amount of DG(18:1/18:2) in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, and the FXN deficient subject is undergoing an FXN replacement therapy, then the FXN replacement therapy regimen is altered (e.g., the dosage and/or administration frequency is increased), or a recommendation to a healthcare provider is made to alter the FXN replacement therapy regimen.
[0505] In some embodiments, when there is lack of an increase in the amount of DG(18:1/18:2) in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, then an FXN replacement therapy is not administered to the FXN deficient subject, or a recommendation to a healthcare provider is made to not administer an FXN replacement therapy to the subject. In some embodiments, when there is a lack of a decrease in the amount of an increase in the amount of DG(18:1/18:2) in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, and wherein the FXN deficient subject is undergoing an FXN replacement therapy, the FXN replacement therapy regimen is maintained (i.e., not changed), or a recommendation to a healthcare provider is made to maintain the FXN replacement therapy regimen.
[0506] In some embodiments, when there is an increase in the amount of CE14:1 in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, then an FXN replacement therapy is administered to the FXN deficient subject, or a recommendation to a healthcare provider is made to administer an FXN replacement therapy to the FXN deficient subject. In some embodiments, when there is an increase in the amount of CE14:1 in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, and the FXN deficient subject is undergoing an FXN replacement therapy, then the FXN replacement therapy regimen is altered (e.g., the dosage and/or administration frequency is increased), or a recommendation to a healthcare provider is made to alter the FXN replacement therapy regimen.
[0507] In some embodiments, when there is lack of an increase in the amount of CE14:1 in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, then an FXN replacement therapy is not administered to the FXN deficient subject, or a recommendation to a healthcare provider is made to not administer an FXN replacement therapy to the subject. In some embodiments, when there is a lack of a decrease in the amount of an increase in the amount of CE14:1 in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, and wherein the FXN deficient subject is undergoing an FXN replacement therapy, the FXN replacement therapy regimen is maintained (i.e., not changed), or a recommendation to a healthcare provider is made to maintain the FXN replacement therapy regimen.
[0508] In some embodiments, when there is a decrease in the amount of CE16:0 in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, then an FXN replacement therapy is administered to the FXN deficient subject, or a recommendation to a healthcare provider is made to administer an FXN replacement therapy to the FXN deficient subject. In some embodiments, when there is a decrease in the amount of CE16:0 in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, and the FXN deficient subject is undergoing an FXN replacement therapy, then the FXN replacement therapy regimen is altered (e.g., the dosage and/or administration frequency is increased), or a recommendation to a healthcare provider is made to alter the FXN replacement therapy regimen.
[0509] In some embodiments, when there is lack of a decrease in the amount of CE16:0 in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, then an FXN replacement therapy is not administered to the FXN deficient subject, or a recommendation to a healthcare provider is made to not administer an FXN replacement therapy to the subject. In some embodiments, when there is a lack of a decrease in the amount of a decrease in the amount of CE16:0 in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, and wherein the FXN deficient subject is undergoing an FXN replacement therapy, the FXN replacement therapy regimen is maintained (i.e., not changed), or a recommendation to a healthcare provider is made to maintain the FXN replacement therapy regimen.
[0510] In some embodiments, when there is a decrease in the amount of CE20:5 in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, then an FXN replacement therapy is administered to the FXN deficient subject, or a recommendation to a healthcare provider is made to administer an FXN replacement therapy to the FXN deficient subject. In some embodiments, when there is a decrease in the amount of CE20:5 in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, and the FXN deficient subject is undergoing an FXN replacement therapy, then the FXN replacement therapy regimen is altered (e.g., the dosage and/or administration frequency is increased), or a recommendation to a healthcare provider is made to alter the FXN replacement therapy regimen.
[0511] In some embodiments, when there is lack of a decrease in the amount of CE20:5 in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, then an FXN replacement therapy is not administered to the FXN deficient subject, or a recommendation to a healthcare provider is made to not administer an FXN replacement therapy to the subject. In some embodiments, when there is a lack of a decrease in the amount of a decrease in the amount of CE20:5 in the sample obtained from the FXN deficient subject as compared to the amount in the normal FXN lipid profile, and wherein the FXN deficient subject is undergoing an FXN replacement therapy, the FXN replacement therapy regimen is maintained (i.e., not changed), or a recommendation to a healthcare provider is made to maintain the FXN replacement therapy regimen.
[0512] In other embodiments, the present disclosure also involves the analysis and consideration of any clinical and/or subject-related health data, for example, data obtained from an Electronic Medical Record (e.g., collection of electronic health information about individual subjects or populations relating to various types of data, such as, demographics, medical history, medication and allergies, immunization status, laboratory test results, radiology images, vital signs, personal statistics like age and weight, and billing information).
[0513] In certain embodiments the methods provided herein further comprise obtaining a biological sample from a subject suspected of having a mitochondrial disease, e.g., FRDA.
[0514] In certain embodiments the methods provided herein further comprise selecting a treatment regimen for the subject based on the level of the one or more FSLMs, such as triglycerides, cholesteryl esters, e.g., CE16:0, CE20:5, or ether phospholipids, e.g., PCO- or PEO-, including phosphatidylcholine ethers, such as PC(O-17:0/20:4). In certain embodiments, the treatment method is started, changed, revised, or maintained based on the results from the methods of the disclosure, e.g., when it is determined that the subject is responding to the treatment regimen, or when it is determined that the subject is not responding to the treatment regimen, or when it is determined that the subject is insufficiently responding to the treatment regimen. In certain embodiments, the treatment method is changed based on the results from the methods.
[0515] In certain embodiments of the diagnostic and monitoring methods provided herein, the method further comprises isolating a component of the biological sample.
[0516] In certain embodiments of the diagnostic and monitoring methods provided herein, the method further comprises concentrating a component of the biological sample.
Methods for Monitoring FXN Deficiency
[0517] In some aspects, the present disclosure provides methods for evaluating FXN deficiency or monitoring or evaluating progression of FXN deficiency in a subject over time. In these methods the amount of one or more FSLMs described herein, e.g., one or more of TGs, PCO- or PCs described herein, in one or more samples obtained from a subject known or suspected of having an FXN deficiency is assessed. The samples may comprise one sample obtained from the subject that may be used for comparison to a reference sample, e.g., a sample obtained from a healthy subject. The samples may also comprise a first sample obtained from the subject at an earlier time point and a second sample obtained from the subject at a later time point. It is understood that the methods of the disclosure include obtaining and analyzing more than two samples (e.g., 3, 4, 5, 6, 7, 8, 9, or more samples) at regular or irregular intervals for assessment of FSLM levels. Pairwise comparisons can be made between consecutive or non-consecutive subject samples. Trends of FSLM levels and rates of change of FSLM levels can be analyzed for any two or more consecutive or non-consecutive subject samples.
[0518] Accordingly, the present disclosure provides a method for evaluating an FXN deficiency in a subject, comprising (a) determining an FXN lipid profile for one or more FSLMs in a sample obtained from the subject, e.g., an FXN deficient subject or a subject suspected of having an FXN deficiency; and (b) comparing the FXN replacement lipid profile determined in step (a) to a reference FXN lipid profile for the one or more FSGMs; and making a determination about the FXN deficiency of the subject based on the comparison in step (b). In some embodiments, the reference FXN lipid profile is a normal FXN lipid profile. In some embodiments, a determination as to the severity of the FXN deficiency is made. In some embodiments, a determination as to the necessity to administer an FXN replacement therapy is made.
[0519] In some embodiments, the one or more FSLMs comprise one or any combination of one or more TGs, ether phospholipids (e.g., PCO- or PEO-), PCs, DGs or CEs as described herein. For example, the one or more FSLMs may comprise one or more TGs, wherein the three acyl groups in each TG molecule contain less than 56 carbon atoms, e.g., one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, an increase in the amount of one or more TGs, wherein the three acyl groups in each TG molecule contain less than 56 carbon atoms (e.g., one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7) in the subject FXN lipid profile as compared to the normal FXN lipid profile is indicative that the subject has FXN deficiency.
[0520] In some embodiments, the one or more FSLMs may comprise one or more TGs, wherein the three acyl groups in each TG molecule contain 7 or less unsaturations, e.g., one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, an increase in the amount of one or more TGs, wherein the three acyl groups in each TG molecule contain 7 or less unsaturations, (e.g., one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7) in the subject FXN lipid profile as compared to the normal FXN lipid profile is indicative that the subject has FXN deficiency.
[0521] In some embodiments, the one or more FSLMs comprise one or more PCO-, e.g., one or more of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7 and PCO-46.8. In some embodiments, a decrease in the amount of one or more PCO- (e.g., one or more of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7 and PCO-46.8) in the subject FXN lipid profile as compared to the normal FXN lipid profile is indicative that the subject has FXN deficiency.
[0522] In some embodiments, the one or more FSLMs comprise one or more PCs, e.g., one or more of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0), PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0). In some embodiments, an increase in the amount of one or more PCs selected from the group consisting of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7 in the subject FXN lipid profile as compared to the normal FXN lipid profile is indicative that the subject has FXN deficiency. In some embodiments, a decrease in the amount of one or more PCs selected from the group consisting of PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0) in the subject FXN lipid profile as compared to the normal FXN lipid profile is indicative that the subject has FXN deficiency.
[0523] In some embodiments, the one or more FSLMs comprise one or more diglycerides, e.g., DG(18:1/18:2). In some embodiments, an increase in the amount of one or more DG, e.g., DG(18:1/18:2), in the subject FXN lipid profile as compared to the normal FXN lipid profile is indicative that the subject has FXN deficiency.
[0524] In some embodiments, an increase in the amount of CE14:1 in the subject FXN lipid profile as compared to the normal FXN lipid profile is indicative that the subject has FXN deficiency.
[0525] In some embodiments, a decrease in the amount of CE16:0 and/or CE20:5 in the subject FXN lipid profile as compared to the normal FXN lipid profile is indicative that the subject has FXN deficiency.
[0526] The present disclosure also provides a method for monitoring progression of an FXN deficiency in a subject, the method comprising: (a) determining a first FXN lipid profile for one or more FSLMs in a first sample obtained from the subject, e.g., an FXN deficient subject or a subject suspected of having an FXN deficiency, at a first time point; (b) determining a second FXN lipid profile for the one or more FSLMs in a second sample obtained from the subject at a second time point that is later than the first time point; and (c) comparing the second FXN lipid profile with the first FXN lipid profile; thereby monitoring FXN deficiency in the subject.
[0527] In some embodiments, the one or more FSLMs comprise one or any combination of one or more TGs, ether phospholipids (e.g., PCO- or PEO-), PCs, DGs or CEs as described herein. For example, the one or more FSLMs may comprise one or more TGs, wherein the three acyl groups in each TG molecule contain less than 56 carbon atoms, e.g., one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7.
[0528] In some embodiments, an increase in the amount of one or more TGs, wherein the three acyl groups in each TG molecule contain less than 56 carbon atoms (e.g., one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7) in the second FXN lipid profile as compared to the first FXN lipid profile is indicative that the FXN deficiency has progressed. In some embodiments, a lack of an increase in the amount of one or more TGs, wherein the three acyl groups in each TG molecule contain less than 56 carbon atoms (e.g., one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7) in the second FXN lipid profile as compared to the first FXN lipid profile is indicative that the FXN deficiency has not progressed.
[0529] In some embodiments, the one or more FSLMs comprise one or any combination of one or more TGs, wherein the three acyl groups in each TG molecule contain 7 or less unsaturations, e.g., one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7. In some embodiments, an increase in the amount of one or more TGs, wherein the three acyl groups in each TG molecule contain 7 or less unsaturations, (e.g., one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7) in the second FXN lipid profile as compared to the first FXN lipid profile is indicative that the FXN deficiency has progressed. In some embodiments, a lack of an increase in the amount of one or more TGs, wherein the three acyl groups in each TG molecule contain 7 or less unsaturations, (e.g., one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7) in the second FXN lipid profile as compared to the first FXN lipid profile is indicative that the FXN deficiency has not progressed.
[0530] In some embodiments, the one or more FSLMs comprise one or more PCO-, e.g., one or more of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7 and PCO-46.8. In some embodiments, a decrease in the amount of one or more PCO- (e.g., one or more of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7 and PCO-46.8) in the second FXN lipid profile as compared to the first FXN lipid profile is indicative that the FXN deficiency has progressed. In some embodiments, lack of a decrease in the amount of one or more PCO- (e.g., one or more of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7 and PCO-46.8) in the second FXN lipid profile as compared to the first FXN lipid profile is indicative that the FXN deficiency has not progressed.
[0531] In some embodiments, the one or more FSLMs comprise one or more PCs, e.g., one or more of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0), PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0).
[0532] In some embodiments, an increase in the amount of one or more PCs selected from the group consisting of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7 in the second FXN lipid profile as compared to the first FXN lipid profile is indicative that the FXN deficiency has progressed. In some embodiments, lack of an increase in the amount of one or more PCs selected from the group consisting of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7 in the second FXN lipid profile as compared to the first FXN lipid profile is indicative that the FXN deficiency has not progressed.
[0533] In some embodiments, a decrease in the amount of one or more PCs selected from the group consisting of PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0) in the second FXN lipid profile as compared to the first FXN lipid profile is indicative that the FXN deficiency has progressed. In some embodiments, lack of a decrease in the amount of one or more PCs selected from the group consisting of PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0) in the second FXN lipid profile as compared to the first FXN lipid profile is indicative that the FXN deficiency has not progressed.
[0534] In some embodiments, the one or more FSLMs comprise one or more diglycerides, e.g., DG(18:1/18:2). In some embodiments, an increase in the amount of one or more DG, e.g., DG(18:1/18:2), in the second FXN lipid profile as compared to the first FXN lipid profile is indicative that the FXN deficiency has progressed. In some embodiments, lack of an increase in the amount of one or more DG, e.g., DG(18:1/18:2), in the second FXN lipid profile as compared to the first FXN lipid profile is indicative that the FXN deficiency has not progressed.
[0535] In some embodiments, an increase in the amount of CE14:1 in the second FXN lipid profile as compared to the first FXN lipid profile is indicative that the FXN deficiency has progressed. In some embodiments, lack of an increase in the amount of CE14:1 in the second FXN lipid profile as compared to the first FXN lipid profile is indicative that the FXN deficiency has not progressed.
[0536] In some embodiments, a decrease in the amount of CE16:0 and/or CE20:5 in the second FXN lipid profile as compared to the first FXN lipid profile is indicative that the FXN deficiency has progressed. In some embodiments, lack of a decrease in the amount of CE16:0 and/or CE20:5 in the second FXN lipid profile as compared to the first FXN lipid profile is indicative that the FXN deficiency has not progressed.
Methods for Detecting FSLMs
[0537] In some aspects, the present disclosure also provides a method for detecting one or more frataxin-sensitive lipid markers (FSLMs) in a sample from a frataxin (FXN) deficient subject, the method comprising contacting the sample, or a portion thereof, with one or more reagents specific for detecting the level of each of the one or more FSLMs.
[0538] In some aspects, the present disclosure also provides a method for detecting one or more frataxin-sensitive lipid markers (FSLMs) in a sample from a frataxin (FXN) deficient subject, the method comprising subjecting the sample, or a portion thereof, to liquid chromatography and mass spectrometry (LC/MS).
[0539] In some embodiments, the FXN deficient subject has Friedreich's Ataxia. In some embodiments, the sample is obtained from the FXN deficient subject before the subject is administered FXN replacement therapy. In some embodiments, the sample is obtained from the FXN deficient subject after the subject is administered FXN replacement therapy. In some embodiments, the sample is obtained from the FXN deficient subject at different time points, e.g., 1, 2, 3, 4 or more time points, while the subject is being administered FXN replacement therapy.
[0540] In some embodiments, the method further comprises obtaining a sample from the FXN deficient subject. In some embodiments, the sample is selected from the group consisting of a buccal sample, a skin sample, a hair follicle or a blood-derived sample. In some embodiments, the sample is a blood-derived sample, e.g., a plasma sample.
[0541] In some embodiments, the one or more FSLMs comprise one or any combination of one or more TGs, ether phospholipids (e.g., PCO- or PEO-), PCs, DGs or CEs as described herein. For example, in some embodiments, the one or more FSLMs comprise one or more of TGs, wherein the three acyl groups in each TG molecule contain less than 56 carbon atoms or 7 or less unsaturations (e.g., TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7). In some embodiments, the one or more FSLMs comprise TG48:1, TG48:2, TG49:1, TG49:2, TG49:4, TG50:1, TG50:3, TG51:1, TG51:2, TG51:3, TG52:3, TG53:2 and TG56:8.
[0542] In some embodiments, the one or more FSLMs comprise one or more PCO-, e.g., one or more of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7 and PCO-46.8. In some embodiments, the one or more FSLMs comprise PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-18:1/18:2). PC(O-22:2/20:4) and PC(O-24:2/20:4).
[0543] In some embodiments, the one or more FSLMs comprise one or more PCs selected from the group consisting of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0). In some embodiments, the one or more FSLMs comprise PC(15:0/22:6) and PC(16:0/14:0). In some embodiments, the one or more FSLMs comprise PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0). In some embodiments, the one or more FSLMs comprise PC(18:2/18:3).
[0544] In some embodiments, the one or more FSLMs comprise one or more of DGs (e.g., DG18:1/18:2) and/or one or more of CEs (e.g., CE14:1, CE 16:0 and CE20:5).
Kits/Panels
[0545] The invention also provides compositions and kits for evaluating and monitoring effectiveness of FXN replacement therapy. These kits may include a reagent useful to facilitate detection and/or quantification by mass spectrometry of one or more FSLM of the disclosure, such as one or more triglycerides (TGs), wherein the three acyl groups in each triglyceride molecule contain less than 56 carbons and/or wherein the three acyl groups in each triglyceride molecule contain 7 or less unsaturations; ether phospholipids (e.g., PCO- and PEO-), phosphatidylcholines (PCs), cholesteryl esters (CEs); and diglycerides (DGs). In some embodiments, the kits include a reagent useful to facilitate the detection and/or quantification by mass spectrometry of one or more FSLMs selected from the group consisting of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2.
[0546] In some embodiments, a kit of the invention comprises an isotopically labeled analog of one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG54:7, PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7, PCO-46.8, PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2. In some embodiments, a kit of the invention comprises an isotopically labeled analog of one or more of TG45:1, TG46:1, TG46:3, TG47:1, TG47:2, TG48:0, TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG49:4, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6 and TG54:7.
[0547] In some embodiments, a kit of the invention comprises an isotopically labeled analog of one or more of PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:3), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-17:0/20:4), PC(O-18:0/18:1), PC(O-18:0/22:6), PC(O-18:0/18:2), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-20:2/20:4), PC(O-22:2/20:4), PC(O-22:1/22:6), PC(O-22:2/20:4), PC(O-(24:1/22:6), PC(O-24:2/20:4), PCO-34:2, PCO-36:3, PCO-34:2, PCO-38:3, PCO-40:2, PCO-40:6, PCO-44:7 and PCO-46.8.
[0548] In some embodiments, a kit of the invention comprises an isotopically labeled analog of one or more of PC(15:0/20:3), PC(15:0/22:6), PC(16:0/14:0), PC(16:0/22:4), PC(16:1/16:0), PC(16:1/20:4), PC(16:1/22.5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC40:6, PC42:7, PC(17:1/20:4), PC(18:2/18:3), PC(18:1/24:1), PC(18:2/20:5), PC(20:4/20:0), CE14:1, CE16:0, CE20:5 and DG18:1/18:2.
[0549] In some embodiments, the isotopically labeled analog may comprise one or more deuterium atoms. The isotopically labeled analogs described above may be used as internal standards during mass spectrometry to facilitate quantification of one or more FSLMs described above.
[0550] In some embodiments, kits of the present disclosure further comprise instructions for (a) determining a baseline FSLM(?) lipid profile for one or more FXN-sensitive lipid markers (FSLMs) in a sample obtained from an FXN deficient subject prior to administration of the FXN replacement therapy; (b) determining an FXN replacement lipid profile for the one or more FXN-sensitive lipid markers (FSLMs) in a sample obtained from the FXN deficient subject following administration of the FXN replacement therapy; (c) comparing the FXN replacement lipid profile determined in step (b) with the baseline FXN(?) lipid profile determined in step (a); and (d) determining efficacy of the FXN replacement therapy based on the comparison in step (c).
[0551] In some embodiments, kits of the present disclosure further comprise instructions for (a) determining an FXN replacement lipid profile for one or more FXN-sensitive lipid markers (FSLMs) in a sample obtained from an FXN deficient subject following administration of an FXN replacement therapy; (b) comparing the subject FXN replacement lipid profile determined in step (a) with a reference FXN lipid profile for the one or more FSLMs; and (c) determining efficacy of the FXN replacement therapy based on the comparison in step (b).
[0552] In some embodiments, kits of the present disclosure further comprise instructions for (a) determining a first FXN replacement lipid profile for one or more FXN-sensitive lipid markers (FSLMs) in a first sample obtained from an FXN deficient subject at a first time point following administration of an FXN replacement therapy to the subject, (b) determining a second FXN replacement lipid profile for the one or more FXN-sensitive lipid markers (FSLMs) in a second sample obtained from the subject at a second time point that is later than the first time point; and (c) comparing the second FXN replacement lipid profile with the first FXN replacement profile.
EXAMPLES
Example 1. Lipidomic Analysis of Samples from FRDA Subjects and Healthy Subjects
[0553] The goal of this experiment was to identify lipids that may be present in different amounts in a subject with Friedreich's Ataxia (FRDA) as compared to a healthy subject, for potential use as biomarkers. To this end, plasma samples were collected from 11 human subjects with Friedreich's Ataxia (FRDA) and 8 healthy controls (N) as shown in Table 2 below.
TABLE-US-00006 TABLE 2 Description of subjects used in the study Subject No. Gender Age at sample collection Group 1 F 18 FRDA 2 F 13 FRDA 3 F 30 FRDA 4 F 26 FRDA 5 M 34 FRDA 6 M 41 FRDA 7 M 23 FRDA 8 M 24 FRDA 9 M 18 FRDA 10 M 25 FRDA 11 M 21 FRDA 12 F 27 N 13 F 30 N 14* F 26 N 15 M 25 N 16 M 17 N 17 M 33 N 18 M 36 N 19 M 24 N *Sample 14 was lost during sample preparation
Sample Preparation and Analysis
[0554] Lipids were extracted from the collected samples and analyzed according to a validated protocol previously described in J. of Proteome Research 2018, 17(11):3657-3670, the entire contents of which are hereby incorporated herein by reference. Samples were split into 4 aliquots and stored at ?80? C. The lipids in the samples were analyzed by liquid chromatography and mass spectrometry (LC/MS) using a Zorbax Eclipse plus C18 column and a LC-QTOF 6530 Agilent operating in positive and negative modes. The volume of injection was 1 ?L, corresponding to 0.33 ?L of plasma equivalent. Internal standards were spiked into the plasma samples before extraction and monitored during LC/MS analysis. The lipids used as internal standards were PS(12:0/12:0), PC(14:0/14:0), PG(15:0/15:0) and PC(19:0/19:0).
Quality Control
[0555] Internal samples were spiked into the collected plasma samples before extraction and monitored by LC/MS. A plasma QC sample was injected at the beginning, in the middle and at the end of the LC/MS analysis sequence in positive mode and in negative mode for a total of 6 QC run analyses. Table 3 below shows the results of the QC runs for four different internal standards.
TABLE-US-00007 TABLE 3 Results of quality control analyses Samples Positive Mode Negative Mode m/z RT (min) RSD Mean m/z RT (min) RSD Mean PS(12:0/12:0) 624.389 12.22 12.5% 2.13E+06 622.372 12.22 10.89% 3.93E+06 PC(14:0/14:0) 678.508 17.78 11.66% 2.36E+07 722.498 17.76 12.22% 3.50E+06 PG(15:0/15:0) 712.514 N/A N/A N/A 693.471 18.55 11.67% 2.27E+06 PC(19:0/19:0) 818.666 35.82 13.2% 6.11E+07 862.654 35.80 11.17% 7.68E+06
[0556] For the plasma QC samples, analyzed in triplicates, the median relative standard deviation (RSD) was 11.10% in the positive mode and 6.44% in the negative mode. The results of the quality control analysis indicate that the internal standards and the QC samples meet the analysis criteria in terms of variability and intensity of signal. It is noted that the signal for the internal standard PG(15:0/15:0) was missing in the positive ion mode likely due to an error during sample preparation.
Data Processing
[0557] Raw MS data was normalized using cyclic loss algorithm using all MS scan signals measured. Imputation of missing values was done using Knn5. All steps of data processing are described in J. of Proteome Research 2018, 17(11):3657-3670. After filtering and corrections from the data processing, the result dataset contained 1938 MS signals (lipid features), ready for statistical analysis.
Statistical Analysis
[0558] Exploratory principal component analysis (PCA) was performed, followed by comparison between the 2 groups using a linear regression approach on each feature. Correction for age and gender were applied. A Storey correction was used to estimate the False Discovery Rate (FDR). To identify features associated with FRDA, the following criteria was used for the FDR and fold-change (FC): FDR=25% (which corresponds to P value of <0.04) and FC>1.23 or <0.81.
Annotation of Lipids
[0559] Annotation of lipids was carried out using MS/MS on features meeting the criteria of P-value and FC.
Results
[0560]
[0561]
Comparison of FRDA Subjects and Control Subjects
[0562] On all the 1938 features, 168 entities were found to discriminate between FRDA and healthy subjects with a p value <0.04 (corresponding to Q-value <0.25) and a fold change >1.23 or <0.81. These 168 entities were analyzed with 2 rounds of MS/MS, resulting in 111 annotations, of which 66 are unique lipids. Results are presented by the volcano plot (
TABLE-US-00008 TABLE 4 Lipids found to discriminate between FRDA and healthy subjects. # of identified # of identified features that are features that are increased in decreased in Category (Sub)class FRDA subjects FRDA subjects Fatty acyls (FA) Very-long-chain dicarboxylic acid 2(2)* Glycerophospholipids Monoacylglycerophophocholines 1(1) (GP) (LPC) Diacylglycerophosphocholines 8(6) 6(4) (PC) Ether 1(1) 7(7) Diacylglycerophosphocholines (PCO) Oxidized 5(5) Diacylglycerophosphocholines (PC(OH)) Sphingolipids (SP) Sphingomyelins (SM) 13(12) Ceramides (Cer) 6(2) Neutral glycosphingolipids (Glc- 1(1) Cer) Sterols Lipids (ST) Stetroid conjugates 2(2) Cholesteryls esters (CE) 7(3) 12(3) Campesteryl esters 3(3) Glycerolipids (GP) Triacylglycerols (TG) 33(15) 2(2) Epoxy Triacylglycerols (TG) 2(2) Total 55(31) 56(35) *( ) number of unique lipids
[0563]
[0564]
[0565]
TABLE-US-00009 TABLE 5 Lipids present at increased levels in FRDA subjects as compared to healthy controls. Sub(class) ID Fold change P-value Very-long-chain dicarboxylic acid VLCDCA 28:1(OH)* 1.50 0.029 VLCDCA 28:4* 1.49 0.023 Monoacylglycerophosphocholines (LPC) LPC22:5 1.65 0.021 Diacylglycerophosphocholines (PC) PC(18:0_24:5) 1.56 8.52E?03 PC(18:0_22:5) 1.52 0.014 PC(18:0_22:4) 1.28 0.019 Ether Diacylglycerophosphocholines PC(O-17:1/20:4) 1.60 0.020 (PCO) Oxidized Diacylglycerophosphocholines PC(16:0/8:0(COOH))* 3.00 1.54E?04 (PC(OH)) PC(16:0/9:0(COOH)) Paz-PC* 2.31 7.75E?03 PC(18:0/9:0(COOH))* 2.18 2.21E?03 PC(18:0/8:0(COOH))* 1.74 0.018 PC(16:0/18:3(OH))* 1.47 0.015 Neutral glycosphingolipids (Glc-Cer) GlcCer(d18:1/24:1) 1.42 0.014 Steroid conjugates Steroid conjugates* 1.36 7.78E?03 Steroid conjugates* 1.26 0.018 Cholesteryls esters (CE) CE22:5 1.82 0.006 CE17:0 1.44 7.78E?03 CE18:0 1.38 0.011 Triacylglycerols (TG) TG(18:1_18:1_17:0) 2.24 4.82E?03 TG(18:1_18:1_20:3) 2.24 0.022 TG(14:0_18:1_17:1) 2.23 0.014 TG(16:0_17:1_18:1) 2.10 0.024 TG48:3 2.05 0.018 TG(16:0_16:1_18:2) 2.02 0.028 TG(18:1_18:1_17:0) 1.99 0.024 TG(14:0_18:1_16:1) 1.98 0.028 TG(18:2_16:1_15:0) 1.87 0.022 TG(18:0_18:1_22:4) 1.77 0.011 TG(18:2_18:1_17:1) 1.77 0.037 TG(18:1_18:1_22:4) 1.72 0.010 TG(18:1_18:2_20:3) 1.70 0.032 TG54:3 1.50 0.032 TG(18:1_18:1_22:5) 1.50 0.033 Epoxy Triacylglycerols (Epoxy-TG) Epoxy TG 16:0_18:1_18:2 (O) 1.72 0.018 Epoxy TG 18:1_18:1_18:2 (O) 1.77 3.62E?03 *annotation needs to be confirmed
[0566] It is noted that the lipid TG(18:1_18:1_17:0) is listed twice in Table 5 because it was identified based on two separate features during mass spectrometric analysis.
[0567] Table 6 below shows lipids that were determined to be present at decreased levels in FRDA subjects as compared to healthy controls.
TABLE-US-00010 TABLE 6 Lipids present at decreased levels in FRDA subjects as compared to healthy controls. Sub(class) ID Fold change P-value Diacylglycerophosphocholines (PC) PC(14:0_18:2) 0.74 0.011 PC(18:0_20:5) 0.63 0.028 PC(18:1_20:5) 0.57 0.018 PC(16:0_20:5) 0.57 9.84E?03 Ether Diacylglycerophosphocholines PC(O-20:2/20:4) 0.80 0.028 (PCO) PC(O-18:1/16:0) 0.70 0.015 PCO-40:3 0.67 5.10E?03 PC(O-18:1/22:6) 0.64 8.55E?03 PC(O-16:1/18:2) 0.63 0.014 PC(P-18:0/20:5) 0.60 0.024 PC(O-16:0/20:5) 0.53 0.016 Sphingomyelins (SM) SM(d18:1/23:0) 0.79 8.78E?03 SM(d18:1/24:0) 0.78 0.022 SM(d18:2/23:0) 0.76 9.11E?03 SM(d18:1/22:0) 0.75 2.11E?03 SM(d18:2/22:0) 0.74 4.77E?03 SM(d18:1/22:1) 0.73 3.28E?03 SM(d18:2/24:0) 0.72 0.026 SM(d18:1/21:0) 0.70 3.81E?04 SM(d16:1/16:0) 0.69 1.47E?03 SM(d16:1/22:0) 0.64 0.021 Ceramides (Cer) Cer(d18:1/22:0) 0.81 0.022 Cer(d18:1/24:0) 0.77 0.013 Neutral glycosphingolipids (Glc-Cer) GlcCer(d18:1/24:1) 1.42 0.014 Cholesteryl esters (CE) CE18:1 0.74 1.73E?03 CE14:0 0.71 0.017 CE20:5 0.59 0.015 Campesteryl esters 18:2 Campesteryl ester 0.69 0.035 18:3 Campesteryl ester 0.64 0.016 18:1 Campesteryl ester 0.62 0.014 Triacylglycerols (TG) TG(18:2_20:5_20:4) 0.60 0.011 TG60:8 0.58 0.018
Conclusions
[0568] The experiment described in this example identified lipids that are modulated, e.g., present in increased or decreased amounts, in FRDA subjects as compared to healthy control subjects. The lipids identified as a result of this experiment may be used as biomarkers to monitor or evaluate effectiveness of frataxin (FXN) replacement therapy.
[0569] The increased amounts of oxidized PCs and epoxy TGs in FRDA subjects as compared to the amounts in healthy subjects are indicative of increased oxidative stress in FRDA subjects.
[0570] The absence of long chain acylcarnitines modulated in FRDA subjects is indicative of minimal perturbations of mitochondrial fatty acid metabolism. The decreased amounts of ether lipids (as precursors of plasmalogens) in FRDA subjects as compared to the amounts in healthy control subjects indicates perturbations in peroxisomal metabolism in FRDA subjects.
[0571] The levels of sphingolipids, such as sphingomyelins (SM) and ceramides (Cer) with very long chain fatty acid (?20) in the sn2 position, are decreased in FRDA subjects as compared to healthy control subjects. Changes in the levels of sphingolipids have been reported in subjects with cardiovascular diseases and heart failure, and are predictive of adverse events (see, e.g., Laaksonen et al., Eur. Heart J. 2016, 37:1967 and Peterson et al., JAHA 2018, 7:e007931).
[0572] Many triacylglycerols (TGs) are increased in FRDA subjects as compared to healthy control subjects. These TGs have fatty acyl moieties with odd or branched chain, which is indicative of dysbiosis or altered lipogenesis.
Example 2. Untargeted Lipidomic Analysis of Serum Samples from a Mouse Model of FRDA
[0573] The goal of this experiment was to determine if one or more lipids are modulated (i.e., levels of lipids are increased or decreased) in a mouse model of FRDA following administration of a frataxin (FXN) replacement therapeutic compound. To this end, plasma samples were collected from mice treated with FXN replacement therapeutic compound or vehicle control, and subjected to lipidomic analysis. The experiments used wild-type mice and FXN knock-out (FXN-KO) mice which represent a mouse model of FRDA. Specifically, the experiment utilized the groups of mice as described in the Table 7 below.
TABLE-US-00011 TABLE 7 Mice and conditions utilized in the experiment No. of female No. of male Group mice mice Wild-type mouse treated with 2 5 vehicle control (WTV) Wild-type mouse treated with 1 2 article (i.e., FXN replacement therapeutic compound) (WTTA) Mutant (i.e., FXN-KO) mouse treated 4 4 with vehicle control (MV) Mutant (i.e., FXN-KO) mouse treated 4 1 with article (i.e., FXN replacement therapeutic compound) (MTA)
Sample Preparation and Analysis
[0574] Lipids were extracted from the collected samples and analyzed according to a validated protocol previously described in J. of Proteome Research 2018, 17(11):3657-3670, the entire contents of which are hereby incorporated herein by reference. Samples were split into 4 aliquots and stored at ?80? C. The lipids in the samples were analyzed by liquid chromatography and mass spectrometry (LC/MS) using a Zorbax Eclipse plus C18 column and a LC-QTOF 6530 Agilent operating in positive and negative modes. The volume of injection was 1 ?L, corresponding to 0.33 ?L of plasma equivalent. Internal standards were spiked into the plasma samples before extraction and monitored during LC/MS analysis. The lipids used as internal standards were PS(12:0/12:0), PC(14:0/14:0), PG(15:0/15:0) and PC(19:0/19:0).
Quality Control
[0575] Internal samples were spiked into the collected plasma samples before extraction and monitored by LC/MS. A plasma QC sample was injected at the beginning, in the middle and at the end of the LC/MS analysis sequence in positive mode and in negative mode for a total of 6 QC run analyses. Table 8 below shows the results of the QC runs for four different internal standards.
TABLE-US-00012 TABLE 8 Results of quality control analyses Samples Positive Mode Negative Mode m/z RT (min) RSD m/z RT (min) RSD PS(12:0/12:0) 624.389 12.23 9.43% 622.372 12.23 13.20% PC(14:0/14:0) 678.508 17.81 7.80% 722.498 17.82 13.90% PG(15:0/15:0) 712.514 18.69 6.24% 693.471 18.7 9.83% PC(19:0/19:0) 818.666 35.87 9.00% 862.654 35.86 7.60%
[0576] The results of the quality control analysis indicate that the internal standards and the QC samples meet the analysis criteria.
Data Processing
[0577] Raw MS data was normalized using cyclic loss algorithm using all MS scan signals measured. Imputation of missing values was done using Knn5. All steps of data processing are described in J. of Proteome Research 2018, 17(11):3657-3670.
Statistical Analysis
[0578] The output text file containing the processed dataset was imported into Mass Professional Pro (MPP: version 12.6.1; Agilent Technologies Inc.) software. A t-test was performed between conditions (WTV, MV, MTA), and a threshold p-value of 0.005 was used. Correction for multiple testing was not considered because of the lack of power in the analysis.
Annotation of Lipids
[0579] First, the resulting list from the data processing was searched in the in-house lipid database APHID, which contains 498 identifications of lipids done using MS/MS with the information on m/z values and retention times for these lipids using the LC-MS method used in the analysis. For the m/z not found in the APHID, a second search was conducted in METLIN, an open-access database which is based only on m/z values. To minimize false positive rate, the search was performed based on the consideration that the highest intensity ions are observed for the lipid (sub)classes as listed in Table 9 below.
TABLE-US-00013 TABLE 9 Lipid subclasses and the corresponding highest intensity ions observed Subclass Ion Positive Ionization Mode diacylglycerophosphocholines (PC) [M + H].sup.+ diacylglycerophosphoethanolamines [M + H].sup.+ (PE) sphingomyelins (SM) [M + H].sup.+ fatty acids (FA) [M + NH.sub.4].sup.+ phosphatidylinosinols (PI) [M + NH.sub.4].sup.+ steryl esters (CE) [M + NH.sub.4].sup.+ or [M + Na].sup.+ glycerolipids (GP) [M + NH.sub.4].sup.+ or [M + Na].sup.+ Negative Ionization fatty acids (FA) [M ? H].sup.? Mode diacylglycerophosphoethanolamines [M ? H].sup.? (PE) diacylglycerophosphoinositols (PI) [M ? H].sup.? diacylglycerophosphocholines (PC) [M + HCOO].sup.? sphingomyelins (SM) [M + HCOO].sup.? Ceramides (Cer) [M + HCOO].sup.?
At this step no MS/MS was done to confirm some identification or to identify acyl chain from TG and PC.
Results
[0580]
[0581]
Comparison of MV Vs. WTV Samples from Female Mice (Effect of Mutation)
[0582] Of all the 2508 features, 356 entities discriminate MV vs. WTV with a p-value <0.05 and a fold change >1.35 between the two conditions. These 356 entities were searched for annotation in APHID and METLIN databases, resulting in 164 annotations. The results of the analyses showing lipids that are modulated in mutant mice as compared to wild-type mice treated with vehicle are presented in Table 10 below and in
TABLE-US-00014 TABLE 10 Lipids that are modulated in FXN-KO mice as compared to WT mice treated with vehicle. # of identified # of identified features that features that are increased are decreased in FXN-KO in FXN-KO Category (Sub)class mice mice Fatty acyls (FA) Fatty acids and conjugates 1 Fatty acylcarnitines 2(2*) Glycerophospholipids Monoacylglycerophosphocholines 6(1*) 3(1*) (GP) (LPC) Monoacylglycerophosphoethanolamines 1 (LPE) Ether Monoacylglycerophosphocholines (LPCO) Diacylglycerophosphocholines (PC) 30(12*) 29(10*) Diacylglycerophosphoethanolamines 2 (PE) Diacylglycerophosphoinositols (PI) 1 12 Ether Diacylglycerophosphocholines 5(1*) 12(2*) (PCO) Phosphatidylethanolamine ethers 7 (PEO) Oxidized Diacylglycerophosphocholines (PC(OH)) Sphingolipids (SP) Sphingomyelins (SM) 1 3(3*) Ceramides (Cer) 5(1*) Oxidized Ceramides (cer(OH)) 1 Neutral glycosphingolipids (Glc-Cer) 1 1 Oxydized glycosphingolipids (Glc- 1 Cer(OH)) Sterols Lipids (ST) Steryls esters (CE) 1 2 Glycerolipids (GP) Diacylglycerols (DG) 1 2(1*) Triacylglycerols (TG) 6 28 Total 56 108 *No. of lipids identified using APHID database
[0583]
[0584]
Comparison of MV vs. MTA samples from female mice (effect of treatment of mutant mice)
[0585] Of all the 2508 features, 167 entities discriminate MTA vs. MV with a p-value <0.05 and a fold change >1.35 between the two conditions. These 167 entities were searched for annotation in APHID and METLIN databases, resulting in 63 annotations. The results of the analyses showing lipids that are modulated in mutant mice treated with FXN replacement therapeutic compound (MTA) as compared to mutant mice treated with vehicle (MV) are presented in Table 11 below and in
TABLE-US-00015 TABLE 11 Lipids that are modulated in FXN-KO mice treated with FXN replacement therapeutic compound as compared to FXN-KO mice treated with vehicle. # of identified # of identified features that features that are increased are decreased in FXN-KO in FXN-KO Category (Sub)class mice mice Fatty acyls (FA) Fatty acids and conjugates 2(1*) 1 Glycerophospholipids Monoacylglycerophosphocholines 2(2*) 1 (GP) (LPC) Monoacylglycerophosphoethanolamines 5(3*) (LPE) Diacylglycerophosphocholines (PC) 3(1*) 3(1*) Diacylglycerophosphoethanolamines 1 (PE) Ether Diacylglycerophosphocholines 1 (PCO) Sphingolipids (SP) Sphingomyelins (SM) 1 Ceramides (Cer) 2(1*) Neutral glycosphingolipids (Glc-Cer) 1 1 Sterols Lipids (ST) Steryls esters (CE) 1 1 Glycerolipids (GP) Diacylglycerols (DG) 1 3 Triacylglycerols (TG) 36 Monoacylglycerols (MG) 1 Total 15 48 *No. of lipids identified using APHID database
[0586]
[0587]
[0588]
[0589] The list of 36 features common for the two comparisons (MTA vs. MV and MV vs. WTV) was screened and 4 features eluting during the dead volume plus 2 entities which were replicate features from a compound already in the list were filtered out. The final list contains 30 features which are listed in Table 12 below. In Table 12, the entity which is decreased in MV samples as compared to the WTV samples (showing the effect of FXN-KO mutation) and decreased in MTA samples as compared to MV samples (showing the effect of treatment of FXN-KO mice with the FXN replacement therapeutic compound) is shown in bold italic. Entities that are increased in MTA samples as compared to the MV samples (showing the effect of FXN-KO mutation) and decreased in MTA samples as compared to MV samples (showing the effect of treatment of FXN-KO mice with FXN replacement therapeutic compound) is shown in bold.
TABLE-US-00016 TABLE 12 Lipids and features that are simultaneously modulated in MTA vs. MV samples and MV vs. WTV samples. [MV] Vs [WTV] [MTA] Vs [MV] Compound FC FC Lipid ID (mass DRT) Adduct p-value (abs) Regulation p-value (abs) Regulation DG(18:1/18:1) pos637.5660@35.11 NH4+ 3.83E?02 1.38 down 2.30E?03 2.03 down unknown neg: 684.5981@36.44 1.00E?02 1.36 down 1.50E?03 1.48 down unknown pos: 1523.2775@49.97 4.33E?02 1.53 down 1.65E?02 2.12 down LPC20:3 pos: 545.3489@8.71 H+ 6.20E?03 1.43 down 6.40E?03 1.41 down unknown pos: 567.3159@6:70 1.89E?02 1.82 down 1.20E?02 1.54 down unknown pos: 589.3738@9.84 1.25E?02 1.62 down 2.27E?02 1.51 down PC(P-34:4) pos: 737.5352@19.05 H+ 1.00E?04 1.56 down 1.20E?03 1.39 down PE(36:0) pos: 747.5733@22.88 H+ 3.00E?04 1.55 down 1.70E?03 1.58 down PC(40:7) pos: 831.5737@25.40 H+ 7.10E?03 1.77 down 4.24E?02 1.39 down TG(50:5) pos: 841.7204@43.58 NH4+ 2.10E?03 2.05 down 1.53E?02 1.9 down TG(51:2) pos: 861.7842@58.38 NH4+ 2.68E?02 2.27 down 1.76E?02 2.95 down unknown pos: 864.6560@46.20 8.70E?03 1.6 down 4.25E?02 1.72 down TG(54:2) pos: 875.7988@62.61 NH4+ 8.20E?03 2.52 down 1.48E?02 2.65 down unknown pos: 876.7925@55.73 2.74E?02 2.03 down 4.32E?02 2.23 down TG(54:7) pos: 893.7427@46.51 NH4+ 1.12E?02 2.48 down 3.50E?02 2.24 down TG(54:8) pos: 896.6927@43.62 Na+ 1.90E?03 1.68 down 1.03E?02 1.97 down TG(56:9) pos: 917.7420@44.32 NH4+ 4.34E?02 2.04 down 4.89E?02 2.03 down TG(56:10) pos: 920.6910@41.88 Na+ 7.30E?03 1.84 down 3.06E?02 1.78 down unknown pos: 938.6841@44.74 1.20E?03 2 down 8.70E?03 1.41 up unknown pos: 278.2241@7.67 6.30E?03 1.72 up 1.51E?02 1.81 down PC(46:6) pos: 917.6898@35.97 H+ 1.65E?02 1.53 up 6.00E?04 1.47 down unknown pos: 948.7571@64.29 8.00E?03 1.39 up 7.80E?03 1.67 down TG(58:7) pos: 949.8111@53.39 NH4+ 4.55E?02 1.55 up 6.80E?03 2 down TG(60:8) pos: 980.7874@57.48 Na+ 2.98E?02 1.35 up 3.20E?02 1.5 down unknown neg: 304.2391@11.76 4.33E?02 1.42 up 1.44E?02 1.4 up unknown pos: 409.3200@6.25 1.82E?02 2.34 up 2.97E?02 1.78 up unknown pos: 676.5400@36.17 1.20E?03 3.07 up 4.54E?02 2.08 up unknown pos: 704.5719@38.02 3.04E?02 2.39 up 2.29E?02 3.01 up PC(40:6) pos: 833.5946@24.98 H+ 7.10E?03 1.44 up 1.10E?03 1.51 up
[0590] The following lipids listed in Table 12 are modulated (increased or decreased) in MV vs. WTV (showing the effect of FXN-KO mutation) and normalize in MTA vs. MV (showing the effect of treatment with the FXN replacement therapeutic compound): pos:278:2241@7.67, PC(46:6), TG(60:8), pos:948.7571@64.29, TG(58:7), pos:938.6841@44.74. Other groups of lipids or features are up or down in MV vs. WTV, but changes are amplified with treatment with the FXN replacement therapeutic compound. This could suggest an adaptive mechanism that is targeted by the treatment.
[0591]
[0592]
[0593] The following lipid subclasses were investigated: triacylglycerols (TG), diacylglycerols (DG), phosphatidylcholines (PC) and lysophospholipids (LCP and LPE).
Triacylglycerols
[0594] The following TGs are increased in FXN-KO mice and decrease following treatment with the FXN replacement therapeutic compound: TG(60:8), TG(59:9), TG (57:7), TG(58:7), TG(58:6), TG(56:9), TG(56:4), TG(54:5), TG(56:5), TG(56:3), TG(53:4), TG(54:2). In general, TGs decrease with the treatment with the FXN replacement therapeutic compound.
Diacylglycerols
[0595] DGs decrease in FXN-KO mice and further decrease with treatment with the FXN replacement therapeutic compound.
Phosphatidylcholines
[0596] The following PCs are modulated in the FXN-KO mice and are normalized following treatment with the FXN replacement therapeutic compound: PC(46:6), PC(41:6) and PC (44:5). However, for most PCs, changes associated with the FXN knockout are not modified or amplified with treatment.
Lysophospholipids
[0597] For most lysophospholipids (LPC and LPE), treatment of FXN-KO mice with the FXN replacement therapeutic compound amplified the changes seen in the FXN-KO mice. Most LPC and LPE increase, except for LPC20:3 and LPC20:5, which decrease. It is noted that lysophospholipids are bioactive molecules, suggesting that treatment with the FXN replacement therapeutic compound is targeting an adaptive mechanism responsible for the formation of these bioactive lipids.
Fold Change Vs. Acyl Chain Length
[0598] The chain length of TGs and PCs that are modulated in the FXN-KO mice and normalize following treatment was investigated. To this end, fold change was plotted versus the number of carbons in the lipids using the list of 523 features.
[0599]
[0600]
[0601] It is noted that very long acyl chains are formed by elongation of commonly found long acyl chain (C16 or palmitate; and C18 or stearate). They can be formed when the mitochondria is unable to oxidize long acyl chain. This could represent a mechanism of adaptation.
[0602]
[0603]
[0604] In contrast to TGs, there is no trend observed for changes in PCs with very long vs. long acyl chains. The majority of PCs which are increased in FXN-KO mice are also increased following treatment with FXN replacement therapeutic compound. Only two PCs two PCs are decreased in FXN-KO mice and are increased following treatment with FXN replacement therapeutic compound, and both have very long chains.
Example 3. Lipidomic Analysis of Samples from FRDA Subjects Treated with FXN Replacement Therapeutic Compound
[0605] The goal of this experiment was to identify lipids that are modulated (i.e., levels of lipids are increased or decreased) in subjects with Friedreich's Ataxia (FRDA) following treatment with FXN replacement therapy. To this end, plasma samples were collected from 27 human subjects with Friedreich's Ataxia (FRDA) who were administered placebo (7 subjects) or different doses of an exemplary FXN replacement therapeutic compound as follows: Group 1 received a dose of 25 mg (5 subjects), Group 2 received a dose of 50 mg (6 subjects) and Group 3 received a dose of 100 mg (7 subjects) of the exemplary FXN replacement therapeutic compound. The lipidomic analysis involved comparing samples from each FRDA patient obtained two days prior to the dose (day ?2) and 15 days after the dose (day 15). The lipidomic analysis also involved comparing samples from each FRDA patient prior to the dose (day ?2) to samples from healthy controls (30 subjects).
[0606] Lipids were extracted from the collected samples and analyzed according to a validated protocol previously described in J. of Proteome Research 2018, 17(11):3657-3670. This is a comprehensive label-free untargeted semi-quantitative high-resolution LC-QTOF-based workflow, which is optimized for coverage of polar and non-polar lipids, as well as resolution of their isomers. It enables measurement of reproducible >1,500 high-quality MS signals or features, defined by mass/charge (m/z) ratio, retention time and signal intensity from 100 ?L of plasma or serum with a single instrument (0.33 ?L of volume equivalent injected).
Instrumentation:
[0607] LC-MS analyses were performed using a high-resolution LC-QTOF 6530 Agilent operating in positive and negative mode. Lipids were eluted on a Zorbax Eclipse plus C18 column.
Sample Preparation
[0608] The samples were randomized and analyzed in batches to control for batch-to-batch variation. Lipids were extracted and analyzed according to the validated protocol described in J. of Proteome Research 2018, 17(11):3657-3670. Samples were split into 4 aliquots, and stored at ?80? C. The volume of the injected sample was 1.4 ?L in positive ionization mode and 2.1 ?L in negative ionization mode, corresponding, respectively, to 0.47 ?L and 0.70 ?L of plasma equivalent. Samples were injected in the same order as batch extraction to allow a better correction.
Quality Controls of Sample Analysis
[0609] Internal standards were spiked into the plasma samples before the extraction, and monitored during LC-MS analysis. A plasma QC sample was injected at the beginning, in the middle and at the end of the LC-MS sequence analysis in positive mode and in negative mode for a total of 5 QC run analysis. Table 13 below lists the results of quality control analyses.
TABLE-US-00017 TABLE 13 Results of quality control analyses Samples Positive mode Negative mode m/z RT (min) RSD Mean m/z RT (min) RSD Mean PS(12:0/12:0) 624.389 12.24 13.30 1758003 622.372 12.25 8.07 1072943 PC(14:0/14:0) 678.508 17.99 11.71 30615704 722.498 18.00 8.00 1991441 PG(15:0/15:0) 712.514 18.67 15.19 510287 693.471 18.68 8.41 1285095 PC(19:0/19:0) 818.666 36.14 14.84 46339181 862.654 36.13 8.85 3533302
[0610] The plasma QC samples (n=5) showed a median relative standard deviation (median RSD) of 17.87% in the positive mode and 11.66% in the negative mode. The internal standards and QC samples met criteria in term of variability and signal intensity.
Data Processing
[0611] Raw data for each ionization mode was processed using the data processing workflow as previously described in J. of Proteome Research 2018, 17(11):3657-3670. Briefly, data processing included the following steps to ensure high quality data.
[0612] 1) Filter of frequency: data was present at least 80% in one condition (example: Group 1 treated with the exemplary FXN replacement therapeutic compound). If a specific lipid was present in 80% of samples from a group in at least one condition, it was included in the analysis; otherwise it was excluded.
[0613] 2) Normalization using cyclic loess algorithm using all MS scan signals present after filtering. This normalization, which is commonly used for microarray data analysis, was selected because it generates good alignment of signals, while allowing some variability in the distributions, and is, therefore, more flexible than other normalization algorithms such as Quantile.
[0614] 3) Imputation of missing values using Knn. This step was found to be crucial to ensure robustness of subsequent statistical analyses, particularly with small datasets. Values are often not missing at random, and missing data can occur for different reasons. For imputation of missing values, we have selected k-nearest neighbor algorithm (k=5), which classifies the data based on similarities measures, and it was previously shown to work best with strongly correlated features, such as lipids.
[0615] 4) Correction for batch of sample preparation (sample lipid extraction). Addition of this step was found to minimize variations due to sample processing, principally at the lipid extraction step. This is attributed to the inherent handling samples on several days by different persons.
[0616] The raw data corrected from positive ionization and negative ionization were merged together, producing a datafile of 3228 features (defined as signal intensity, mass/charge, and retention time).
Statistical Analysis
[0617] A total of 3228 signals (lipid features) remained after data processing, of which ?50% represents potential unique lipids; the remainder are dimers, fragments, adducts, contamination, etc. At this step, those signals (features) are not annotated/identified.
[0618] Exploratory principal component analysis (PCA) was achieved using PC1 vs. PC2 and PC1 vs. PC3 on the ratio data.
[0619] Comparison between samples at day 15 vs. day ?2 was performed using paired t-test on each feature, for each group (dose). A Storey correction was used to estimate the False Discovery Rate (FDR, Q-value) in Group 3. A significant threshold was set at P-value=0.03, corresponding to a Q-value=0.05 for comparison of day 15 vs. day-2 of Group 3. The subjective threshold p-value=0.03 was used then for comparison in each group.
[0620] Pearson correlation was used for correlating frataxin levels and certain lipid classes (triglycerides (TGs) and cholesteryl esters (CEs)). The Pearson correlation corresponds to a linear relationship among the same pairs of variables in the population. A subjective high threshold p-value <0.2 was used to discern a trend among lipids selected.
[0621] Linear regression analysis was used to correlate each feature with frataxin levels. The following criteria were used as subjective threshold: p-value <0.05. Linear regression analysis enables the identification and characterization of relationships among multiple factors. For this analysis only 1 variable was used: frataxin level, so the p-values calculated for this regression analysis were the same as the Pearson correlation analysis. A more stringent threshold was used for this regression analysis because all features (>3000) were included, which is more a discovery-based analysis, compared to Pearson analysis, which was focused only on significant TGs and CEs.
[0622] Network analysis using Fruchterman-Reingold Method was used to determine positive correlation between associated features. Positive correlation between associated features was projected onto a 2-dimensional display using Fruchterman-Reingold layout algorithm (R package igraph: Csardi G, Nepusz T. The igraph software package for complex network research. InterJournal 2006; Complex Systems:1695). A starting point was given to the algorithm as the first two principal component analysis coordinates.
Lipid Annotations
[0623] For lipid annotation, an in-house database was used. The database is composed of more than 450 lipids previously annotated by MS/MS in human plasma, using an algorithm to align mass and retention time. The database is principally composed of phospholipids and sphingolipids with their acyl chains and TGs with the sum of the 3 acyl chains. For the remaining lipids that were not annotated but were determined to be significantly different between day 15 and day ?2, MS/MS analysis was performed to identify the lipid class and acyl chains when it was possible. Since acyl side chain positions were not validated with synthetic standards, phospholipids and glycerolipids were annotated along with the identified structure for the acyl side chains using the underscore convention for sn1 and sn2.
Results
[0624]
Comparison Day 15 vs. Day ?2
[0625] The comparisons are based on the intensity data of day 15 vs. day ?2. A threshold p-value=0.03 was chosen based on the comparison of Group 3 (Paired t-test day 15 vs. day-2), corresponding to a Q-value=0.05. The same threshold was chosen in order to compare the group effect.
[0626]
[0627] The results presented in
[0628]
[0629]
[0630]
[0631]
[0632]
[0633] For Group 3, it was observed that TGs with a total number of acyl chain carbons <56 are decreased following dosing with the exemplary FXN replacement therapeutic compound, and those with a total number of acyl chain carbons ?56 are increased following dosing with the exemplary FXN replacement therapeutic compound.
[0634]
[0635] For Group 3, it was observed that levels of TGs with >7 acyl chain unsaturations are increased following dosing with the exemplary FXN replacement therapeutic compound, while those with a total number of acyl chain unsaturations ?7 are decreased following dosing with the exemplary FXN replacement therapeutic compound.
[0636] The results presented in
[0637]
[0638]
[0639] The results presented in
[0640] Ether phospholipids, e.g., PCO- and PEO-, were found to be decreased in FRDA subjects prior to treatment, as compared to healthy controls, and increased following FXN replacement therapy. Table 14 below presents the results for the selected PCO- species.
TABLE-US-00018 TABLE 14 Levels of selected PCO species in healthy FRDA subjects vs. healthy control subjects and FRDA subjects before and after FXN replacement therapy. FRDA subjects at Day ?2 vs. healthy control subjects* Group 3: Day 15 vs. Day ?2 Lipid Log.sub.2 fold change Log.sub.2 fold change Feature Annotation (FRDA/control) p-value (Day 15/Day ?2) p-value POS: 743.5837@24.22 PC(O-16:0/18:2) ?0.44 1.44E?04 0.57 1.28E?04 POS: 791.5831@23.05 PC(O-16:0/22:6) ?0.60 1.87E?04 0.26 7.85E?03 POS: 771.6142@28.12 PC(O-18:0/18:2) ?0.54 7.67E?07 0.25 3.88E?02 POS: 791.5828@22.01 PC(O-18:1/20:5) ?0.63 1.28E?03 0.38 2.51E?02 POS: 769.5992@24.74 PCO-36:3 ?0.38 7.75E?04 0.37 1.59E?04 NEG: 789.5875@22.26 PCO-34:2 ?0.38 7.25E?04 0.39 5.28E?04 POS: 827.6779@35.56 PCO-40:2 ?0.44 1.72E?02 0.39 1.80E?02 POS: 873.6603@30.96 PCO-44:7 ?0.41 1.48E?02 0.43 3.88E?02 *Lipid features were selected based on the significance of the FRDA subjects vs. control subjects value: p value <0.03; |fold change| >1.25.
[0641] The results presented in Table 14 demonstrate that levels of the PCO- species are decreased in FRDA subjects vs. healthy control subjects and that levels of PCO- species increase in FRDA subjects following administration of FXN replacement therapy.
Pearson Correlations
[0642] Pearson correlations were calculated for each lipid feature with its corresponding p-value in order to correlate levels of lipids, such as TGs and CEs, with frataxin levels measured in the skin, platelets and buccal cells from each subject. A subjective threshold of p-value=0.2 was chosen.
[0643]
[0644] The results presented in
[0645]
[0646]
[0647] The results presented in
[0648] A linear regression analysis using log 2 of levels of frataxin in skin was performed on all features, independent of their significance with respect to the impact of treatment with the exemplary FXN replacement therapeutic compound. The goal of this analysis was to determine if lipids other than TGs and CEs are correlated with frataxin levels in skin.
[0649] The results of the analysis are presented in the in
[0650] The results presented in
[0651]
[0652] The results presented in
[0653] The results presented in
Network Analysis Using Fruchterman-Reingold Method
[0654] The network analysis was conducted using annotated lipids that were shown to be differentially expressed at day 15 vs. day ?2 in subjects who received 100 mg of the exemplary FXN replacement therapeutic compound (Group 3). Positive correlation (R>0.6) between day vs. day ?2 associated features was projected onto a 2-dimensional display using Fruchterman-Reingold layout algorithm.
[0655]
[0656] The results presented in
[0657]
[0658] The results presented in
Conclusions
[0659] The results of Example 3 indicate that TGs with acyl chain length <56 carbons are decreased and TGs with acyl chain length ?56 are increased at day 15 vs day ?2 in subjects treated with 100 mg of the exemplary FXN replacement therapeutic compound (Group 3). Complete annotation using MS/MS of acyl chains in TGs with acyl chain length ?56 carbons reveals that they all contain a C22:5 or C20:5. The pattern of TG remodeling observed for subjects in Group 3 is consistent with their correlation with frataxin levels in skin.
[0660] Cholesteryl esters (CEs) follow a pattern of changes similar to those of TGs with acyl chain length >56. Accordingly, CEs and TGs belong to the same correlation cluster (R>0.6). Among CEs, CE 16:0 and CE 20:5 are also correlated positively with frataxin levels in skin, but above the threshold p-value (p=0.054 and 0.099 respectively).
[0661] Ether phospholipids, e.g., PCO- and PEO-, were found to be decreased in FRDA subjects as compared to healthy controls, and increased following FXN replacement therapy.
[0662] Phosphatidylcholines (PC) with acyl chains containing 12 or 14 carbons (i.e., medium chain length fatty acids) were found to be correlated negatively with frataxin levels in skin and TGs with acyl chain length <56 carbons. Some of PCs show a significant decrease between day vs. day-2 in Group 3.
[0663] Phosphatidylcholine ethers were found to be increased at day 15 vs. day ?2 for Group 3. This is especially evident for PC(O-17:0/20:4), which correlated positively with frataxin levels in skin and showed strong correlation (R>0.6) with TGs with acyl chain length ?56 carbons, phosphatidylethanolamine ethers (PEO-), and CEs. Some PC ethers are also affected in the placebo group, but not PC(O-17:0/20:4).
[0664] Lysophosphatidylcholines (LPCs), mostly with a saturated fatty acyl chains, were found to be negatively associated with frataxin levels in skin.
[0665] Acylcarnitines (ACs), specifically long chain ACs, were found also to be negatively associated with frataxin levels in skin.
[0666] Altogether, the observed correlations (positive or negative) between the aforementioned changes in circulating lipid subclasses with frataxin levels in skin in subjects following treatment with the exemplary FXN replacement therapeutic compound support a role of frataxin in mediating the reported changes in the circulating levels of these lipid subclasses.
[0667] Given that the systemic lipid changes observed can be explained by a limited number of correlation clusters of lipids or group of lipids, it can be proposed that they could potentially be summarized by a composite global score that remains to be defined, which would likely reflect a limited number of different metabolic mechanisms modulated by frataxin. For example, TG acyl chain remodeling, specifically a shift from TGs with acyl chain length ?56 carbons (highly unsaturated) to TGs with acyl chain length <56 carbons (mostly saturated), has been reported in humans and linked to insulin resistance (see Rhee et al., J. Clin. Invest. 2018, 121:1402). TGs with acyl chain length <56 carbons include acyl chains that are predominantly saturated fatty acids, such as lauric acid (C12:0), myristic acid (C14:0), palmitic acid (C16:0), stearic acid (C18:0) and oleic acid (C18:1). This reflects de novo lipogenesis, most likely predominantly in liver, but the involvement of other tissues is not excluded. Enhanced de novo lipogenesis in FRDA patients is also supported by the presence of PCs with saturated medium length chain fatty acids (12 and 14 carbons) in the same correlation clusters as TGs with acyl chain length <56 carbons.
[0668] Circulating levels of long chain ACs are recognized proxies of defects in mitochondrial fatty acid oxidation (Review: McCoin et al., Nat. Rev. Endocrinol. 2015, 11:617).
[0669] The aforementioned metabolic mechanisms (mitochondrial metabolic dysfunction, enhanced lipogenesis and insulin resistance) concur with the reported metabolic perturbations resulting from frataxin deficiency in in a mouse model Friedreich's ataxia (FRDA; Turchi et al., Cell Death and Disease 2020, 11:51). Furthermore, the metabolic mechanisms are also consistent with the reported metabolic reprogramming of mammalian cells following acute loss of iron-sulfur clusters, which are essential parts of several mitochondrial enzymes, including mitochondrial respiratory chain complexes and aconitase, whose mitochondrial synthesis is governed by frataxin (Crooks et al., J. Biol. Chem. 2018, 293(21):8297).
Example 4. Lipidomic Analysis of Samples from FRDA Subjects Treated with FXN Replacement Therapeutic Compound and Healthy Volunteers
[0670] The goal of this experiment was: a) assess the difference in baseline levels of select lipid subclasses between untreated FRDA subjects and healthy volunteers; b) analyze a second aliquot of the samples used in the experiment described in Example 3 in order to determine reproducibility of results described in Example 3; and c) assess the impact of treatment by comparing lipid levels in FRDA subjects at baseline (Day ?2) and at Day 15, and the impact of disease by comparing lipid levels at baseline (Day ?2) in FRDA subjects and healthy volunteers.
Methods
[0671] The validation of the metabolomics platform lipidomic workflow used in the experiment was previously reported for 48 replicates of a single human plasma sample (Forest et al., J. of Proteome Research 2018, 17(11):3657-3670). This is a comprehensive, label-free, untargeted, semi-quantitative, high-resolution liquid chromatography (LC) quadrupole time-of-flight-(QTOF) based workflow optimized for coverage of polar and nonpolar lipids, as well as resolution of their isomers. It enables measurement of reproducible >1500 high-quality mass spectrometry (MS) signals or features, defined by mass/charge (m/z) ratio, retention time (RT), and signal intensity from 100 ?L of plasma or serum with a single instrument (0.33 ?L of volume equivalent injected).
[0672] MS signal intensity spanned 4 orders of magnitude for 92% of these features and had a relative standard deviation (RSD)<30% inside their linear intensity range. Half of the features were reported to be redundant due to adducts, dimers, in-source fragmentation, contaminations, or positive and negative ion duplicates. To date, 509 structurally unique lipid molecular species covering 25 lipid subclasses have been annotated by tandem mass spectrometry (MS/MS) analyses across different studies in human plasma in the MHI in-house database. Median inter- and intra-assay coefficients of variations (or RSD) for the resulting annotated lipids meet the upper criteria tolerated by the Food and Drug Administration (i.e., >80% lipid with RSD <20%) thereby enabling robust semi-quantitation.
[0673] Cohorts and dosing regimen of the exemplary FXN replacement therapeutic compound for the subjects involved in the study are shown in Table 15 below.
TABLE-US-00019 TABLE 15 Cohorts and Dosing Regimen Dose Subjects Cohort (mg) (n) Dosing Regimen 1 25 6 Once daily Days 1 through 4; Placebo 2 every third day until Day 13 2 50 7 Once daily Days 1 through 7; Placebo 2 every other day until Day 13 3 100 7 Once daily Days 1 through 13 Placebo 3 NA 31.sup.b Non-interventional study; samples collected from healthy volunteers at T.sub.0 NA 31.sup.b Non-interventional study; samples collected from healthy volunteers at T.sub.3 = 3-hour time point
Instrumentation
[0674] LC-MS/MS analyses were done using a high-resolution LC-QTOF 6550 Agilent operating in positive and negative mode. Lipids were eluted on a Zorbax Eclipse plus C18 column.
Sample Preparation
[0675] Plasma samples collected from FRDA subjects described in Example 3 and healthy volunteers were randomized. Lipids were extracted and analyzed according to the workflow described above. Each sample extract was split into 4 aliquots, and stored at ?80? C. Samples were analyzed at injection volumes of 1 ?L in positive ionization mode and 2 ?L in negative ionization mode, corresponding to 0.33 ?L and 0.67 ?L, respectively, of plasma equivalent. Samples were injected in the same order as batch extraction to allow a better correction.
Quality Controls of Sample Analysis
[0676] Internal standards (IS) were spiked into human plasma to prepare IS quality control (QC) samples before extraction. These IS QC samples were extracted and monitored at the beginning, middle, and end of the LC-MS analysis. A pooled plasma QC sample was also extracted and monitored as plasma QC. Both IS QC and plasma QC samples were injected during LC-MS analysis in positive mode and in negative mode (Table 16 and Table 17). The plasma QC samples correspond to human plasma samples from control subjects (healthy volunteers from MHI MAPoM project) collected using the same procedure and stored in aliquots at ?80? C. The plasma QC sample results are presented for the raw data, corresponding to the original intensities value for features present in 80% of the samples, and for the corrected data, corresponding to correction of intensity data by normalization including imputation of missing values.
TABLE-US-00020 TABLE 16 Internal Standard QC Variability in Study Samples Ionization Mode Positive Negative Internal Standard m/z RT (min) RSD (%) Mean m/z RT (min) RSD (%) Mean PS (12:0/12:0) 624.389 12.00 15.78 1758003 622.372 10.14 15.09 3380673 PC (14:0/14:0) 678.508 17.30 11.71 30615704 722.498 15.38 15.44 2685887 PG (15:0/15:0) 712.514 18.01 13.06 510287 693.471 16.07 16.45 838241 PC (19:0/19:0) 818.666 35.37 18.72 46339181 862.654 33.37 14.91 3908792 Abbreviations: min = minutes; m/z = mass/charge; PC = phosphatidylcholine; PG = phosphatidylglycerol; PS = phosphatidylserine; QC = quality control; RSD = relative standard deviation; RT = retention time.
TABLE-US-00021 TABLE 17 Plasma QC Samples Variability Results Ionization Mode Positive Negative (n = 11) (n = 8).sup.a Median RSD Raw Data 14.77% 18.26% Data Corrected 13.63% 11.17% Total number of features 2427 520 Total number of features 2115 471 with RSD <30% Abbreviations: QC = quality control; RSD = relative standard deviation. .sup.aOne QC analyzed in negative mode was lost (the third QC). For an unknown reason, no signal was acquired.
[0677] IS corrected for signal intensities had a median RSD <20%. Plasma QC samples met the variability criteria for the corrected data (median RSD <15%) and signal intensity (represented by the number of features detected with an RSD <30% in human plasma in 80% of samples >1300 in positive ionization mode and >350 in negative ionization mode).
Data Processing
[0678] The raw data from each ionization mode were analyzed per the published data processing workflow (Forest et al., J. of Proteome Research 2018, 17(11):3657-3670).
[0679] A brief summary of the data processing is as follows: [0680] Filter of frequency: data should be present in at least 80% in one group. This criterion was used to select only features with the highest intensity. [0681] Normalization using cyclic loess algorithm using all MS scan signals present after filtering: cyclic loess normalization, commonly used for microarray data analysis, was selected among others as part of the validation method because it generates good alignment of signals, while allowing some variability in distribution, and thus, was more flexible than other algorithms such as quantile normalization. [0682] Imputation of missing values using k-nearest neighbor (KNN) algorithm: this step was crucial to ensure robustness of subsequent statistical analyses, particularly with small datasets. Values are often not missing at random, and missing data can occur for different reasons. For imputation of missing values, the KNN algorithm (k=5), which classifies data based on similar measurements, was selected as it was previously shown to work best with strongly correlated features, such as lipids. [0683] Correction for batch of sample preparation (sample lipid extraction) using the COMBAT algorithm: this step minimized variations due to sample processing, principally at the lipid extraction step, that were attributed to the inherent handling of samples across several days by different persons. [0684] Filter of variation: RSD <80% was applied to corrected intensity data.
[0685] Following data processing, corrected raw data from positive and negative ionization for the entire experiment were merged together, resulting in a datafile of 3646 lipid features (defined by MS signal intensity, m/z, and RT).
Statistical Analysis
[0686] A total of 3646 lipid features (defined by MS signal intensity, m/z, and RT) remained after data processing, of which approximately 50% represented potential unique lipids. The remainder were dimers, fragments, adducts, contamination, etc. This corrected dataset was used for all statistical analyses described below, which were conducted on corrected MS signal intensity expressed in log 2.
Comparison Between Groups
[0687] FRDA subjects vs. healthy volunteers: linear regression analysis was done on each lipid feature, adjusted for age and sex, for the entire dataset of 3646 lipid features for FRDA subjects who were administered an exemplary FXN replacement therapeutic compound and healthy volunteers at Baseline (Day ?2). A Storey correction was applied to estimate the false discovery rate (FDR, Q-value). Significance was set at a p-value <0.03, corresponding to a Q-value <0.14, and absolute fold-change >1.25. Lipid features were not annotated/identified at this step. The 95% confidence interval (CI) was also calculated for each feature fold-change between FRDA subjects and healthy volunteers.
[0688] Day 15 vs Day ?2 for each of the 3 cohorts of FRDA subjects (i.e., subjects who were administered 25 mg, 50 mg or 100 mg of the exemplary FXN replacement therapeutic compound): a comparison between the MS signal intensity (log 2) for Day 15 vs Day ?2 for all 3646 lipid features was performed using a paired t-test on each feature for each cohort. A Storey correction was applied to estimate the FDR (Q-value) in Cohorts 3 (i.e., subjects who were dosed with 100 mg of the exemplary FXN replacement therapeutic compound). Significance was set at a p-value <0.03, corresponding to a Q-value <0.08, for comparison of Day 15 vs Day ?2 for Cohort 3. A subjective p-value was set at 0.03 for comparison in Cohorts 1 and 2. The 95% CI was also calculated for each feature fold-change between Day 15 vs Day ?2 in each dose cohort individually, and 90% CI on fold-change of the results of this Example 4 vs. the results of Example 3 Day 15/Day ?2 ratio for each FRDA patient for the reproducibility analysis of signal intensities.
Correlation Analysis
[0689] Reproducibility of results from the MAD study (MAD1 vs MAD2): Pearson correlation was done between the MS signal intensity (log 2) of lipid features aligned between MAD2 and previously obtained results from MAD1 study to assess reproducibility of results between the 2 studies.
[0690] Network analysis was performed using the Fruchterman-Reingold layout algorithm on selected lipids. Positive correlations between selected lipid features or annotated unique lipids were projected onto a 2-dimensional display. A starting point was given to the algorithm as the first 2 principal component analysis coordinates.
Lipid Annotations
[0691] Lipid annotation was performed using a proprietory database composed of more than 509 lipids previously annotated by MS/MS in human plasma and an algorithm to align mass and RT. This database is principally composed of glycerophospholipids and sphingolipids with their acyl chains and TGs with the sum of the 3 acyl chains. For the remaining lipids that were not annotated using the proprietory database, but were significantly different for the comparisons in this report, MS/MS analysis was performed to identify the lipid class and acyl chains when possible. Because acyl side chain positions were not validated with synthetic standards, phospholipids and glycerolipids were annotated along with the identified structure for the acyl side chains using the underscore convention for sn1 and sn2 positions.
[0692] Abbreviations for all lipid subclasses mentioned in this report are defined in Table 18.
TABLE-US-00022 TABLE 18 Lipid Subclass Abbreviations Abbreviation Lipid Subclass AC acylcarnitine CE cholesteryl ester Cer ceramide DG diglyceride Epoxy-TG epoxy triglyceride FFA free fatty acid Glc-Cer glucosyl ceramide LPC lysophosphatidylcholine LPE lysophosphatidylethanolamine PA phosphatidic acid PC phosphatidylcholine PCO ether phosphatidylcholine PC(OH) oxidized phosphatidylcholine PE phosphatidylethanolamine PEO ether phosphatidylethanolamine PI phosphatidylinositol SE steryl ester SM sphingomyelin TG triglyceride
[0693] For each subject with FRDA who was administered an exemplary FXN replacement therapeutic compound, samples were collected at Baseline (Day ?2) and at Day 15. For each healthy volunteer, samples were collected from each subject at 2 time points, T.sub.0 and T.sub.3. All samples were analyzed by LC-MS/MS. Samples were injected into the LC-MS in the numeric order of MHI identification (ID).
Results
Assess the Differences in Baseline Levels of Select Lipid Subclasses Between Untreated FRDA Subjects and Healthy Volunteers
[0694] Comparisons were made between samples collected at Baseline (Day ?2) for FRDA subjects (n=27) and T.sub.0 for healthy volunteers (n=29). Comparisons were made based on the final corrected datasets, which included 3646 lipid features. A threshold p-value of 0.03 was chosen based on the comparison of Cohort 3 (paired t test Day 15 vs Day ?2, Objective 2), corresponding to a Q value of 0.14.
Comparison of Plasma Lipid Features in Untreated FRDA Subjects vs. Healthy Volunteers
[0695] Of the 3646 lipid features, 390 discriminated FRDA subjects from healthy volunteers (p value <0.03, Q value <0.14, absolute fold change >1.25). Of these 390 significant features, 189 were annotated to a lipid ID. In total, 308 features (143 annotated) were higher and 82 features (46 annotated) were lower in FRDA subjects vs. healthy volunteers. The lipid subclasses with the highest number of annotated features were TGs, PCO-, and phosphatidylcholines (PCs).
[0696]
Triglycerides (TGs)
[0697] Overall, TGs had the greatest number of significant features. A total of 101 TG features were upregulated and 1 TG feature was downregulated between FRDA subjects and healthy volunteers (see
[0698] The number of unique TGs was obtained by removing duplicate signals from different adducts pertaining to corresponding significant TG features. This resulted in 61 unique TG species (p value <0.03, absolute fold change >1.25).
[0699] TG acyl chains were identified by MS/MS. Data are presented as the fold-change in MS signal intensity between FRDA subjects and healthy volunteers for the 61 significant unique TGs according to the structure of their acyl chain length, namely the number of carbons (
[0700] With the exception of TG58:6, the plasma levels of unique TGs, irrespective of the composition of their acyl chains, were higher in subjects with FRDA, as compared to healthy volunteers. The unique TGs that were upregulated in subjects with FRDA included TG48:1, TG48:2, TG48:3, TG49:1, TG49:2, TG49:3, TG50:1, TG50:2, TG50:3, TG50:4, TG50:5, TG51:1, TG51:2, TG51:3, TG51:4, TG52:2, TG52:3, TG52:4, TG52:5, TG52:6, TG53:2, TG53:3, TG53:4, TG53:5, TG54:4, TG54:5, TG54:6, TG56:4, TG56:5, TG56:6, TG56:7, TG56:8, TG56:9, TG58:5, TG58:7 and TG58:8. TG58:6 was the only TG species for which both the number of carbons (58) and unsaturations (6) in its acyl chain was higher in healthy volunteers than in subjects with FRDA.
Ether Phosphatidylcholines (PCO-)
[0701] As shown in
[0702] Acyl chain compositions for these unique lipid species were identified by MS/MS. Plasma levels of all PCO- species, irrespective of the composition of their acyl chain, were lower in subjects with FRDA compared to healthy volunteers. The 20 annotated unique PCO- lipid species that were downregulated in untreated FRDA subjects included: PC(O-16:0/14:0), PC(O-16:0/18:2), PC(O-16:0/20:4), PC(O-16:0/22:6), PC(O-18:0/18:1), PC(O-18:0/18:2), PC(O-18:0/22:6), PC(O-18:1/18:2), PC(O-18:1/20:4), PC(O-18:1/20:5), PC(O-18:1/22:6), PC(O-(20:0/22:6), PC(O-20:1/22.6), PC(O-22:1/22:6), PC(O-(24:1/22:6), PC(O-16:0/20:3), PCO-38:3, PCO-40:2, PCO-40:6 and PCO-46:8.
Phosphatidylcholines (PCs)
[0703] As shown in
[0704] Acyl chain compositions for these unique lipid species were identified by MS/MS. Plasma levels of most (14 out of 18) of the significant unique PC species were higher in subjects with FRDA compared to healthy volunteers. The 14 unique PC species that are upregulated in subjects with FRDA include PC(15:0/20:3), PC(16:0/22:4), PC(16:1/16:0), PC (16:1/20:4), PC(16:1/22:5), PC(17:0/20:5), PC(18:0/20:3), PC(18:0/22:4), PC(18:1/20:3), PC(18:2/18:2), PC(20:4/15:0), PC(40:6)(a), PC(40:6)(b) and PC(42:7). The 4 unique PC specs that are downregulated in subjects with FRDA include PC(17:1/20:4), PC(18:1/24:1), PC(18:2/20:5) and PC(20:4/20:0). The results indicate that changes in these lipid species may depend on their acyl chain composition.
Network Analysis
[0705] Because high dimensional lipidomic data are expected to have a correlation structure, this was assessed for all 133 unique annotated lipids that were significant for the subjects with FRDA vs. healthy volunteer comparison (p-value <0.03; absolute fold-change >1.25,
[0706]
[0707] Of the 133 annotated lipids significantly and differentially expressed in subjects with FRDA vs. healthy volunteers, all were highly correlated. There were 3 major independent correlation clusters or networks (groups of strongly correlated lipids) that demonstrated the difference between subjects with FRDA and healthy volunteers, likely reflecting a limited number of underlying mechanisms. One of these major correlation clusters (Cluster A) included all TGs that were higher in subjects with FRDA except TG58:6, which was lower in subjects with FRDA. The 2 other clusters (Cluster B and Cluster C) included PCO- species that differed according to their acyl chain composition: chain length ?38C and number of unsaturations ?3 (Cluster B), or chain length ?38C and number of unsaturations ?4 (Cluster C). Cluster C included TG58:6, which is lower in subjects with FRDA and contains both a high number of carbons and unsaturations. The chemical structure of the 3 acyl chains could not be identified by MS/MS.
Conclusions for the Analysis of Samples from Untreated FRDA Subjects Vs. Healthy Volunteers
[0708] The analysis of samples from untreated FRDA subjects vs. healthy volunteers reveals major perturbations in the plasma lipidome of untreated subjects with FRDA vs healthy volunteers (390/3646, or 11% of all lipid features in the dataset). The lipid subclasses with the highest number of annotated features were TGs, PCO-, and PCs.
[0709] TGs showed the highest number of lipid features modulated by FRDA, encompassing 102 (26%) of the 390 identified lipid features and corresponding to 61 unique lipids. Levels of most TG species (with the exception of TG58:6) were elevated in subjects with FRDA as compared to healthy volunteers, contained ?58 carbons in their acyl chains, and were highly correlated in 1 cluster as revealed by network analysis.
[0710] PCO- represented 25 (6.4%) of all lipid features modulated by FRDA. Levels of all PCO- species were decreased in subjects with FRDA as compared to healthy volunteers and were associated with 2 correlation clusters, which differed according to the number of carbons and unsaturations. The cluster with PCO- species with a high number of carbons and unsaturations included TG58:6.
Reproducibility of Results Between Example 3 and Example 4
[0711] PCs represented 19 (4.8%) of all lipid features modulated by FRDA. The majority (15/19) of PCs were higher in subjects with FRDA.
[0712] Observed changes in plasma lipids in subjects with FRDA are consistent with the proposed metabolic consequences of FXN deficiency in mitochondria (Crooks et al., J Biol Chem. 2018, 293(21):8297-8311). Specifically, the observed changed included increased de novo lipid synthesis as evidenced by the higher levels in TGs with <58 carbons and low unsaturations. These changes also suggest additional consequences on lipid metabolism in peroxisomes, as evidenced by the lower plasma levels of PCO-.
Assessment of the Reproducibility of Results of Example 3
[0713] This example (Example 4) used the same samples from FRDA subjects dosed with an exemplary FXN replacement therapeutic compound for lipid analysis as the samples used in Example 3. One of the goals of this experiment was to determine reproducibility of the results obtained in Example 3.
Methods and Results
[0714] Since this experiment used an untargeted approach, not all lipid features of the datasets were annotated. Features of interest were selected based on a significance threshold, and therefore datasets analyzed at different times may have different sets of annotated features (although subclasses may be the same). In order to compare signal intensities of the 2 untargeted lipidomic analyses, both datasets were aligned to ensure that the same lipid features were being compared.
[0715] The alignment of the 2 datasets from Example 3 and Example 4 was done on a subset of lipid features. The following 2 datasets were compared: (a) final corrected dataset with 3228 MS signals (lipid features) from Example 3; and (b) final corrected dataset with 3646 MS signals (lipid features) from this example (Example 4).
[0716] To align the Example 3 and Example 4 datasets, from the annotated features from Example 3, 593 features were selected from positive ionization since they covered all subclasses annotated in this dataset. Example 3 and Example 4 datasets were aligned to an in-house database using an in-house digital tool that enables RT correction between 2 LC-MS analyses. To include more lipids, data alignment was then completed manually using chromatograms. Overall, 192 annotated lipid features (188 unique lipids) were aligned in both datasets, which corresponded to 43% of unique lipid annotations for the Example 3 dataset and 42% for the Example 4 dataset.
[0717] The comparison of signal intensity values between the aligned Example 3 and Example 4 datasets was achieved using ratios of signal intensity values for Day 15 vs Day ?2 in each subject. Comparison was done on signal intensity ratios based on the premise that if the analysis is reproducible, these ratios should be similar for Example 3 and Example 4. Signal intensity ratios were compared because absolute signal intensity values could be different between the 2 studies analyzed 7 months apart due to instrument sensitivity fluctuations. Each dataset was processed for correction and normalization independently.
[0718] The log 2 fold change between Example 3 and Example 4 datasets was calculated using the Day 15/Day ?2 ratio. CI of 90% for each of the 192 annotated and aligned lipid features were also calculated. A given lipid was considered reproducible if the fold change and CI were within the threshold of fold change >0.8 and fold change <1.25. Overall, 169 lipid features (88%) were within the 90% CI threshold.
[0719] The 192 annotated and aligned lipid features were then restricted to include only lipid features that were significant (p<0.03) for Day 15 vs Day ?2 in Cohort 3 (i.e., FRDA subjects who were administered 100 mg of the exemplary FXN replacement therapeutic compound). This resulted in 65 total lipid features and 56 lipid features (86%) within the 90% CI threshold.
[0720] Pearson correlations were calculated on normalized MS signal intensities (log 2) for each subject for the 192 annotated and aligned lipid features. In total, 146 lipid features (76%) were correlated between Example 3 and Example 4 (R>0.7), and 187 lipid features (97%) had a p value <0.01.
[0721] Linearity curves were plotted for selected lipid features and overall showed good reproducibility.
[0722] The comparison of Day 15 vs Day ?2 for Cohort 3 was based on a discovery approach where a selected statistical significance threshold was applied independently on each dataset to identify lipid features that significantly discriminated the 2 time points.
[0723] From the 3228 lipid features in the Example 3 dataset, 452 features discriminated Day 15 vs Day 2 (p-value <0.03, Q-value <0.08, absolute fold change >1.25). Of these 452 features, 157 were annotated to a lipid ID. In total, 199 lipid features (44 annotated) were higher and 253 features (113 annotated) were lower at Day 15 vs Day ?2.
[0724] From the 3646 lipid features in the Example 4 dataset, 227 features discriminated Day 15 vs Day 2 (p-value <0.03, Q-value <0.15, absolute fold change >1.25). Of these 227 features, 80 were annotated to a lipid ID. In total, 79 lipid features (17 annotated) were higher and 148 lipid features (63 annotated) were lower at Day 15 vs Day ?2 (
[0725] Overall, results demonstrated the same trends in both studies: TGs were predominantly downregulated and PCO- were predominantly upregulated. TGs with a high number of unsaturations were greater in Example 3 dataset (10 TGs) as compared to Example 4 dataset (3 TGs). However, although these lipids were below the selected thresholds chosen for the discovery approach (p value <0.03, absolute fold change >1.25), they followed the same trend in Example 3 and Example 4.
[0726] From the 192 lipid features (188 unique lipids) aligned between both datasets, those that were significant in Example 3 dataset (p-value <0.03, absolute fold-change >1.25) were selected for the comparison of Day 15 vs Day ?2 in Cohort 3, resulting in 44 lipid features (43 unique lipids). Of the 43 unique lipids, 29 (67%) met the selected thresholds of reproducibility.
[0727] From the 192 lipid features (188 unique lipids) aligned between both datasets, those that were significant in Example 3 dataset (p-value <0.03, absolute fold change >1.25) were selected for the comparison of Day 15 vs Day ?2 in Cohort 2, resulting in 13 lipid features (13 unique lipids). Of the 13 unique lipids, 6 (46%) met the selected thresholds of reproducibility.
[0728] From the 192 lipid features (188 unique lipids) aligned between both datasets, those that were significant in Example 3 dataset (p-value <0.03, absolute fold change >1.25) were selected for the comparison of Day 15 vs Day ?2 in Cohort 1, resulting in 18 lipid features (18 unique lipids). Of the 18 unique lipids, 12 (67%), met the selected thresholds of reproducibility.
Conclusions
[0729] Overall, there was good reproducibility between the Example 3 and Example 4 datasets based on comparative analyses using different statistical approaches, considering all lipid features aligned between the datasets and those that were significant after treatment.
Assessment of the Impact of on Lipid Profiles of FXN Deficiency and Treatment with an Exemplary FXN Replacement Therapeutic Compound
[0730] Comparisons were made using the dataset from this example only, since all samples from subjects with FRDA at baseline and after treatment with an exemplary FXN replacement therapeutic compound or placebo and healthy volunteers were injected simultaneously. This enabled comparison between data from the different groups.
[0731] The 29 unique lipids identified as a result of comparison between Example 3 and Example 4 datasets that met the selected thresholds of reproducibility were compared as follows: (a) lipids were compared at Day 15 vs. Day ?2 in Cohort 3 to determine impact of treatment; and (b) Day ?2 in Cohort 3 vs. To in healthy volunteers to determine impact of disease. These results are presented in
[0732] In
[0733] Of the 29 unique lipids, 17 (59%) showed significant changes (p-value <0.05) in opposite directions for the 2 comparisons (indicated by * in
[0734]
Conclusions
[0735] Among the 29 unique lipids that met selected thresholds of reproducibility and were significantly modulated in both Example 3 and Example 4, 17 (69%), predominantly TG and PCO- species, showed changes that were opposite for the impact of FRDA vs. treatment with an exemplary FXN replacement therapeutic compound, consistent with a return towards the profiles of healthy individuals.