IMMUNOGENIC COMPOSITIONS COMPRISING SBI PROTEIN AND USES THEREOF

20190282683 ยท 2019-09-19

Assignee

Inventors

Cpc classification

International classification

Abstract

The invention relates to methods and compositions for use in stimulating an immune response against a target antigen. More specifically, it relates to use of domains III and IV of the Staphylococcal Sbi protein as an immunological adjuvant, for enhancing an immune response against a target antigen.

Claims

1. A complement-activating moiety comprising Sbi-III-IV for use as an immunological adjuvant.

2. A complement-activating moiety comprising Sbi-III-IV for use in a method of enhancing an immune response in a subject against a target antigen, wherein said complement-activating moiety is administered to a subject in conjunction with the target antigen.

3. A complement-activating moiety for use according to claim 2 wherein the target antigen is a peptide antigen.

4. A complement-activating moiety for use according to claim 2 wherein the target antigen comprises a carbohydrate, saccharide, polysaccharide, lipid or lipopolysaccharide.

5. A complement-activating moiety for use according to any one of claims 2 to 4 wherein the target antigen is admixed with the complement-activating moiety.

6. A complement-activating moiety for use according to claim 2 or claim 3 wherein the target antigen is covalently linked to the complement-activating moiety.

7. A complement-activating moiety for use according to claim 6 wherein the target antigen forms a fusion protein with the complement-activating moiety.

8. A complement-activating moiety for use according to claim 4 wherein the target antigen is covalently linked to a carrier peptide.

9. A method of enhancing the immunogenicity of a target antigen, comprising contacting the target antigen in vitro or ex vivo with complement and a complement-activating moiety comprising Sbi-III-IV to yield an opsonised target antigen.

10. A method according to claim 9, further comprising the step of isolating the opsonised target antigen from other complement components and/or the complement activating moiety.

11. A method according to claim 9 or claim 10, further comprising the step of formulating the opsonised target antigen for administration to a subject.

12. A method according to claim 9 or claim 10 further comprising administering the target antigen to a subject.

13. A composition comprising an opsonised target antigen for use in a method of stimulating an immune response against the target antigen, wherein the target antigen has previously been contacted in vitro or ex vivo with complement and a complement-activating moiety comprising Sbi-III-IV.

14. A complement-activating moiety for use according to any one of claims 2 to 8, a method according to any one of claims 10 to 12, or a composition for use according to claim 13, wherein the target antigen is derived from an infectious organism.

15. A complement-activating moiety for use, a method, or a composition for use, according to claim 14, wherein the infectious organism is a bacterium, fungal cell, virus, protozoan, helminth or fluke.

16. A complement-activating moiety for use, a method, or a composition for use, according to claim 15, wherein the bacterium is: Actinomyces (e.g. Actinomyces israelii); Bacillus (e.g. Bacillus anthracis, Bacillus cereus); Bacteroides (e.g. Bacteroides fragilis); Bartonella (e.g. Bartonella henselae, Bartonella quintana); Bordetella (e.g. Bordetella pertussis); Borrelia (e.g. Borrelia burgdorferi, Borrelia garinii, Borrelia afzelii, Borrelia recurrentis); Brucella (e.g. Brucella abortus, Brucella canis, Brucella melitensis, Brucella suis); Campylobacter (e.g. Campylobacter jejuni); Chlamydia and Chlamydophila (e.g. Chlamydia pneumoniae Chlamydia trachomatis Chlamydophila psittaci); Clostridium (e.g. Clostridium botulinum, Clostridium difficile, Clostridium perfringens Clostridium tetani); Corynebacterium (e.g. Corynebacterium diphtheriae); Cryptococcus (e.g. Cryptococcus neoformans); Ehrlichia (e.g. Ehrlichia canis, Ehrlichia chaffensis); Enterococcus (e.g. Enterococcus faecalis, Enterococcus faecium); Escherichia (e.g. Escherichia coli); Francisella (e.g. Francisella tularensis); Haemophilus (e.g. Haemophilus influenzae); Helicobacter (e.g. Helicobacter pylori); Klebsiella (e.g. Klebsiella pneumoniae); Legionella (e.g. Legionella pneumophila); Leptospira (e.g. Leptospira interrogans, Leptospira santarosai, Leptospira weilii, Leptospira noguchii); Listeria (e.g. Listeria monocytogenes); Mycobacterium (e.g. Mycobacterium leprae, Mycobacterium tuberculosis, Mycobacterium ulcerans); Mycoplasma (e.g. Mycoplasma pneumoniae); Neisseria (e.g. Neisseria gonorrhoeae, Neisseria meningitidis); Nocardia (e.g. Nocardia asteroides); Pseudomonas (e.g. Pseudomonas aeruginosa); Rickettsia (e.g. Rickettsia rickettsii); Salmonella (e.g. Salmonella typhi, Salmonella typhimurium, Salmonella enterica); Shigella (e.g. Shigella sonnei, Shigella dysenteriae; Shigella flexneri); Staphylococcus (e.g. Staphylococcus aureus, Staphylococcus epidermidis, Staphylococcus saprophyticus); Streptococcus (e.g. Streptococcus agalactiae, Streptococcus pneumoniae, Streptococcus pyogenes, Streptococcus viridans); Treponema (e.g. Treponema pallidum); Ureaplasma (e.g. Ureaplasma urealyticum); Vibrio (e.g. Vibrio cholerae); or Yersinia (e.g. Yersinia pestis, Yersinia enterocolitica, Yersinia pseudotuberculosis).

17. A complement-activating moiety for use, a method, or a composition for use, according to claim 15, wherein the fungal cell is: Candida (e.g. Candida albicans, Candida glabrata, Candida rugosa, Candida parapsilosis, Candida tropicalis, Candida dubliniensis); Aspergillus (e.g. Aspergillus fumigatus, Aspergillus flavus); Cryptococcus (e.g. Cryptococcus neoformans); Histoplasma (e.g. Histoplasma capsulatum); Pneumocystis (e.g. Pneumocystis jirovecii, Pneumocystis carinii); or Stachybotrys (e.g. Stachybotrys charatum)

18. A complement-activating moiety for use, a method, or a composition for use, according to claim 15, wherein the virus is of the type: Adenoviridae (e.g. Adenovirus); Herpesviridae (e.g. Herpes simplex, type 1, Herpes simplex, type 2, Varicella-zoster virus, Epstein-Barr virus, Human cytomegalovirus, Human herpesvirus type 8); Papillomaviridae (e.g. Human papillomavirus); Polyomaviridae (e.g. BK virus, JC virus); Poxviridae (e.g. Smallpox); Hepadnaviridae (e.g. Hepatitis B virus); Parvoviridae (e.g. Parvovirus B19); Astroviridae (e.g. Human astrovirus); Caliciviridae (e.g. Norwalk virus); Picornaviridae (e.g. coxsackievirus, hepatitis A virus, poliovirus, rhinovirus); Coronaviridae (e.g. Severe acute respiratory syndrome virus); Flaviviridae (e.g. Hepatitis C virus, yellow fever virus, dengue virus, West Nile virus, TBE virus); Togaviridae (e.g. Rubella virus); Hepeviridae (e.g. Hepatitis E virus); Retroviridae (e.g. Human immunodeficiency virus (HIV), Human T-cell leukaemia virus (HTLV) types I, II, III and IV); Orthomyxoviridae (e.g. Influenza virus); Arenaviridae (e.g. Lassa virus); Bunyaviridae (e.g. Crimean-Congo hemorrhagic fever virus, Hantaan virus); Filoviridae (e.g. Ebola virus, Marburg virus); Paramyxoviridae (e.g. Measles virus, Mumps virus, Parainfluenza virus, Respiratory syncytial virus); Rhabdoviridae (e.g. Rabies virus); Hepatitis D virus; Reoviridae (e.g. Rotavirus, Orbivirus, Coltivirus, Banna virus).

19. A complement-activating moiety for use, a method, or a composition for use, according to claim 15, wherein the protozoan is: Plasmodium spp. (responsible for malaria, e.g. Plasmodium falciparum, Plasmodium berghei, Plasmodium yoelii, Plasmodium vivax and Plasmodium knowlesii) Entamoeba (Entamoeba histolytica is responsible for amoebic dysentery); Giardia (responsible for Giardiasis, e.g. Giardia lamblia); trypanosomes (e.g. Trypanosoma brucei, which causes African sleeping sickness, and Trypanosoma cruzi); Leishmania (e.g. Leishmania spp. and Leishmania mexicana); Toxoplasma (e.g. Toxoplasma gondii); Acanthamoeba; Babesia; Balamuthia (e.g. Balamuthia mandrillaris) Cryptosporidium; Cyclospora; Naegleria (e.g. Naegleria fowleri).

20. A complement-activating moiety for use, a method, or a composition for use, according to any one of claims 2 to 15 wherein the target antigen is a marker expressed specifically or preferentially on a neoplastic cell.

21. A complement-activating moiety for use, a method, or a composition for use, according to any one of the preceding claims, wherein said complement-activating moiety does not bind immunoglobulin Fc.

22. A complement-activating moiety for use, a method, or a composition for use, according to any one of the preceding claims wherein said complement-activating moiety does not comprise Sbi-I or Sbi-II.

23. A complement-activating moiety for use, a method, or a composition for use, according to any one of the preceding claims, wherein the complement-activating moiety comprises an Sbi-III domain with at least 80%, at least 85%, at least 90%, at least 95% or at least 99% sequence identity with the wild type Sbi-III sequence.

24. A complement-activating moiety for use, a method, or a composition for use, according to any one of the preceding claims, wherein the complement-activating moiety comprises an Sbi-IV domain with at least 80%, at least 85%, at least 90%, at least 95% or at least 99% sequence identity with the wild type Sbi-IV sequence.

25. A complement-activating moiety for use, a method, or a composition for use, according to any one of the preceding claims, wherein the complement-activating moiety comprises an Sbi-III-IV moiety with at least 80%, at least 85%, at least 90%, at least 95% or at least 99% sequence identity with the wild type Sbi-III-IV sequence.

26. A method of enhancing the immunogenicity of a target antigen, comprising associating said target antigen with a complement-activating moiety comprising Sbi-III-IV.

27. A method according to claim 22 wherein the target antigen is associated with the complement-activating moiety by: (i) admixing the target antigen with the complement-activating moiety; (ii) covalently linking the target antigen to the complement-activating moiety; or (iii) expressing the target antigen as a fusion protein with the complement-activating moiety.

28. A method of immune stimulation, comprising administering a complement-activating moiety comprising Sbi-III-IV as an immunological adjuvant.

29. A method of enhancing an immune response in a subject against a target antigen, wherein said method comprises administering a complement-activating moiety comprising Sbi-III-IV to the subject in conjunction with the target antigen.

30. Use of a complement-activating moiety comprising Sbi-III-IV in the preparation of a medicament for use as an immunological adjuvant.

31. Use of a complement-activating moiety comprising Sbi-III-IV in the preparation of a medicament for use in a method of enhancing an immune response in a subject against a target antigen, wherein said method comprises administering the complement-activating moiety to the subject in conjunction with the target antigen.

32. A method of stimulating an immune response against a target antigen, wherein the method comprises administering to the subject a target antigen which has previously been contacted in vitro or ex vivo with complement and a complement-activating moiety comprising Sbi-III-IV.

33. Use of a composition comprising an opsonised target antigen in the preparation of a medicament for stimulating an immune response against the target antigen, wherein the target antigen has previously been contacted in vitro or ex vivo with complement and a complement-activating moiety comprising Sbi-III-IV.

Description

DESCRIPTION OF THE DRAWINGS

[0063] FIG. 1: Complement activation assay. Fresh CD21.sup./ serum was added to Sbi-III-IV-Ag85b or Sbi-III-IV. The reaction was stopped at various time points (0, 30, 60, 120 minutes). Western blot was developed with rabbit anti-C3 at 1/1000 and goat anti-rabbit at 1/2000. C3d is shown as confirmation that C3 has been activated and broken down. (-) is CD21.sup./ incubated for 120 minutes with saline.

[0064] FIG. 2: Experiment 1 (I.P.1). Serum IgG reactivity to Ag85b over time in WT mice when immunised and boosted (day 28) intraperitoneally with either 1 g Ag85b or 1.35 g Sbi-III-IV-Ag85b as detected by ELISA. Sera was diluted 1/50 and the mean absorbance SEM of each mouse group is shown. All data has been normalised to the day 0 average of all WT mice. tOD450=normalised value read at 450 nm.

[0065] FIG. 3: Experiment 2 (I.V.). Serum IgG reactivity to Ag85b over time in WT mice when immunised and boosted (day 28) intravenously with either 1 g Ag85b or 1.35 g Sbi-III-IV-Ag85b as detected by ELISA. Sera from days 0-28 was diluted 1/50 and sera from days 35-50 was diluted 1/100 and multiplied by 2. The mean absorbance SEM of each mouse group is shown. All data has been normalised to the day 0 average of all WT mice. Note, no blood sample was taken on the boost day 28 due to the IV administration of the vaccine.

[0066] FIG. 4: Experiment 3 (I.P.2). Serum IgG reactivity to Ag85b over time in WT mice when immunised and boosted (day 28) intraperitoneally with either 2.7 g Sbi-III-IV-Ag85b protein, 2 g Ag85b, or 0.7 g Sbi-III-IV plus 2 g Ag85b in 150 mM NaCl solution as detected by ELISA. Sera was diluted 1/50 and the mean absorbance SEM of each mouse group is shown. All data has been normalised to the day 0 average of all WT mice.

[0067] FIG. 5:

[0068] A: Experiment 1 (I.P.1) and experiment 3 (I.P.2). Serum IgG reactivity to Ag85b over time in WT mice when immunised and boosted (day 28) intraperitoneally with either 1.35 g Sbi-III-IV-Ag85b or 2.7 g Sbi-III-IV-Ag85b as detected by ELISA.

[0069] B: Experiment 1 (I.P.1) and Experiment 2 (I.V). Serum IgG reactivity to Ag85b over time in WT mice when immunised and boosted (day 28) 1.35 g Sbi-III-IV-Ag85b either intravenously or intraperitoneally as detected by ELISA.

[0070] Sera was diluted 1/50 and the mean absorbance SEM of each mouse group is shown. All data has been normalised to the day 0 average of all WT mice. (Note, experiment I.P.1 was terminated at day 42 as opposed to day 50).

[0071] FIG. 6:

[0072] A: Experiment 2 (I.V.). Serum IgG reactivity to Ag85b over time in WT, C3.sup./, and CD21.sup./ mice when immunised and boosted (day 28) intravenously with either 1 g Ag85b or 1.35 g Sbi-III-IV-Ag85b as detected by ELISA.

[0073] B: Experiment 2 (I.V.). Serum IgG reactivity to Ag85b at day 42 in WT, C3.sup./, and CD21.sup./ mice when immunised and boosted (day 28) intravenously with either 1 g Ag85b or 1.35 g Sbi-III-IV-Ag85b as detected by ELISA

[0074] C: Experiment 3 (I.P.2). Serum IgG reactivity to Ag85b at day 42 in WT and C3.sup./ mice when immunised and boosted (day 28) intraperitoneally with either 1 g Ag85b or 1.35 g Sbi-III-IV-Ag85b as detected by ELISA. Sera from all IV days 0-28 and all IP was diluted 1/50 and sera from IV days 35-50 was diluted 1/100 and multiplied by 2. The mean absorbance SEM of each mouse group is shown. All data has been normalised to the day 0 average of all mice in each group. Note, no blood sample was taken on the boost day 28 due to the IV administration of the vaccine.

[0075] FIG. 7:

[0076] A: Experiment 2 (I.V.). Serum IgG reactivity to Ag85b or Sbi-III-IV-Ag85b over time in WT mice when immunised and boosted (day 28) intravenously with 1.35 g Sbi-III-IV-Ag85b as detected by ELISA.

[0077] B: Experiment 3 (I.P.2) Serum IgG reactivity to Ag85b or Sbi-III-IV-Ag85b over time in WT mice when immunised and boosted (day 28) intraperitoneally with 2.7 g Sbi-III-IV-Ag85b as detected by ELISA.

[0078] Sera from days 0-28 was diluted 1/50 and sera from days 35-50 was diluted 1/100 and multiplied by 2. The mean absorbance SEM of each mouse group is shown. All data has been normalised to the day 0 average of all WT mice

[0079] FIG. 8:

[0080] A: Experiment 2 (I.V.). Serum IgG reactivity to Sbi-III-IV at day 50 for all mice in IV experiment. Positive control 1/100 polyclonal anti-Sbi serum.

[0081] B: Experiment 3 (I.P.2). Serum IgG reactivity to Sbi-III-IV at day 50 for all mice in IP2 experiment. Positive control 1/100 polyclonal anti Sbi serum.

[0082] Serum was diluted 1/50 and data has been normalised to day 0 average of all mice in each group. The mean absorbance SEM of each mouse group is shown.

[0083] FIG. 9:

[0084] T cell activation by murine splenocytes primed by antigen administration in vivo.

[0085] A: Schematic of experimental design.

[0086] B: Activation of Th1 cells.

[0087] C: Production of IFN-.

[0088] FIG. 10:

[0089] Intracellular cytokine production in subsets of PBMCs treated in vitro with various combinations of Toll-like receptor ligands (TLRs) and Sbi-III-IV. First panel: TNF production by monocytes, classical dendritic cells, and plasmacytoid dendritic cells. Second panel: IL-1 and IL-10 production by monocytes and IFN production by plasmacytoid dendritic cells.

[0090] FIG. 11:

[0091] Illustration of the (.fwdarw.2--D-Galactopyranose-(1.fwdarw.3)--D-Glucopyranose-(1.fwdarw.3)--L-rhamnopyranose-(1.fwdarw.4)-D-ribitol-5-phosphate-0 repeat unit of Pn6B.

[0092] FIG. 12:

[0093] Scheme showing the synthetic method employed for the production of Sbi-III-IV(V80C)-Pn6B conjugate.

[0094] FIG. 13:

[0095] Determination of residual complement (% activity remaining) following complement depletion by incubation with Sbi-III-IV, Pn6B and Sbi-III-IV(V80C)-Pn6B conjugate for the classical (CP), mannose-binding lectin (MBLP), and alternative (AP) complement pathways. Complement depletion (% activity remaining) was quantified from the equation: (samplenegative control)/(positive controlnegative control)100%.

DETAILED DESCRIPTION OF THE INVENTION

Complement

[0096] The complement system is a crucial part of the innate immune system and consists of a group of approximately 20 proteins, mostly found in the serum. When the system is activated, a cascade of sequential enzyme activation takes place, in which the product of one reaction is itself an enzyme which catalyses the next stage of activation. The cascade thus contains a number of points at which exponential signal amplification occurs, potentially resulting in a massive response from a very small initial stimulus.

[0097] The system has three known activation mechanisms, referred to as the classical pathway, the alternative pathway, and the lectin pathway. In simple terms, these three pathways converge into a common downstream effector or terminal pathway.

[0098] Activation by any one of the three mechanisms has three main effects. Firstly, it results in generation of small protein fragments called anaphylatoxins, which serve as chemoattractants to recruit immune cells to the site of activation. Anaphylatoxins include the components C3a and C5a. Secondly, foreign substances (such as microorganisms, viruses, etc.) which trigger the complement cascade are marked for destruction by coating with so-called opsonins, which become covalently bound to hydroxyl and amine groups on the foreign surface. These opsonins (which include C3b, described in more detail below) are recognised by phagocytic cells such as neutrophils. Thirdly, a complex called the membrane attack complex (MAC), comprising the complement components C5b-C9, may be formed in the membrane of foreign cells leading to membrane lysis.

[0099] The protein C3 is a crucial component of all three complement activation pathways. In its intact form it consists of an alpha chain and a beta chain linked by a disulphide bridge. The alpha chain contains an unusual internal thioester bond between Cys1010 and Gln1013 which is exposed by cleavage of C3 during the complement activation process. This thioester bond can then be cleaved by nucleophilic attack from a suitable group (e.g. a hydroxyl or amine group), leading to the formation of a covalent adduct between C3b and the nucleophile, which is an important part of the opsonisation process.

[0100] C3b also participates in the formation of an enzyme capable of further C3 cleavage (a C3 convertase). iC3b is an inactivated form of C3b formed when C3b is cleaved by a control protein which prevents excessive activation of the complement cascade. C3c, C3dg and C3d are further downstream cleavage products of iC3b. C3d also acts as an opsonin.

[0101] Thus, activation of complement at a given site typically results in the generation of complement activation products such as anaphylatoxins and opsonins, which provide signals to various immune cell types here termed responder cells. Responder cells are primarily cells of the immune system such as basophils, neutrophils, mast cells and macrophages. Anaphylatoxins and opsonins trigger various functions in these cell types such as chemotaxis (towards the site of complement activation), mast cell degranulation, activation of respiratory burst, phagocytosis of opsonised targets, etc. Opsonisation of a particular target typically results in enhanced generation of antibodies against that target.

[0102] Any system comprising C3 always shows a low level of complement activation via spontaneous hydrolysis of C3 (referred to as tick-over C3 activation). However the cascade is normally kept in check by powerful regulatory mechanisms.

Complement-Activating Moiety

[0103] The complement-activating moiety comprises an Sbi-III domain and an Sbi-IV domain which together are capable of activating the complement cascade. Without wishing to be bound by theory, it is believed that, when acting in concert, these domains undergo a trans-acylation reaction with C3, thus forming a covalent adduct with C3b. The adduct thus formed is then able to drive localised complement activation (which may involve the formation of a C3 convertase incorporating Factor B, Factor D and further C3b components) leading to opsonisation of the target antigen.

[0104] Native Sbi protein is composed (from N- to C-terminus) of a leader peptide, domains Sbi-I, II, III and IV, a putative wall-anchoring sequence (WR) and a so-called Y region. Its sequence, including signal sequence, is as follows:

TABLE-US-00001 MetLysAsnLysTyrIleSerLysLeuLeuValGly 1510 AlaAlaThrIleThrLeuAlaThrMetIleSerAsn 1520 GlyGluAlaLysAlaSerGluAsnThrGlnGlnThr 253035 SerThrLysHisGlnThrThrGlnAsnAsnTyrVal 4045 ThrAspGlnGlnLysAlaPheTyrGlnValLeuHis 505560 LeuLysGlyIleThrGluGluGlnArgAsnGlnTyr 6570 IleLysThrLeuArgGluHisProGluArgAlaGln 7580 GluValPheSerGluSerLeuLysAspSerLysAsn 859095 ProAspArgArgValAlaGlnGlnAsnAlaPheTyr 100105 AsnValLeuLysAsnAspAsnLeuThrGluGlnGlu 110115120 LysAsnAsnTyrIleAlaGlnIleLysGluAsnPro 125130 AspArgSerGlnGlnValTrpValGluSerValGln 135140 SerSerLysAlaLysGluArgGlnAsnIleGluAsn 145150155 AlaAspLysAlaIleLysAspPheGlnAspAsnLys 160165 AlaProHisAspLysSerAlaAlaTyrGluAlaAsn 170175180 SerLysLeuProLysAspLeuArgAspLysAsnAsn 185190 ArgPheValGluLysValSerIleGluLysAlaIle 195200 ValArgHisAspGluArgValLysSerAlaAsnAsp 205210215 AlaIleSerLysLeuAsnGluLysAspSerIleGlu 220225 AsnArgArgLeuAlaGlnArgGluValAsnLysAla 230235240 ProMetAspValLysGluHisLeuGlnLysGlnLeu 245250 AspAlaLeuValAlaGlnLysAspAlaGluLysLys 255260 ValAlaProLysValGluAlaProGlnIleGlnSer 265270275 ProGlnIleGluLysProLysValGluSerProLys 280285 ValGluValProGlnIleGlnSerProLysValGlu 290295300 ValProGlnSerLysLeuLeuGlyTyrTyrGlnSer 305310 LeuLysAspSerPheAsnTyrGlyTyrLysTyrLeu 315320 ThrAspThrTyrLysSerTyrLysGluLysTyrAsp 325330335 ThrAlaLysTyrTyrTyrAsnThrTyrTyrLysTyr 340345 LysGlyAlaIleAspGlnThrValLeuThrValLeu 350355360 GlySerGlySerLysSerTyrIleGlnProLeuLys 365370 ValAspAspLysAsnGlyTyrLeuAlaLysSerTyr 375380 AlaGlnValArgAsnTyrValThrGluSerIleAsn 385390395 ThrGlyLysValLeuTyrThrPheTyrGlnAsnPro 400405 ThrLeuValLysThrAlaIleLysAlaGlnGluThr 410415420 AlaSerSerIleLysAsnThrLeuSerAsnLeuLeu 425430 SerPheTrpLys. 435

[0105] By Sbi-III domain is meant a polypeptide sequence comprising at least amino acids 150 to 197 of the wild type Sbi sequence, a fragment thereof, or a variant of either having at least 80%, at least 85%, at least 90%, at least 95% or at least 99% sequence identity with the corresponding Sbi sequence. The Sbi-III domain may be at least 30, at least 35, at least 40, or at least 45 amino acids in length. In some embodiments the Sbi-III domain has at least 80%, at least 85%, at least 90%, at least 95% or at least 99% sequence identity with the wild type Sbi-III sequence. In some embodiments, the Sbi-III domain comprises the wild type Sbi-III sequence.

[0106] It may be desirable that residue K173 is not modified, as modification at this site may adversely affect Sbi's ability to activate complement.

[0107] Wild type Sbi-III (residues 150 to 197 of the molecule shown above) has the sequence:

TABLE-US-00002 ERQNIENADKAIKDFQDNKAPHDKSAAYEANSKLPKDLRDKNNRFVEK

[0108] By Sbi-IV domain is meant a polypeptide sequence comprising at least amino acids 198 to 266 of the Sbi sequence, a fragment thereof, or a variant of either having at least 80%, at least 85%, at least 90%, at least 95% or at least 99% sequence identity with the corresponding Sbi sequence. The Sbi-IV domain retains the ability to bind to C3 protein, especially the C3d portion of C3. Interactions between Sbi-IV and C3 are described by Clark et al., Mol. Immunol. 48(2011), 452-462. The Sbi-IV domain may be at least 30, at least 35, at least 40, at least 45, at least 50, at least 55, at least 60, or at least 65 amino acids in length. In some embodiments the Sbi-IV domain has at least 80%, at least 85%, at least 90%, at least 95% or at least 99% sequence identity with the wild type Sbi-IV sequence. In some embodiments, the Sbi-IV domain comprises the wild type Sbi-IV sequence.

[0109] It may be desirable that residues 5199, 5226, R231, N238, K250, K259, K263 and/or K264 are not modified, as modification at these sites may adversely affect Sbi's ability to form a covalent adduct with C3b and/or otherwise to activate complement.

[0110] Wild type Sbi-IV (residues 198 to 266 of the molecule shown above) has the sequence:

TABLE-US-00003 VSIEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREVNKAPMDVKEH LQKQLDALVAQKDAEKKVA

[0111] The Sbi-III and Sbi-IV sequences may be contiguous as in the native protein. For example, residues 150-266 of the Sbi molecule shown above (i.e. wild type Sbi-III-IV) have the sequence:

TABLE-US-00004 ERQNIENADKAIKDFQDNKAPHDKSAAYEANSKLPKDLRDKNNRFVEKVS IEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREVNKAPMDVKEHLQ KQLDALVAQKDAEKKVA

[0112] The Sbi-III-IV moiety may therefore comprise or consist of residues 150-266 of the Sbi sequence shown, or a fragment thereof capable of undergoing the required transacylation reaction with C3. Alternatively the complement-activating moiety may comprise a variant of either which has at least 80%, at least 85%, at least 90%, at least 95% or at least 99% sequence identity with the corresponding Sbi sequence and which retains the ability to undergo the required transacylation reaction with C3. In some embodiments the Sbi-III-IV moiety has at least 80%, at least 85%, at least 90%, at least 95% or at least 99% sequence identity with the wild type Sbi-III-IV sequence.

[0113] An example of a modification to the wild type Sbi-III-IV sequence is the introduction of a cysteine residue, e.g. to facilitate covalent linkage to a target antigen, especially a non-peptide target antigen such as a carbohydrate, polysaccharide, lipopolysaccharide or lipid. For example, the valine residue adjacent the C-terminus of Sbi-III-IV protein (V68 of Sbi-IV; V116 of Sbi-III-IV) may be mutated to cysteine to yield the construct was designated Sbi-III-IV(V80C) in the Examples below, which has the sequence:

TABLE-US-00005 ERQNIENADKAIKDFQDNKAPHDKSAAYEANSKLPKDLRDKNNRFVEKVS IEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREVNKAPMDVKEHLQ KQLDALVAQKDAEKKCA

[0114] In some embodiments, the Sbi-III-IV moiety comprises the wild type Sbi-III-IV sequence.

[0115] Alternatively, the Sbi-III and Sbi-IV domains may be separated by a linker sequence. As described elsewhere, peptide linkers are typically between 12 and 30 amino acids in length, and have a high proportion of small and hydrophilic amino acid residues (e.g. glycine and serine) to provide the required flexibility without compromising solubility, and may comprise additional elements such as poly-His sequences (e.g. His.sub.6-His.sub.10).

[0116] In some embodiments, the complement-activating moiety is not capable of binding to an immunoglobulin Fc region, i.e. it has substantially no affinity for an immunoglobulin Fc region. For example, it does not comprise a domain having affinity for Fc.

[0117] In some embodiments, the complement-activating moiety does not comprise any further Sbi sequence other than an Sbi-III domain and an Sbi-IV domain. For example, it does not comprise either an Sbi-I domain or an Sbi-II domain. However, if desired, it may comprise an Sbi-I domain or an Sbi-II domain.

[0118] By Sbi-I domain is meant a polypeptide sequence comprising amino acids 42 to 90 of the Sbi sequence shown above, a fragment thereof, or a variant of either having at least 80% sequence identity with the corresponding Sbi sequence. The Sbi-I domain may retain the ability to bind immunoglobulin, in particular via the Fc region.

[0119] By Sbi-II domain is meant a polypeptide sequence comprising at least amino acids 92 to 149 of the Sbi sequence shown above, a fragment thereof, or a variant of either having at least 80% sequence identity with the corresponding Sbi sequence. The Sbi-II domain may retain the ability to bind immunoglobulin, in particular via the Fc region.

[0120] Percent (%) amino acid sequence identity with respect to a reference sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. % identity values may be determined by WU-BLAST-2 (Altschul et al., Methods in Enzymology, 266:460-480 (1996)). WU-BLAST-2 uses several search parameters, most of which are set to the default values. The adjustable parameters are set with the following values: overlap span=1, overlap fraction=0.125, word threshold (T)=11. A % amino acid sequence identity value is determined by the number of matching identical residues as determined by WU-BLAST-2, divided by the total number of residues of the reference sequence (gaps introduced by WU-BLAST-2 into the reference sequence to maximize the alignment score being ignored), multiplied by 100.

[0121] Reference to corresponding Sbi sequence should be taken to mean the portion of Sbi sequence which aligns with a query sequence when that query sequence is optimally aligned with the full length Sbi sequence. Thus, for example, a 40 amino acid sequence which is identical to a contiguous 40 amino acid stretch of Sbi-III would be considered to have 100% identity to that stretch of corresponding Sbi sequence.

[0122] It may be desirable (although not necessary) that the Sbi domains used for the purposes of the present differ from the Sbi sequence shown only by conservative substitutions.

[0123] Conservative substitutions may be defined as substitutions within the following groups of amino acids:

I. Asp and Glu (acidic amino acids);
II. Arg, Lys and His (basic amino acids);
III. Asn, Gln, Ser, Thr and Tyr (uncharged polar amino acids);
IV. Ala, Gly, Val, Leu, Ile, Pro, Phe, Met, Trp and Cys (non-polar amino acids).

[0124] The complement-activating moieties described here may bind C3 (and form adducts with C3b) from any mammalian species, including rodents (e.g. mice, rats), lagomorphs (e.g. rabbits), felines (e.g. cats), canines (e.g. dogs), equines (e.g. horses), bovines (e.g. cows), caprines (e.g. goats), ovines (e.g. sheep), other domestic, livestock or laboratory animals, or primates (e.g. Old World monkey, New World monkey, apes or humans). Preferably they bind human C3 protein.

[0125] As discussed elsewhere in this specification, the complement-activating moiety is capable of enhancing an immune response against a target antigen, as compared to an equivalent administration in the absence of complement-activating moiety, or an equivalent administration with an inactivate analogue of the complement-activating moiety, i.e. one which is not capable of activating complement. Such analogues may have an identical amino acid sequence to the complement-activating moiety but have been physically inactivated, e.g. by incorrect folding, heat treatment, or other modes of denaturation. Alternatively, the analogue may differ from the complement activating-moiety by one or more point mutations in the Sbi-III-IV sequence, e.g. at one or more of positions K173, 5199, R213, N238. The substituent amino acid may be Ala or any other residue which results in an inactive analogue, i.e. suitable substitutions include K173A, S199A, R213A and N238A. Thus, a reference inactivate analogue of any given complement-activating moiety may be generated by introducing one of these modifications, or more if desired. Preferably, the analogue differs from the complement-activating moiety in question only by one such modification.

Target Antigen

[0126] The target antigen may be any antigen against which it is desirable to raise an immune response, and especially any antigen against which it is desirable to stimulate production of antibodies, particularly IgG.

[0127] The target antigen may be a peptide antigen. As mentioned above, the term peptide here refers to the nature of the antigen, i.e. that it is formed from amino acids linked by peptide bonds, and should not be taken to imply any particular size or length. Typically the peptide antigen will be at least 8 amino acids in length, and may be up to 30 amino acids in length, up to 50 amino acids in length, up to 100 amino acids, up to 200 amino acids, or even longer. It may be a complete protein, an isolated domain of a protein, or a peptide fragment of a protein.

[0128] Alternatively, the antigen may be a non-peptide antigen. It may comprise or consist of any other type of biological molecule, including a carbohydrate, polysaccharide, lipid, lipopolysaccharide, etc. For example a non-peptide antigen may be a polysaccharide or lipopolysaccharide from the cell membrane, cell wall or capsule of an infectious organism, such as the polysaccharide Pn6B from Streptococcus pneumoniae.

[0129] The target antigen may be covalently linked (e.g. chemically conjugated) to the complement-activating moiety. Chemical conjugation may be performed by any suitable means and the skilled person will be well aware of suitable technologies, including, but not limited to: (1) direct coupling via protein functional groups (e.g., thiol-thiol linkage, amine-carboxyl linkage, amine-aldehyde linkage; enzyme direct coupling); (2) homobifunctional coupling of amines (e.g., using bis-aldehydes); (3) homobifunctional coupling of thiols (e.g., using bis-maleimides); (4) homobifunctional coupling via photoactivated reagents (5) heterobifunctional coupling of amines to thiols (e.g., using maleimides); (6) heterobifunctional coupling via photoactivated reagents (e.g., the -carbonyldiazo family); (7) introducing amine-reactive groups into a poly- or oligosaccharide via cyanogen bromide activation or carboxymethylation; (8) introducing thiol-reactive groups into a poly- or oligosaccharide via a heterobifunctional compound such as maleimido-hydrazide; (9) protein-lipid conjugation via introducing a hydrophobic group into the protein and (10) protein-lipid conjugation via incorporating a reactive group into the lipid. Also, contemplated are heterobifunctional non-covalent coupling techniques such the biotin-avidin interaction. For a comprehensive review of conjugation techniques, see Aslam and Dent (1998). Thus the antigen may be covalently linked to the side chain of a residue of the Sbi-III-IV moiety, e.g. to the side chain of a cysteine residue.

[0130] Where the target antigen is a peptide antigen, it may be provided as part of a fusion protein with the complement-activating moiety; i.e. the antigen and complement-activating moiety are part of the same peptide chain.

[0131] In the fusion protein, the target antigen may be N-terminal of the complement-activating moiety, or the complement-activating moiety may be N-terminal of the target antigen.

[0132] The fusion protein may comprise other components. For example, it may comprise a linker peptide between the complement-activating moiety and the target antigen.

[0133] A peptide linker is typically between 12 and 30 amino acids in length, with a high proportion of small and hydrophilic amino acid residues (e.g. glycine and serine) to provide the required flexibility without compromising aqueous solubility of the molecule. For example, it may comprise at least 50% glycine and serine residues, at least 60% glycine and serine residues, at least 70% glycine and serine residues, at least 80% glycine and serine residues, or at least 90% glycine and serine residues.

[0134] Additionally or alternatively, the fusion protein may comprise a peptide tag (e.g. a poly-His sequence, such as His.sub.6-His.sub.10) to facilitate purification. Such a tag may, for example, be located at the N-terminus or the C-terminus of the fusion protein, or within a linker sequence. By way of illustration, in the examples below, a linker is employed between a complement-activating moiety (Sbi-III-IV) and a target antigen (Ag85b) which contains a poly-His tag, and has the sequence GTSGGGGSHHHHHHHHHHSGGGGS.

[0135] The target antigen itself will be chosen depending on the nature of the desired immune response.

[0136] It may be desirable to generate an immune response against an infectious organism, e.g. for prophylaxis or treatment of infection by that organism. Thus the target antigen may be derived from an infectious organism, such as a bacterium, fungal cell, virus, protozoan, or other parasite. In this context, derived from means genetically encoded, expressed, or otherwise synthesised by the infectious organism. Typically, the target antigen will be expressed or otherwise displayed on the surface of that organism.

[0137] A bacterial target antigen may be from a gram positive bacterium or a gram negative bacterium.

[0138] A bacterial target antigen may be from a bacterium of one of the following genera or species, which include common human pathogens:

Actinomyces (e.g. Actinomyces israelii);
Bacillus (e.g. Bacillus anthracis, Bacillus cereus);
Bacteroides (e.g. Bacteroides fragilis);
Bartonella (e.g. Bartonella henselae, Bartonella quintana);
Bordetella (e.g. Bordetella pertussis);
Borrelia (e.g. Borrelia burgdorferi, Borrelia garinii, Borrelia afzelii, Borrelia recurrentis);
Brucella (e.g. Brucella abortus, Brucella canis, Brucella melitensis, Brucella suis);
Campylobacter (e.g. Campylobacter jejuni);
Chlamydia and Chlamydophila (e.g. Chlamydia pneumoniae Chlamydia trachomatis Chlamydophila psittaci);
Clostridium (e.g. Clostridium botulinum, Clostridium difficile, Clostridium perfringens Clostridium tetani);
Corynebacterium (e.g. Corynebacterium diphtheriae);
Cryptococcus (e.g. Cryptococcus neoformans);
Ehrlichia (e.g. Ehrlichia canis, Ehrlichia chaffensis);
Enterococcus (e.g. Enterococcus faecalis, Enterococcus faecium);
Escherichia (e.g. Escherichia coli);
Francisella (e.g. Francisella tularensis);
Haemophilus (e.g. Haemophilus influenzae);
Helicobacter (e.g. Helicobacter pylori);
Klebsiella (e.g. Klebsiella pneumoniae);
Legionella (e.g. Legionella pneumophila);
Leptospira (e.g. Leptospira interrogans, Leptospira santarosai, Leptospira weilii, Leptospira noguchii);
Listeria (e.g. Listeria monocytogenes);
Mycobacterium (e.g. Mycobacterium leprae, Mycobacterium tuberculosis, Mycobacterium ulcerans);
Mycoplasma (e.g. Mycoplasma pneumoniae);
Neisseria (e.g. Neisseria gonorrhoeae, Neisseria meningitidis);
Nocardia (e.g. Nocardia asteroides);
Pseudomonas (e.g. Pseudomonas aeruginosa);
Rickettsia (e.g. Rickettsia rickettsii);
Salmonella (e.g. Salmonella typhi, Salmonella typhimurium, Salmonella enterica);
Shigella (e.g. Shigella sonnei, Shigella dysenteriae, Shigella flexneri);
Staphylococcus (e.g. Staphylococcus aureus, Staphylococcus epidermidis, Staphylococcus saprophyticus);
Streptococcus (e.g. Streptococcus agalactiae, Streptococcus pneumoniae, Streptococcus pyogenes, Streptococcus viridans);
Treponema (e.g. Treponema pallidum);
Ureaplasma (e.g. Ureaplasma urealyticum);
Vibrio (e.g. Vibrio cholerae);
Yersinia (e.g. Yersinia pestis, Yersinia enterocolitica, Yersinia pseudotuberculosis).

[0139] In some embodiments, the antigen is not derived from a Staphylococcus species (i.e. it is not a Staphylococcal antigen). In some embodiments, the antigen is not derived from Staphylococcus aureus or from Staphylococcus epidermidis.

[0140] A fungal target antigen may be from one of the following genera or species, which include common human pathogens:

Candida (e.g. Candida albicans, Candida glabrata, Candida rugosa, Candida parapsilosis, Candida tropicalis, Candida dubliniensis);
Aspergillus (e.g. Aspergillus fumigatus, Aspergillus flavus);
Cryptococcus (e.g. Cryptococcus neoformans);
Histoplasma (e.g. Histoplasma capsulatum);
Pneumocystis (e.g. Pneumocystis jirovecii, Pneumocystis carinii);
Stachybotrys (e.g. Stachybotrys charatum).

[0141] A viral target antigen may be derived from one of the following virus families or species, which include common human pathogens:

Adenoviridae (e.g. Adenovirus);
Herpesviridae (e.g. Herpes simplex, type 1, Herpes simplex, type 2, Varicella-zoster virus, Epstein-Barr virus, Human cytomegalovirus, Human herpesvirus type 8);
Papillomaviridae (e.g. Human papillomavirus);
Polyomaviridae (e.g. BK virus, JC virus);
Poxviridae (e.g. Smallpox);
Hepadnaviridae (e.g. Hepatitis B virus);
Parvoviridae (e.g. Parvovirus B19);
Astroviridae (e.g. Human astrovirus);
Caliciviridae (e.g. Norwalk virus);
Picornaviridae (e.g. coxsackievirus, hepatitis A virus, poliovirus, rhinovirus);
Coronaviridae (e.g. Severe acute respiratory syndrome virus);
Flaviviridae (e.g. Hepatitis C virus, yellow fever virus, dengue virus, West Nile virus, TBE virus);
Togaviridae (e.g. Rubella virus);
Hepeviridae (e.g. Hepatitis E virus);
Retroviridae (e.g. Human immunodeficiency virus (HIV), Human T-cell leukaemia virus (HTLV) types I, II, III and IV);
Orthomyxoviridae (e.g. Influenza virus);
Arenaviridae (e.g. Lassa virus);
Bunyaviridae (e.g. Crimean-Congo hemorrhagic fever virus, Hantaan virus);
Filoviridae (e.g. Ebola virus, Marburg virus);
Paramyxoviridae (e.g. Measles virus, Mumps virus, Parainfluenza virus, Respiratory syncytial virus); Rhabdoviridae (e.g. Rabies virus);
Hepatitis D virus;
Reoviridae (e.g. Rotavirus, Orbivirus, Coltivirus, Banna virus).

[0142] A protozoan target antigen may be derived from one of the following genera or species of protozoan, which include common human pathogens:

Plasmodium spp. (responsible for malaria, e.g. Plasmodium falciparum, Plasmodium berghei, Plasmodium yoelii, Plasmodium vivax and Plasmodium knowlesii)
Entamoeba (Entamoeba histolytica is responsible for amoebic dysentery);
Giardia (responsible for Giardiasis, e.g. Giardia lamblia);
trypanosomes (e.g. Trypanosoma brucei, which causes African sleeping sickness, and Trypanosoma cruzi);
Leishmania (e.g. Leishmania spp. and Leishmania mexicana);
Toxoplasma (e.g. Toxoplasma gondii);

Acanthamoeba;

Babesia;

[0143] Balamuthia (e.g. Balamuthia mandrillaris)

Cryptosporidium;

Cyclospora;

[0144] Naegleria (e.g. Naegleria fowleri).

[0145] Some of these organisms (e.g. Plasmodium, trypanosomes, Leishmania and Toxoplasma gondii) may also infect host cells.

[0146] Other parasites from which the target antigen may be derived include helminths (e.g. Ascaris lumbricoides, pinworm, Strongyloides stercoralis, Toxocara, guinea worm, hookworm, tapeworm, whipworm) and flukes (e.g. Schistosoma, Gnathostoma, Paragonimus, Fasciola hepatica, Trichobilharzia regenti).

[0147] It may also be beneficial to stimulate an immune response against a neoplastic cell. The neoplastic cell may be benign or malignant. It may be a cancer cell.

[0148] Thus, the target antigen may be a marker expressed specifically or preferentially on a neoplastic cell, e.g. a cancer cell. Such a marker may be referred to as a tumour-specific marker or tumour-specific antigen, although their expression is not restricted to solid tumours.

[0149] Markers expressed on neoplastic cells may be self antigens. Thus the target antigen may be derived from the same species as the subject to which it is to be administered, or derived from the subject themselves.

[0150] Examples of self cancer antigens include alphafetoprotein (AFP, found in germ cell tumours and hepatocellular carcinoma), carcinoembryonic antigen (CEA, found in bowel cancers and certain lung and breast cancers), CA-125 (found in ovarian cancer), MUC-1 (found in breast cancer), epithelial tumour antigen (ETA, found in breast cancer), tyrosinase (found in malignant melanoma), melanoma-associated antigen (MAGE, found in malignant melanoma) and variants of Ras and p53.

[0151] Markers of neoplasia may alternatively be non-self, e.g. derived from an infectious organism associated with (or causative of) the neoplasia. Many neoplasias and cancers are associated with or caused by oncoviruses. Such conditions and their associated viruses include hepatocellular carcinoma (hepatitis viruses including hepatitis B and C), tropical spastic paraparesis and adult T cell leukaemia (human T-lymphotropic virus [HTLV]), cancers of the cervix, anus, penis, vulva/vagina and oropharyngeal cancer (human papillomaviruses), Kaposi's sarcoma, multicentric Castleman's disease and primary effusion lymphoma (Kaposi's sarcoma-associated herpesvirus [HHV-8]), Merkel cell carcinoma (Merkel cell polyomavirus), and Burkitt's lymphoma, Hodgkin's lymphoma, post-transplantation lymphoproliferative disease and nasopharyngeal carcinoma (Epstein Barr virus [EBV]). Thus the target antigen may be an antigen derived from one of these viruses.

[0152] For the avoidance of any doubt, the target antigen is not Sbi. For example, the antigen typically has less than 60% sequence identity with Sbi protein. (That is to say, when optimally aligned with the Sbi sequence set out above, the antigen has less than 60% sequence identity with the corresponding Sbi sequence in the region of overlap.) Preferably, the antigen has less than 50%, less than 40%, less than 30%, less than 25% or less than 20% sequence identity with the corresponding Sbi sequence.

[0153] The complement-activating moiety comprises Sbi-III-IV. As discussed above, it may also comprise additional Sbi sequences, including an Sbi-I domain and/or an Sbi-II domain. These sequences are not to be construed to constitute the target antigen.

Pharmaceutical Compositions and Methods of Treatment

[0154] The molecules described herein can be formulated in pharmaceutical compositions. These compositions may comprise, in addition to one of the above substances, a pharmaceutically acceptable excipient, carrier, buffer, stabiliser or other materials well known to those skilled in the art. Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient. The precise nature of the carrier or other material may depend on the route of administration, which may be by any suitable route, and may be oral or parenteral. Because of the difficulties experienced with oral delivery of peptide agents, parenteral administration may prove the most suitable. Suitable parenteral routes include but are not limited to intravenous, intramuscular, intraperitoneal, cutaneous, subcutaneous, transdermal, and other mucosal routes such as nasal, buccal, rectal and vaginal routes. Examples of suitable compositions and methods of administration are provided in Esseku and Adeyeye (2011) and Van den Mooter G. (2006).

[0155] Pharmaceutical compositions for oral administration may be in tablet, capsule, powder or liquid form. A tablet may include a solid carrier such as gelatin or an adjuvant. Liquid pharmaceutical compositions generally include a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included.

[0156] For intravenous, cutaneous or subcutaneous injection, or injection at the site of affliction, the active ingredient will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability. Those of relevant skill in the art are well able to prepare suitable solutions using, for example, isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection. Preservatives, stabilisers, buffers, antioxidants and/or other additives may be included, as required.

[0157] Whatever the nature of the active agent that is to be given to an individual (e.g. a cell, polypeptide, nucleic acid molecule, other pharmaceutically useful agent according to the present invention), administration is preferably in a prophylactically effective amount or a therapeutically effective amount (as the case may be, although prophylaxis may be considered therapy), this being sufficient to show benefit to the individual. The actual amount administered, and rate and time-course of administration, will depend on the nature and severity of what is being treated. Prescription of treatment, e.g. decisions on dosage etc., is within the responsibility of general practitioners and other medical doctors, and typically takes account of the disorder to be treated, the condition of the individual patient, the site of delivery, the method of administration and other factors known to practitioners. Examples of the techniques and protocols mentioned above can be found in Remington's Pharmaceutical Sciences, 20th Edition, 2000, pub. Lippincott, Williams & Wilkins.

EXAMPLES

Stimulation of Immune Response Against Peptide Antigen

[0158] Sbi-III-IV and the Ag85b protein from Mycobacterium tuberculosis were expressed alone, and as a fusion protein.

[0159] To facilitate covalent attachment to Pn6B antigen, the valine residue adjacent the C-terminus of Sbi-III-IV protein (V68 of Sbi-IV; V116 of Sbi-III-IV) was mutated to cysteine. The resulting construct was designated Sbi-III-IV(V80C).

[0160] All proteins were expressed with poly-His tags to assist purification. Sbi-III-IV, Ag85b, and the Sbi-III-IV-Ag85b fusion protein were expressed in both E. coli and CHO expression systems. Sbi-III-IV(V80C) was expressed only in E. coli. Consistent results were obtained whichever expression system was used.

Test Proteins

[0161]

TABLE-US-00006 Sbi-III-IV MRGSHHHHHHGSERQNIENADKAIKDFQDNKAPHDKSAAYEANSKLPKDL RDKNNREVEKVSIEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREV NKAPMDVKEHLQKQLDALVAQKDAEKKVA[Sbisequenceshown initalics.] Ag85b MPLLLLLPLLWAGALAMDVDKLHHHHHHHHHTSASFSRPGLPVEYLQVPS PSMGRDIKVQFQSGGNNSPAVYLLDGLRACIDDYNGWDINTPAFEWYYQS GLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRA VKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDRSQGMGPSLI GLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNG TPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSW EYWGAQLNAMKGDLQSSLGAGKP[Full-lengthprecursor sequence.Signalpeptideunderlined.Ag85b sequenceshowninitalics.] Sbi-III-IV-Ag85bfusion MPLLLLLPLLWAGALAMDVDERQNIENADKAIKDFQDNKAPHDKSAAYEA NSKLPKDLRDKNNRFVEKVSIEKAIVRHDERVKSANDAISKLNEKDSIEN RRLAQREVNKAPMDVKEHLQKQLDALVAQKDAEKKVAGTSGGGGSHHHHH HHHHHSGGGGSTSASFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPA VYLLDGLRACIDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYS PACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMI LAAYHPQQFIYAGSLSALLDRSQGMGPSLIGLAMGDAGGYKAADMWGPSS DPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVR SSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGA GKP[Full-lengthprecursorsequence.Signal peptideunderlined.SbiandAg85bsequencesshown initalics.] Sbi-III-IV(V80C) MRGSHHHHHHGSERQNIENADKAIKDFQDNKAPHDKSAAYEANSKLPKDL RDKNNRFVEKVSIEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREV NKAPMDVKEHLQKQLDALVAQKDAEKKcustom-character A[Sbi-III-IV(V80C) sequenceshowninitalics.VtoCsubstitution showninboldandunderlined.]

Recombinant Protein Expression

[0162] For expression in CHO cells, plasmids encoding the test proteins were transfected into CHO cells using jetPRIME transfection reagent (Polyplus Transfections). Cells were kept at 37 C. in RPMI 1640 (Lonza) media. One day post-transfection, cells were selected by the addition of 0.8/ml hygromycin. After approximately 1 week, cells were grown in a maintenance level of 0.2 mg/ml hygromycin media. Supernatant was collected when cells were split and kept frozen at 20 C.

[0163] Expression in E. coli was performed as described in Burman et al., 2008, J Biol Chem 283, 17579-17593.

Confirmation of Protein Production

[0164] Supernatant from transfected CHO cell cultures was collected and mixed with nickel-agarose beads (Thermo). This was left overnight at 4 C. with constant shaking. Beads were washed twice with nickel-His binding buffer (0.5M NaCl/0.1M Tris-HCl containing 40-80 mM imidazole, pH 8.0) Buffer was removed and beads were mixed 1:1 with non-reducing PAGE buffer and boiled for 5 minutes. Samples were loaded onto a 12.5% SDS-PAGE gel, transferred to nitrocellulose and developed with anti-His and HRPO. If His-tag was shown to be present at approximately 48.5 kDa (size of Sbi-III-IV-Ag85b), cells were serially diluted in a 96 well plate to allow single colonies to grow. Single colonies were then tested using immunoprecipitation as above and positive colonies allowed to grow in larger T175 flasks.

[0165] The identity of the bacterially-expressed Sbi_III-IV protein was confirmed by mass spectrometry and Western blotting using polyclonal anti-Sbi antibodies.

KTA Protein Purification of Supernatant

[0166] Supernatant from transfected CHO cells was collected regularly as flasks were split. When sufficient supernatant was collected, it was mixed 1:1 with equilibration buffer (pH 7.4, 50 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 25 mM imidazole), filter sterilised and run through a cobalt column (GE) at a rate of 1 ml/minute at 4 C. The column was then washed with wash buffer (pH 7.4, 50 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 25 mM Imidazole), and eluted with elution buffer (pH 7.4, 50 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 300 mM Imidazole) on an KTA (GE) protein purification system. Fractions of eluted protein at a gradient of up to 100% elution buffer were collected and analysed on SDS-PAGE stained with Coomassie stain, or transferred for western blot developed with mouse anti-poly histidine antibody to confirm the presence of the purified His-tagged protein.

[0167] A similar method was used for purification of bacterially-expressed protein, as described in Burman et al., 2008, J Biol Chem 283, 17579-17593.

Buffer Exchange and Concentration of Purified Protein

[0168] Appropriate fractions containing the purified His-tagged protein were combined and concentrated using a 30,000 kDa cut off spin column (Vivaspin) to a final volume of 2.5 ml. The concentrated protein was then buffer exchanged into phosphate buffered saline (PBS) using PD-10 columns (GE). Final yields were measured by nanodrop.

In Vitro Complement Activation by Sbi-III-IV-Ag85b

[0169] A Western blot assay was carried out to confirm that the purified Sbi-III-IV-Ag85b protein was able to activate the complement system in vitro. Fresh mouse serum (CD21.sup./) was added to Sbi-III-IV or Sbi-III-IV-Ag85b, ensuring that the amount of Sbi-III-IV in each preparation was equivalent. The reaction was stopped at 0, 30, 60 and 120 minutes, by the addition of reducing sample buffer, boiled for 5 minutes and run on a 10% SDS-PAGE gel. These were transferred to nitrocellulose membranes and developed with rabbit anti C3 ( 1/1000) and goat anti rabbit HRPO ( 1/2000).

Ensuring Stoichiometry of Proteins in Vaccine Preparations

[0170] To ensure administration of equivalent quantities of antigen proteins, mice immunised with Sbi-III-IV-Ag85b received 1.35 g of protein and those immunised with Ag85b received 1 g. (Molecular weight of Sbi-III-IV is 17 kDa and that of Ag85b is 3.15 kDa.)

Experiment 1 (I.P.1)

[0171] To determine whether mice immunised with Sbi-III-IV-Ag85b had a higher immune response to Ag85b than those immunised with Ag85b alone, mice were immunised by intraperitoneal (I.P.) injection. Animals receiving antigen Ag85b alone were injected with 1 g Ag85b in 200 l 150 mM NaCl and animals receiving Sbi-III-IV-Ag85b were injected with 1.35 g Sbi-III-IV-Ag85b in 200 l 150 mM NaCl. Negative controls were mice immunised with 200 l 150 mM NaCl. Positive control was a WT mouse immunised with 1 g Ag85b plus Complete Freund's Adjuvant (CFA). C3.sup./ mice were used as an internal negative control.

[0172] Mice were immunised once at day 0 and boosted at day 28. Serum samples (from approximately 70 l blood) were collected weekly for ELISA analysis until sacrifice by cardiac puncture at day 42.

TABLE-US-00007 TABLE 1 Mice used in experiment 1 (I.P.1) Genotype Immunisation n= WT (C57BL/6) 200 l 150 mM NaCl (Negative control) 1 WT (C57BL/6) 100 l 0.1 mg/ml Ag85b plus 100 lCFA 1 (Positive control) WT (C57BL/6) 1 g Ag85b in 200 l 150 mM NaCl 4 WT (C57BL/6) 1.35 gSbi-III-IV-Ag85b in 200 l 4 150 mM NaCl C3.sup./ (C57BL/6) 200 l 150 mM NaCl (Negative control) 2 C3.sup./ (C57BL/6) 1 g Ag85b in 200 l 150 mM NaCl 3 C3.sup./ (C57BL/6) 1.35 gSbi-III-IV-Acf85b in 200 l 3 150 mM NaCl

Experiment 2 (I.V.)

[0173] To determine if an alternative route of administration would improve the response to Ag85b, mice were immunised by intravenous (I.V.) injection. Animals receiving antigen Ag85b alone were injected with 1 g Ag85b in 50 l 150 mM NaCl and animals receiving Sbi-III-IV-Ag85b were injected with 1.35 g Sbi-III-IV-Ag85b in 50 l 150 mM NaCl. C3.sup./ and CD21.sup./ mice were used as internal negative controls.

[0174] Mice were immunised once at day 0 and boosted at day 28. Serum samples (from approximately 70 l blood) were collected weekly for ELISA analysis until sacrifice by cardiac puncture at day 50. No sample was taken at the boost day 28 due to the I.V. route of the immunisation.

TABLE-US-00008 TABLE 2 Mice used in experiment 2 (I.V.) Genotype Immunisation n= WT (C57BL/6) 1 g Ag85b in 200 l 150 mM NaCl 5 WT (C57BL/6) 1.35 gSbi-III-IV-Ag85b in 200 l 5 150 mM NaCl C3.sup./ (C57BL/6) 1 g Ag85b in 200 l 150 mM NaCl 4 C3.sup./ (C57BL/6) 1.35 gSbi-III-IV-Ag85b in 200 l 4 150 mM NaCl CD21.sup./ (C57BL/6) 1 g Ag85b in 200 l 150 mM NaCl 5 CD21.sup./ (C57BL/6 1.35 gSbi-III-IV-Ag85b in 200 l 5 150 mM NaCl

Experiment 3 (I.P.2)

[0175] To determine if doubling the dose of Sbi-III-IV-Ag85b would improve immune response to Ag85b, mice were immunised by intraperitoneal (I.P.) injection. In this experiment, Ag85b and Sbi-III-IV were also administered together as separate proteins.

[0176] Animals receiving antigen Ag85b alone were injected with 2 g Ag85b in 200 l 150 mM NaCl and animals receiving Sbi-III-IV-Ag85b protein were injected with 2.7 g Sbi-III-IV-Ag85b in 200 l 150 mM NaCl. Mice immunised with Sbi-III-IV and Ag85b as separate proteins were injected with 200 l 150 mM NaCl containing both 0.7 g Sbi-III-IV and 2 g Ag85b, to allow for equivalent amounts of Ag85b. C3.sup./ mice were used as an internal negative control.

[0177] Mice were immunised once at day 0 and boosted at day 28. Serum samples (from approximately 70 l blood) were collected weekly for ELISA analysis until sacrifice by cardiac puncture at day 50.

TABLE-US-00009 TABLE 3 Mice used in experiment 3 (I.P.2) Genotype Immunisation n= WT (C57BL/6) 2.7 gSbi-III-IV-Ag85b in 200 l 150 mM 4 NaCl (Conjugate) WT (C57BL/6) 0.7 gSbi-III-IV plus 2 g Ag85b in 4 200 l 150 mM NaCl (Separate) WT (C57BL/6) 2 g Ag85b in 200 l 150 mM NaCl 2 C3.sup./ (C57BL/6) 2.7 g Sbi-III-IV-Ag85b in 200 l 4 150 mM NaCl (Conjugate) C3.sup./ (C57BL/6) 0.7 gSbi-III-IV plus 2 g Ag85b in 4 200 l 150 mM NaCl (Separate) C3.sup./ (C57BL/6) 2 g Ag85b in 200 l 150 mM NaCl 2

ELISA Assays to Test Immune Response to Ag85b

[0178] 96 well plates (NUNC Maxisorb) were coated with 1 g/ml Ag85b or 1.35 g/ml Sbi-III-IV-Ag85b in carbonate buffer at 50 l per well and incubated at 4 C. overnight. Plates were washed with 0.01% PBS-Tween and a 1% BSA blocking solution was incubated for 1 hour at room temperature and then washed. Serum samples were diluted to 1/50 or 1/100 in 0.01% PBS-Tween, added at 50 l per well and incubated for 1 hour at room temperature. Plates were washed and secondary antibody (sheep anti-mouse IgG HRPO) was added at 1/100 dilution at 50 l per well and incubated for 1 hour at room temperature. TMB substrate was prepared (200 l TMB in DMSO (10 mg/ml), 9.9 ml phosphate-citrate buffer, 3 l H.sub.2O.sub.2). Plates were washed and 50 l per well TMB substrate was added and allowed to develop for 6 minutes. The reaction was stopped with 50 l per well 10% H.sub.2SO.sub.4 and plates were read at 450 nm.

[0179] This was repeated for each serum sample, collected weekly.

[0180] For normalisation purposes, an average baseline Day 0 value was calculated for the entire group of mice and separate Day 0 average values calculated for each individual treatment group. During the course of the study, each data point was normalised to the global Day 0 average of all mice divided by the Day 0 OD450 reading for the relevant treatment group.

Effect of Sbi-III-IV on Th1 Response Against Ag85b

[0181] Male mice were injected intraperitoneally with molar equivalent amounts of either Sbi (n=2), Ag85b (n=3), Sbi-Ag85b (n=3) diluted in PBS, PBS alone (n=3), or Ag85b diluted in the commonly used adjuvant Alum (n=2). See FIG. 9A for a schematic outline of the experiment. All volumes injected were 200 l. Experiments were carried out in two blocks. 5 days after injection, mice were euthanised and spleens removed. Spleens were processed for in vitro splenocyte cultures, and added to 6 well plates (210.sup.6 cells/well) containing dendritic cells (110.sup.6 cells/well; clone DC2.4) that had been primed with 1 g/well of Ag85b 24 hours previously. Cultures were incubated for 72 hrs and supernatant collected for analysis in cytokine specific ELISAs according to manufacturer's instructions (R&D systems). Cells were then treated with 50 ng of PMA (Calbiochem), 500 ng Ionomycin (Sigma) and 1 l of BD Golgi block (BD Biosciences) in fresh media. After a 5 hour incubation period (37 C., 5% CO.sub.2) cells were pelleted, washed in PBS and resuspended in 2.4G2 Fc block (BD Pharmingen) and heat inactivated mouse Ig (both 1/100 in PBS) for 30 minutes on ice.

[0182] Live (Aqua live dead negative) T-Helper cells (Th) were identified using forward and side scatter (singlets) in conjunction with positive reaction with CD3-PE and CD4-PerCP.sup.Cy5.5 antibodies (and negative for CD8-APC.sup.H7) using standard flow cytometry analysis i.e. antibodies were added to each well of a 96 well ELISA plate as required at 1:200 diluted in 25 l flow buffer. 100 l of blocked cells were added to each well and incubated on ice in the dark for 30 minutes. Cells were then fixed in 4% formaldehyde solution for 20 minutes. To stain for intracellular proteins cells were permeabilised in 100 l of BD Perm (BD Biosciences, 15 minute incubation on ice), then incubated with intracellular antibodies (IFN--PE.sup.Cy7 or IgG.sub.2b-APC Isotype control) on ice in the dark for 30 minutes. Finally, cells were resuspended in 250 l of flow buffer and read on the FACS CANTO II machine (BD Biosciences). Flow cytometry data was analysed using FCS express 6 Flow Research Edition software (DeNovo Software). All data is expressed as a percentage relative to numbers of T cells in the PBS control culture and statistical analysis was carried out on GraphPad Prism 7.0.

[0183] Th1 proliferation stimulated by the SbiIII-IV-Ag85b conjugate was significantly higher than that stimulated by Ag85b alone or in combination with alum (FIG. 9C). Secreted IFN- in the tissue culture supernatant of splenocytes primed with Sbi-III-IV-Ag85b was increased by 4 fold compared to cells primed with Ag85b alone (FIG. 9D).

Effect of Sbi-III-IV on Dendritic Cell Activation and Function

[0184] 310.sup.6 healthy donor PBMC, separated by standard density centrifugation, were cultured in RPMI plus 50% autologous serum, in the presence or absence of Poly(I:C) (10 g/ml, Invivogen), Lipopolysaccharide (LPS, 10 ng/ml, Sigma), CL075 (1 g/ml, Invivogen) and CpG (ODN 2216, 7.5 g, Invivogen), with or without SBI (10 g/ml; confirmed endotoxin free). Cells were cultured for 14 hrs at 37 C., 5% CO.sub.2, with addition of Brefeldin A (10 g/ml, eBioscience) after 3 hrs. Cells were stained with Zombie amine dye (Biolegend) for dead cell exclusion (usually <30%), surface markers and then intracellular cytokines after fixation and permeabilization (eBioscience) according to manufacturer's protocol. Analysis was performed with an LSRFortessa X-20 running BD FACSDIVA 8.0.1 software and analysed with FlowJo 10.1r5 (Tree Star, Inc). Graphs were plotted with Prism V5 (GraphPad software Inc).

[0185] The lineage.sup. (CD3,16,19,20) HLA-DR.sup.+ population was identified from within the live, singlet cells. This fraction contained CD14.sup.+ monocytes as well as CD14.sup. dendritic cell (DC) populations. The CD14.sup. DC were subdivided into CD123.sup.+ plasmacytoid dendritic cells (pDC) and the CD123.sup. CD141.sup.+ (cDC1) or CD2.sup.+CD1c.sup.+CD11c.sup.+ (cDC2) classical dendritic cells. Cytokine production was quantified as the percentage of positive cells/parent population.

[0186] Antibodies were from Biolegend (Bio) or BD Biosciences (BD) unless otherwise stated, denoted as antigen-fluorochrome, clone (manufacturer): CD11c-BV711, B-ly6 (BD); CD123-BUV395, 7G3 (BD); CD14-BV650, M5E2 (Bio), CD141-BV510, 1A4 (BD); CD19-AF700, H1B1 (Bio); CD20-AF700, 2H7 (Bio); CD3-AF700, SK7 (Bio); CD16-AF700, 3G8 (Bio); CD1c-PERCP-Cy5.5, L161 (Bio); CD303-BV605, 201A (Bio); CD304-BV605, U21-1283 (BD); HLA0DR-BV780, L243 (Bio); IFNa-PE, LT27:295 (MACS Miltenyi Biotec); IL-10-APC, JES3-9D7 (Bio); IL-12p40/p70-BV421, C8.6 (BD); IL-1b-FITC, JK1B-1 (Bio); IL-8-PE-Cy7, E8N1 (Bio); TNF-APCCy7, Mabll (Bio).

[0187] The adjuvant effect of Sbi-III-IV was investigated by examination of intracellular cytokine production by specific monocyte and dendritic cell subsets in response to a cocktail of TLR agonists (Poly(I:C), Lipopolysaccharide, CL075 and CpG). Culture in the presence of 10 g/ml of Sbi-III-IV increased the percent of cells producing TNF in all cell subsets examined, both with and without the addition of TLR agonist cocktail. In the presence of TLR agonists, Sbi-III-IV potentiated monocyte production of IL-1b and IFN elaboration from plasmacytoid DCs. IL-10 production from monocytes was reduced, thus demonstrating an adjuvant action of Sbi-III-IV on human primary immune effector cells as evidenced by an increase in the production of inflammatory cytokines and reduction of anti-inflammatory IL-10 from monocytes. INFO production from all cells and IFN production from plasmacytoid DCs was also increased, independently of TLR agonist stimulation.

Synthesis of Sbi-III-IV(V80C)-Pn6B Conjugate

[0188] The antigenic polysaccharide Pn6B from the outer protective capsule of the pathogen Streptococcus pneumoniae was chosen as a ligand for functionalisation to Sbi-III-IV protein, as it is a common antigen utilised in vaccine production to prevent infection from S. pneumoniae. Pn6B is a 0.9-1.5 MDa carbohydrate and consists of a repeat unit of (.fwdarw.2--D-Galactopyranose-(1.fwdarw.3)--D-Glucopyranose-(1.fwdarw.3)--L-rhamnopyranose-(1.fwdarw.4)-D-ribitol-5-phosphate.fwdarw.).

[0189] Pn6B (20 mg) was added to 2 mL of water and stirred at room temperature until the carbohydrate had dissolved (3-6 hours). The solution was then loaded onto an ion exchange column (Dowex 50W4-200, tetrabutylammonium form) and incubated for 30 minutes before allowing elution. The fractions containing carbohydrate were pooled and subsequently freeze dried to yield a white solid. The solid was added to 5 mL of anhydrous DMSO and stirred at 30 C. under N2 overnight to dissolve the carbohydrate. An anhydrous DMSO solution (1 mL) of 1,1-carbonyl diimidazole (1-2 mg) was added to the carbohydrate solution and allowed to stir for one hour. Triethylamine (0.05 mL) was added, followed by N-(2-(2-(2-aminoethoxy)ethoxy)-ethyl)-3-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)propanamide (100 mg), and the reaction was left to stir for 2 hours. The solution was transferred to a dialysis bag (12-14 KDa cut-off) and dialysed against 1) 5 litres of 0.1 M sodium phosphate buffer (pH=7), 2) 5 litres of 0.01 M sodium phosphate buffer (pH=7), 3) 5 litres of water. The solution in the dialysis bag was then treated with ion exchange resin (Dowex 50W8-100, H+ form). The resin was removed by centrifugation. The supernatant was freeze dried to yield 24 mg of white solid. A portion of product was analysed by NMR spectroscopy to determine alkylating reagent loading on the carbohydrate. This was determined through the comparison of the integrals of the maleimide's alkene proton signal and the fucose's methane proton signals.

[0190] Sbi-III-IV(V80C) (0.5 mg, 3.5710-2 mmol) was dissolved in deoxygenated sodium phosphate buffer (0.5 mL, 200 mM, pH=7, containing 1 mM EDTA and 5 eq. of THPP). The reactions were incubated at 25 C. for 24 hours. 5-Azido pentanoic acid (5 eq.) was subsequently added to oxidise the remaining phosphine in solution and incubated for 30 minutes. Finally, a deoxygenated solution (0.5 ml, water) of Pn6B-maleimide (0.5 mg) was added to the freshly reduced protein and incubated at ambient temperature for up to 24 hours. SDS PAGE was used to analyse the bio conjugation reaction. Aliquots of the solution (10 L) were added to reducing SDS PAGE loading buffer (10 L). A sample (10 L) of this solution was loaded into a precast gel for SDS PAGE electrophoresis (Invitrogen, NuPage 4-12% Bis-Tris gradient gel, NuPage MOPS SDS running buffer, Bio Rad PowerPac HV, 200 V, 45-55 minutes). The gel was subsequently stained with Coomassie stain, followed by soaking in a destaining solution (water:ethanol:acetic acid, 16:3:1). The presence of stained material within the loading wells of the gel provides a positive indication of a high molecular weight carbohydrate-protein conjugate. Size exclusion high performance liquid chromatography (SEC-HPLC) was also utilised to confirm conjugate production. A sample (10 L) of the reaction was injected into a Dionex Ultimate 3000 HPLC instrument equipped with a TOSOH TSKgel SEC-column (G5000PWXL, 7.8 mm I.D.30.0 cm L). The sample was eluted at 0.5 ml/min with sodium phosphate buffer (50 mM, pH=7), containing sodium chloride (150 mM), with the detector set at 280 nm. The conjugate is represented by a broad peak, eluting from 12-20 minutes, while the unreacted Sbi protein elutes at 23-24 minutes.

[0191] The conjugation reaction was quenched by the addition of cysteamine (5 mM) and the unreacted Sbi protein in the reaction mixture was removed spin filter centrifugation (30 kDa cut-off membrane).

In Vitro Complement Activation by Sbi-III-IV(V80C)-Pn6B

[0192] The Wielisa total complement system screen (Wieslab), described by Seelen et al. was used to detect depletion by Sbi-III-IV, Pn6B and Sbi-III-IV(V80C)-Pn6B of the classical (CP), mannose-binding lectin (MBLP), and alternative (AP) complement pathways. 1 g of Sbi or the Sbi conjugate was added per 1 l of human serum (positive control serum, supplied with the kit), and assayed for complement activity after 30 min of preincubation at 37 C. The assay was completed in duplicate, according to the manufacturer's instructions, and included a blank, a positive control (human serum from healthy individuals), and a negative control (heat-inactivated serum). Residual complement activity inhibition (i.e. complement activity remaining after depletion) was quantified from the absorbance at 405 nm using the equation: (samplenegative control)/(positive controlnegative control)100%.

T Cell Activation by Exposure to Sbi-III-IV(V80C)-Pn6B

[0193] Peripheral blood donated by a healthy human volunteer was heparinised (10 Units/ml) in syringes and mixed at a 1:1 ratio with RPMI 1640 medium. 35 ml of blood/RPMI was layered on top of 15 ml Lymphoprep (Greiner Bio One) in 50 ml Falcon tubes. These were centrifuged for 30 minutes at 1500 RPM with the brake off on deceleration. The Peripheral blood mononuclear cell (PBMC) layer was then extracted from the tube using a Pasteur pipette and washed three times in RPMI 1640 medium. PBMCs were re-suspended in RPMI medium+10% human serum with complement. PBMC's were then treated with 200 l of Sbi-III-IV or the Sbi-III-IV(V80C)-Pn6B conjugate protein (10 g/ml), then incubated at 37 C. (5% CO2) for 24 hours. Cells were then washed once in cold PBS, suspended in 100 l PBS and then treated with 10 l labelled antibody (anti-CD69). The antibody labelled cells were then incubation at 4 C. for 30 minutes, then washed twice in ice cold PBS, re-suspended in 400 l PBS and analysed using a FACSCanto flow cytometer (BD Bioscience) and processed using DIVA software.

[0194] CD69 is an important indicator of T cell activation. Exposure of lymphocytes to the Sbi-III-IV(V80C)-Pn6B conjugate resulted in a significant increase in surface expression of CD69 compared to unconjugated Pn6B antigen, indicating enhanced T cell response against the conjugate compared to the unconjugated antigen (data not shown).

[0195] While the invention has been described in conjunction with the exemplary embodiments described above, many equivalent modifications and variations will be apparent to those skilled in the art when given this disclosure. Accordingly, the exemplary embodiments of the invention set forth are considered to be illustrative and not limiting. Various changes to the described embodiments may be made without departing from the spirit and scope of the invention. All documents cited herein are expressly incorporated by reference.