Mice expressing a limited immunoglobulin light chain repertoire

10412940 ยท 2019-09-17

Assignee

Inventors

Cpc classification

International classification

Abstract

A genetically modified mouse is provided, wherein the mouse expresses an immunoglobulin light chain repertoire characterized by a limited number of light chain variable domains. Mice are provided that present a choice of two human light chain variable gene segments such that the immunoglobulin light chains expresses by the mouse comprise one of the two human light chain variable gene segments. Methods for making bispecific antibodies having universal light chains using mice as described herein, including human light chain variable regions, are provided. Methods for making human variable regions suitable for use in multispecific binding proteins, e.g., bispecific antibodies, and host cells are provided.

Claims

1. A method for generating a human immunoglobulin heavy or light chain variable domain sequence comprising the steps of: (a) immunizing a genetically modified mouse with an antigen of interest, wherein the genetically modified mouse comprises in its germline genome: (i) exactly two unrearranged human immunoglobulin V gene segments and five unrearranged human immunoglobulin J gene segments operably linked to a mouse immunoglobulin light chain constant region sequence at the endogenous kappa light chain loci of the mouse, wherein the two unrearranged human immunoglobulin V gene segments are a human V1-39 gene segment and a human V3-20 gene segment; and (ii) one or more unrearranged human immunoglobulin V.sub.H gene segments, one or more unrearranged human immunoglobulin D.sub.H gene segments, and one or more unrearranged human immunoglobulin J.sub.H gene segments operably linked to a mouse immunoglobulin heavy chain constant region sequence at the endogenous heavy chain loci of the mouse; wherein the unrearranged human immunoglobulin heavy chain and kappa light chain gene segments of the genetically modified mouse are capable of rearranging and encoding human immunoglobulin variable domains of an antibody, wherein the genetically modified mouse does not comprise endogenous immunoglobulin V or J gene segments that are capable of rearranging to form an immunoglobulin light chain variable region sequence; and (b) determining a human immunoglobulin heavy or light chain variable domain sequence of an antibody that specifically binds the antigen and that was generated by the genetically modified mouse.

2. The method of claim 1, wherein determining the human immunoglobulin heavy or light chain variable domain sequence comprises determining a nucleotide sequence that encodes the human immunoglobulin heavy or light chain variable domain sequence.

3. The method of claim 1, wherein the five unrearranged human immunoglobulin J gene segments are a human J1 gene segment, a human J2 gene segment, a human J3 gene segment, a human J4 gene segment, and a human J5 gene segment.

4. The method of claim 1, wherein the human V1-39 gene segment in the germline genome of the genetically modified mouse is a human germline V1-39 gene segment and the human V3-20 gene segment in the germline genome of the genetically modified mouse is a human germline V3-20 gene segment.

5. The method of claim 1, wherein the germline genome of the genetically modified mouse comprises in order: the human V1-39 gene segment, the human V3-20 gene segment, the human J1 gene segment, the human J2 gene segment, the human J3 gene segment, the human J4 gene segment, and the human J5 gene segment.

6. The method of claim 1, wherein the genetically modified mouse comprises a nonfunctional light chain locus.

7. The method of claim 1, wherein the genetically modified mouse comprises a functional light chain locus.

8. A method of making a fully human immunoglobulin heavy chain or a fully human immunoglobulin light chain comprising the steps of: (a) immunizing a genetically modified mouse with an antigen of interest, wherein the genetically modified mouse comprises in its germline genome: (i) exactly two unrearranged human immunoglobulin V gene segments and five unrearranged human immunoglobulin J gene segments operably linked to a mouse immunoglobulin light chain constant region sequence at the endogenous kappa light chain loci of the mouse, wherein the two unrearranged human immunoglobulin V gene segments are a human V1-39 gene segment and a human V3-20 gene segment; and (ii) one or more unrearranged human immunoglobulin V.sub.H gene segments, one or more unrearranged human immunoglobulin D.sub.H gene segments, and one or more unrearranged human immunoglobulin J.sub.H gene segments operably linked to a mouse immunoglobulin heavy chain constant region sequence at the endogenous heavy chain loci of the mouse; wherein the unrearranged human immunoglobulin heavy chain and kappa light chain gene segments of the genetically modified mouse are capable of rearranging and encoding human immunoglobulin variable domains of an antibody, wherein the genetically modified mouse does not comprise endogenous immunoglobulin V or J gene segments that are capable of rearranging to form an immunoglobulin light chain variable region sequence; (b) determining a human immunoglobulin heavy or light chain variable domain sequence of an antibody that specifically binds the antigen and that was generated by the genetically modified mouse; and (c) operably linking the human immunoglobulin heavy or light chain variable domain sequence to a human immunoglobulin heavy or light chain constant domain sequence, respectively, to form a fully human immunoglobulin heavy chain or a fully human immunoglobulin light chain.

9. The method of claim 8, wherein determining the human immunoglobulin heavy or light chain variable domain sequence comprises determining a nucleotide sequence that encodes the human immunoglobulin heavy or light chain variable domain sequence.

10. The method of claim 8, wherein operably linking the human immunoglobulin heavy or light chain variable domain sequence to the human immunoglobulin heavy or light chain constant domain sequence, respectively, comprises operably linking a nucleotide sequence encoding the human immunoglobulin heavy or light chain variable domain sequence to a nucleotide sequence encoding the human immunoglobulin heavy or light chain constant domain sequence.

11. The method of claim 8, wherein the five unrearranged human immunoglobulin J gene segments are a human J1 gene segment, a human J2 gene segment, a human J3 gene segment, a human J4 gene segment, and a human J5 gene segment.

12. The method of claim 8, wherein the human V1-39 gene segment in the germline genome of the genetically modified mouse is a human germline V1-39 gene segment and the human V3-20 gene segment in the germline genome of the genetically modified mouse is a human germline V3-20 gene segment.

13. The method of claim 8, wherein the germline genome of the genetically modified mouse comprises in order: the human V1-39 gene segment, the human V3-20 gene segment, the human J1 gene segment, the human J2 gene segment, the human J3 gene segment, the human J4 gene segment, and the human J5 gene segment.

14. The method of claim 8, wherein the genetically modified mouse comprises a nonfunctional light chain locus.

15. The method of claim 8, wherein the genetically modified mouse comprises a functional light chain locus.

Description

BRIEF DESCRIPTION OF FIGURES

(1) FIG. 1 illustrates a targeting strategy for replacing endogenous mouse immunoglobulin light chain variable region gene segments with a human V1-39J5 gene region.

(2) FIG. 2 illustrates a targeting strategy for replacing endogenous mouse immunoglobulin light chain variable region gene segments with a human V3-20J1 gene region.

(3) FIG. 3 illustrates a targeting strategy for replacing endogenous mouse immunoglobulin light chain variable region gene segments with a human VpreB/J5 gene region.

(4) FIG. 4 shows the percent of CD19.sup.+ B cells (y-axis) from peripheral blood for wild type mice (WT), mice homozygous for an engineered human rearranged V1-39J5 light chain region (V1-39J5 HO) and mice homozygous for an engineered human rearranged V3-20J1 light chain region (V3-20J1 HO).

(5) FIG. 5A shows the relative mRNA expression (y-axis) of a V1-39-derived light chain in a quantitative PCR assay using probes specific for the junction of an engineered human rearranged V1-39J5 light chain region (V1-39J5 Junction Probe) and the human V1-39 gene segment (V1-39 Probe) in a mouse homozygous for a replacement of the endogenous V and J gene segments with human V and J gene segments (H), a wild type mouse (WT), and a mouse heterozygous for an engineered human rearranged V1-39J5 light chain region (V1-39J5 HET). Signals are normalized to expression of mouse C. N.D.: not detected.

(6) FIG. 5B shows the relative mRNA expression (y-axis) of a V1-39-derived light chain in a quantitative PCR assay using probes specific for the junction of an engineered human rearranged V1-39J5 light chain region (V1-39J5 Junction Probe) and the human V1-39 gene segment (V1-39 Probe) in a mouse homozygous for a replacement of the endogenous V and J gene segments with human V and J gene segments (H), a wild type mouse (WT), and a mouse homozygous for an engineered human rearranged V1-39J5 light chain region (V1-39J5 HO). Signals are normalized to expression of mouse C.

(7) FIG. 5C shows the relative mRNA expression (y-axis) of a V3-20-derived light chain in a quantitative PCR assay using probes specific for the junction of an engineered human rearranged V3-20J1 light chain region (V3-20J1 Junction Probe) and the human V3-20 gene segment (V3-20 Probe) in a mouse homozygous for a replacement of the endogenous V and J gene segments with human V and J gene segments (H), a wild type mouse (WT), and a mouse heterozygous (HET) and homozygous (HO) for an engineered human rearranged V3-20J1 light chain region. Signals are normalized to expression of mouse C.

(8) FIG. 6A shows IgM (left) and IgG (right) titer in wild type (WT; N=2) and mice homozygous for an engineered human rearranged V1-39J5 light chain region (V1-39J5 HO; N=2) immunized with -galatosidase.

(9) FIG. 6B shows total immunoglobulin (IgM, IgG, IgA) titer in wild type (WT; N=5) and mice homozygous for an engineered human rearranged V3-20J1 light chain region (V3-20J1 HO; N=5) immunized with -galatosidase.

(10) FIG. 7A shows a schematic of monospecific antibodies (Parent-1 and Parent-2) and a bispecific antibody (Bispecific) constructed from heavy chain variable regions from each parent monospecific antibody. A common light chain variable region (darkened) is indicated in the bispecific antibody.

(11) FIG. 7B shows a schematic for the binding characteristics of two parent monoclonal antibodies (Parent-1 and Parent-2) for an antigen of interest, as well as the binding characteristic of a bispecific antibody constructed from pairing the heavy chain variable regions from each monospecific parent antibody with a common light chain. The capability of the bispecific antibody to bind to two distinct epitopes of the antigen of interest either separately (bottom left) or simultaneously (bottom right) is indicated.

(12) FIG. 8 shows a bar graph of the binding of 300 nM bispecific (darkened bars) and monospecific (striped and gray bars) antibodies to a captured monomeric Antigen E surface in BIACORE units (RU). Monoclonal parent-1 antibody (P1 Ab), monoclonal parent-2 (P2 Ab) and bispecific antibodies (BsAb) are indicated.

(13) FIG. 9 shows two genetically modified endogenous immunoglobulin light chain (e.g., K light chain) loci. The locus on the top (DLC-5J) contains an engineered human DNA fragment (striped line) containing two human V gene segments and five human J gene segments. The locus on the bottom (DLC-1J) contains an engineered human DNA fragment (striped line) containing two human V gene segments and one human J gene segment. Each locus is capable of rearranging to form a human V region operably linked to an endogenous light chain constant region (e.g., a C). Immunoglobulin promoters (arrow above locus), leader exons (closed arrows), and the two human V gene segments (open arrows), all flanked upstream (5) by a neomycin cassette containing Frt recombination sites are shown. Recombination signal sequences engineered with each of the human gene segments (V and J) are indicated by open ovals juxtaposed with each gene segment.

(14) FIG. 10A, in the top panel, shows representative contour plots of bone marrow stained for B and T cells (CD19.sup.+ and CD3.sup.+, respectively) from a wild type mouse (WT) and a mouse homozygous for two human V and five human J gene segments (DLC-5J). The bottom panel shows representative contour plots of bone marrow gated on CD19.sup.+ and stained for ckit.sup.+ and CD43.sup.+ from a wild type mouse (WT) and a mouse homozygous for two human V and five human J gene segments (DLC-5J). Pro and Pre B cells are noted on the contour plots of the bottom panel.

(15) FIG. 10B shows the number of Pro (CD19.sup.+CD43.sup.+ckit.sup.+) and Pre (CD19.sup.+CD43.sup.ckit.sup.) B cells in bone marrow harvested from the femurs of wild type mice (WT) and mice homozygous for two human V and five human J gene segments (DLC-5J).

(16) FIG. 11A shows representative contour plots of bone marrow gated on singlets stained for immunoglobulin M (IgM) and B220 from a wild type mouse (WT) and a mouse homozygous for two human V and five human J gene segments (DLC-5J). Immature, mature and pro/pre B cells are noted on each of the contour plots.

(17) FIG. 11B shows the total number of B (CD19.sup.+), immature B (B220.sup.intIgM.sup.+) and mature B (B220.sup.hiIgM.sup.+) cells in bone marrow isolated from the femurs of wild type mice (WT) and mice homozygous for two human V and five human J gene segments (DLC-5J).

(18) FIG. 12A shows representative contour plots of bone marrow gated on singlets stained for immunoglobulin M (IgM) and B220 from a wild type mouse (WT) and a mouse homozygous for two human V and five human J gene segments (DLC-5J). Immature, mature and pro/pre B cells are noted on each of the contour plots.

(19) FIG. 12B shows representative contour plots of bone marrow gated on immature (B220.sup.intIgM.sup.+) and mature (B220.sup.hiIgM.sup.+) B cells stained for Ig and Ig expression isolated from the femurs of a wild type mouse (WT) and a mouse homozygous for two human V and five human J gene segments (DLC-5J).

(20) FIG. 13A, in the top panel, shows representative contour plots of splenocytes gated on singlets and stained for B and T cells (CD19.sup.+ and CD3.sup.+, respectively) from a wild type mouse (WT) and a mouse homozygous for two human V and five human J gene segments (DLC-5J). The bottom panel shows representative contour plots of splenocytes gated on CD19.sup.+ and stained for immunoglobulin D (IgD) and immunoglobulin M (IgM) from a wild type mouse (WT) and a mouse homozygous for two human V and five human J gene segments (DLC-5J). Mature (54 for WT, 56.9 for DLC-5J) and transitional (23.6 for WT, 25.6 for DLC-5J) B cells are noted on each of the contour plots.

(21) FIG. 13B shows the total number of CD19.sup.+ B cells, transitional B cells (CD19.sup.+IgM.sup.hiIgD.sup.lo) and mature B cells (CD19.sup.+IgM.sup.loIgD.sup.hi) in harvested spleens from wild type mice (WT) and mice homozygous for two human V and five human J gene segments (DLC-5J).

(22) FIG. 14A shows representative contour plots of Ig.sup.+ and Ig.sup.+ splenocytes gated on CD19.sup.+ from a wild type mouse (WT) and a mouse homozygous for two human V and five human J gene segments (DLC-5J).

(23) FIG. 14B shows the total number of B cells (CD19.sup.+), Ig.sup.+ B cells (CD19.sup.+Ig.sup.+) and Ig.sup.+ B cells (CD19.sup.+Ig.sup.+) in harvested spleens from wild type (WT) and mice homozygous for two human V and five human J gene segments (DLC-5J).

(24) FIG. 15A shows the peripheral B cell development in mice homozygous for two human V and five human J gene segments. The first (far left) contour plot shows CD93.sup.30 and B220.sup.+ splenocytes gated on CD19.sup.+ indicating immature (39.6) and mature (57.8) B cells. The second (top middle) contour plot shows IgM.sup.+ and CD23.sup.+ expression in immature B cells indicating T1 (33.7; IgD-IgM.sup.+CD21.sup.loCD23.sup.), T2 (21.2; IgD.sup.hiIgM.sup.hiCD21.sup.midCD23.sup.+) and T3 (29.1) B cell populations. The third (bottom middle) contour plot shows CD21.sup.+ (CD35) and IgM.sup.+ expression of mature B cells indicating a small population (14.8) which give rise to marginal zone B cells and a second population (70.5) which gives rise to follicular (FO) B cells. The fourth (top right) contour plot shows B220.sup.+ and CD23.sup.+ expression in mature B cells indicating marginal zone (90.5; MZ) and marginal zone precursor (7.3; IgM.sup.hiIgD.sup.hiCD21.sup.hiCD23.sup.+) B cell populations. The fifth (bottom right) contour plot shows IgD.sup.+ and IgM.sup.+ expression in mature B cells indicating FO-I (79.0; IgD.sup.hiIgM.sup.loCD21.sup.midCD23.sup.+) and FO-II (15.1; IgD.sup.hiIgM.sup.hiCD21.sup.midCD23.sup.+) B cell populations. Percentage of cells within each gated region is shown.

(25) FIG. 15B shows the peripheral B cell development in wild type mice. The first (far left) contour plot shows CD93.sup.30 and B220.sup.+ splenocytes gated on CD19.sup.+ indicating immature (31.1) and mature (64.4) B cells. The second (top middle) contour plot shows IgM.sup.+ and CD23.sup.+ expression in immature B cells indicating T1 (28.5; IgD.sup.IgM.sup.+CD21.sup.loCD23.sup.), T2 (28.7; IgD.sup.hiIgM.sup.hiCD21.sup.midCD23.sup.+) and T3 (30.7) B cell populations. The third (bottom middle) contour plot shows CD21.sup.+ (CD35.sup.+) and IgM.sup.+ expression of mature B cells indicating a small population (7.69) which give rise to marginal zone B cells and a second population (78.5) which gives rise to follicular (FO) B cells. The fourth (top right) contour plot shows B220 and CD23.sup.+ expression in mature B cells indicating marginal zone (79.9; MZ) and marginal zone precursor (19.4; IgM.sup.hiIgD.sup.hiCD21.sup.hiCD23.sup.+) B cell populations. The fifth (bottom right) contour plot shows IgD.sup.+ and IgM.sup.+ expression in mature B cells indicating FO-I (83.6; IgD.sup.hiIgM.sup.loCD21.sup.midCD23.sup.+) and FO-II (13.1; IgD.sup.hiIgM.sup.hiCD21.sup.midCD23.sup.+) B cell populations. Percentage of cells within each gated region is shown.

(26) FIG. 16 shows the total number of transitional, marginal zone and follicular B cell populations in harvested spleens of wild-type (WT) and mice homozygous for two human V and five human J gene segments (DLC-5J).

(27) FIG. 17 shows the relative mRNA expression in bone marrow (y-axis) of V3-20-derived and V1-39-derived light chains in a quantitative PCR assay using probes specific for V3-20 or V1-39 gene segments in mice homozygous for a replacement of the endogenous V and J gene segments with human V and J gene segments (H), wild type mice (WT), mice homozygous for two human V gene segments and five human J gene segments (DLC-5J) and mice homozygous for two human V gene segments and one human J gene segment (DLC-1J). Signals are normalized to expression of mouse C. ND: not detected.

(28) FIG. 18 shows the relative mRNA expression in whole spleens (y-axis) of V3-20-derived and V1-39-derived light chains in a quantitative PCR assay using probes specific for V3-20 or V1-39 gene segments in mice homozygous for a replacement of the endogenous V and J gene segments with human V and J gene segments (H), wild type mice (WT), mice homozygous for two human V gene segments and five human J gene segments (DLC-5J) and mice homozygous for two human V gene segments and one human J gene segment (DLC-1J). Signals are normalized to expression of mouse C. ND: not detected.

(29) FIG. 19 shows a general illustration of recombination of a V and a J gene segment of an immunoglobulin light chain allele in a mouse and the structure of the light chain locus before rearrangement (top) and after rearrangement (bottom). Such a rearrangement as shown is only one of several possible rearrangement events.

DETAILED DESCRIPTION

(30) This invention is not limited to particular methods, and experimental conditions described, as such methods and conditions may vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention is defined by the claims.

(31) Unless defined otherwise, all terms and phrases used herein include the meanings that the terms and phrases have attained in the art, unless the contrary is clearly indicated or clearly apparent from the context in which the term or phrase is used. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, particular methods and materials are now described. All publications mentioned are hereby incorporated by reference in their entirety.

(32) The term antibody, as used herein, includes immunoglobulin molecules comprising four polypeptide chains, two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds. Each heavy chain comprises a heavy chain variable (V.sub.H) region and a heavy chain constant region (C.sub.H). The heavy chain constant region comprises three domains, C.sub.H1, C.sub.H2 and C.sub.H3. Each light chain comprises a light chain variable (V.sub.L) region and a light chain constant region (C.sub.L). The V.sub.H and V.sub.L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each V.sub.H and V.sub.L comprises three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4 (heavy chain CDRs may be abbreviated as HCDR1, HCDR2 and HCDR3; light chain CDRs may be abbreviated as LCDR1, LCDR2 and LCDR3. The term high affinity antibody refers to an antibody that has a K.sub.D with respect to its target epitope about of 10.sup.9 M or lower (e.g., about 110.sup.9 M, 110.sup.10 M, 110.sup.11 M, or about 110.sup.12 M). In one embodiment, K.sub.D is measured by surface plasmon resonance, e.g., BIACORE; in another embodiment, K.sub.D is measured by ELISA.

(33) The phrase bispecific antibody refers to an antibody capable of selectively binding two or more epitopes. Bispecific antibodies include fragments of two different monoclonal antibodies (FIG. 7A) and generally comprise two nonidentical heavy chains derived from the two different monoclonal antibodies, with each heavy chain specifically binding a different epitope-either on two different molecules (e.g., different epitopes on two different immunogens; see FIG. 7B, bottom left) or on the same molecule (e.g., different epitopes on the same immunogen; see FIG. 7B, bottom right). If a bispecific antibody is capable of selectively binding two different epitopes (a first epitope and a second epitope), the affinity of the first heavy chain for the first epitope will generally be at least one to two or three or four or more orders of magnitude lower than the affinity of the first heavy chain for the second epitope, and vice versa. Epitopes specifically bound by the bispecific antibody can be on the same or a different target (e.g., on the same or a different protein; see FIG. 7B). Exemplary bispecific antibodies include those with a first heavy chain specific for a tumor antigen and a second heavy chain specific for a cytotoxic marker, e.g., an Fc receptor (e.g., FcRI, FcRII, FcRII, etc.) or a T cell marker (e.g., CD3, CD28, etc.). Further, the second heavy chain variable region can be substituted with a heavy chain variable region having a different desired specificity. For example, a bispecific antibody with a first heavy chain specific for a tumor antigen and a second heavy chain specific for a toxin can be paired so as to deliver a toxin (e.g., saporin, vinca alkaloid, etc.) to a tumor cell. Other exemplary bispecific antibodies include those with a first heavy chain specific for an activating receptor (e.g., B cell receptor, FcRI, FcRIIA, FcRIIIA, FcRI, T cell receptor, etc.) and a second heavy chain specific for an inhibitory receptor (e.g., FcRIIB, CD5, CD22, CD72, CD300a, etc.). Such bispecific antibodies can be constructed for therapeutic conditions associated with cell activation (e.g. allergy and asthma). Bispecific antibodies can be made, for example, by combining heavy chains that recognize different epitopes of the same or different immunogen (FIG. 7B). For example, nucleic acid sequences encoding heavy chain variable sequences that recognize different epitopes of the same or different immunogen can be fused to nucleic acid sequences encoding the same or different heavy chain constant regions, and such sequences can be expressed in a cell that expresses an immunoglobulin light chain. A typical bispecific antibody has two heavy chains each having three heavy chain CDRs, followed by (N-terminal to C-terminal) a C.sub.H1 domain, a hinge, a C.sub.H2 domain, and a C.sub.H3 domain, and an immunoglobulin light chain that either does not confer epitope-binding specificity but that can associate with each heavy chain, or that can associate with each heavy chain and that can bind one or more of the epitopes bound by the heavy chain epitope-binding regions, or that can associate with each heavy chain and enable binding or one or both of the heavy chains to one or both epitopes.

(34) The term cell includes any cell that is suitable for expressing a recombinant nucleic acid sequence. Cells include those of prokaryotes and eukaryotes (single-cell or multiple-cell), bacterial cells (e.g., strains of E. coli, Bacillus spp., Streptomyces spp., etc.), mycobacteria cells, fungal cells, yeast cells (e.g., S. cerevisiae, S. pombe, P. pastoris, P. methanolica, etc.), plant cells, insect cells (e.g., SF-9, SF-21, baculovirus-infected insect cells, Trichoplusia ni, etc.), non-human animal cells, human cells, or cell fusions such as, for example, hybridomas or quadromas. In some embodiments, the cell is a human, monkey, ape, hamster, rat, or mouse cell. In some embodiments, the cell is eukaryotic and is selected from the following cells: CHO (e.g., CHO K1, DXB-11 CHO, Veggie-CHO), COS (e.g., COS-7), retinal cell, Vero, CV1, kidney (e.g., HEK293, 293 EBNA, MSR 293, MDCK, HaK, BHK), HeLa, HepG2, WI38, MRC 5, Colo205, HB 8065, HL-60, (e.g., BHK21), Jurkat, Daudi, A431 (epidermal), CV-1, U937, 3T3, L cell, C127 cell, SP2/0, NS-0, MMT 060562, Sertoli cell, BRL 3A cell, HT1080 cell, myeloma cell, tumor cell, and a cell line derived from an aforementioned cell. In some embodiments, the cell comprises one or more viral genes, e.g., a retinal cell that expresses a viral gene (e.g., a PER.C6 cell).

(35) The phrase complementarity determining region, or the term CDR, includes an amino acid sequence encoded by a nucleic acid sequence of an organism's immunoglobulin genes that normally (i.e., in a wild type animal) appears between two framework regions in a variable region of a light or a heavy chain of an immunoglobulin molecule (e.g., an antibody or a T cell receptor). A CDR can be encoded by, for example, a germline sequence or a rearranged or unrearranged sequence, and, for example, by a naive or a mature B cell or a T cell. A CDR can be somatically mutated (e.g., vary from a sequence encoded in an animal's germline), humanized, and/or modified with amino acid substitutions, additions, or deletions. In some circumstances (e.g., for a CDR3), CDRs can be encoded by two or more sequences (e.g., germline sequences) that are not contiguous (e.g., in an unrearranged nucleic acid sequence) but are contiguous in a B cell nucleic acid sequence, e.g., as the result of splicing or connecting the sequences (e.g., V-D-J recombination to form a heavy chain CDR3).

(36) The term conservative, when used to describe a conservative amino acid substitution, includes substitution of an amino acid residue by another amino acid residue having a side chain R group with similar chemical properties (e.g., charge or hydrophobicity). In general, a conservative amino acid substitution will not substantially change the functional properties of interest of a protein, for example, the ability of a variable region to specifically bind a target epitope with a desired affinity. Examples of groups of amino acids that have side chains with similar chemical properties include aliphatic side chains such as glycine, alanine, valine, leucine, and isoleucine; aliphatic-hydroxyl side chains such as serine and threonine; amide-containing side chains such as asparagine and glutamine; aromatic side chains such as phenylalanine, tyrosine, and tryptophan; basic side chains such as lysine, arginine, and histidine; acidic side chains such as aspartic acid and glutamic acid; and, sulfur-containing side chains such as cysteine and methionine. Conservative amino acids substitution groups include, for example, valine/leucine/isoleucine, phenylalanine/tyrosine, lysine/arginine, alanine/valine, glutamate/aspartate, and asparagine/glutamine. In some embodiments, a conservative amino acid substitution can be substitution of any native residue in a protein with alanine, as used in, for example, alanine scanning mutagenesis. In some embodiments, a conservative substitution is made that has a positive value in the PAM250 log-likelihood matrix disclosed in Gonnet et al. (1992) Exhaustive Matching of the Entire Protein Sequence Database, Science 256:1443-45, hereby incorporated by reference. In some embodiments, the substitution is a moderately conservative substitution wherein the substitution has a nonnegative value in the PAM250 log-likelihood matrix.

(37) In some embodiments, residue positions in an immunoglobulin light chain or heavy chain differ by one or more conservative amino acid substitutions. In some embodiments, residue positions in an immunoglobulin light chain or functional fragment thereof (e.g., a fragment that allows expression and secretion from, e.g., a B cell) are not identical to a light chain whose amino acid sequence is listed herein, but differs by one or more conservative amino acid substitutions.

(38) The phrase epitope-binding protein includes a protein having at least one CDR and that is capable of selectively recognizing an epitope, e.g., is capable of binding an epitope with a K.sub.D that is at about one micromolar or lower (e.g., a K.sub.D that is about 110.sup.6 M, 110.sup.7 M, 110.sup.9 M, 110.sup.9 M, 110.sup.10 M, 110.sup.11 M, or about 110.sup.12 M). Therapeutic epitope-binding proteins (e.g., therapeutic antibodies) frequently require a K.sub.D that is in the nanomolar or the picomolar range.

(39) The phrase functional fragment includes fragments of epitope-binding proteins that can be expressed, secreted, and specifically bind to an epitope with a K.sub.D in the micromolar, nanomolar, or picomolar range. Specific recognition includes having a K.sub.D that is at least in the micromolar range, the nanomolar range, or the picomolar range.

(40) The term germline includes reference to an immunoglobulin nucleic acid sequence in a non-somatically mutated cell, e.g., a non-somatically mutated B cell or pre-B cell or hematopoietic cell.

(41) The phrase heavy chain, or immunoglobulin heavy chain includes an immunoglobulin heavy chain constant region sequence from any organism. Heavy chain variable domains include three heavy chain CDRs and four FR regions, unless otherwise specified. Fragments of heavy chains include CDRs, CDRs and FRs, and combinations thereof. A typical heavy chain has, following the variable domain (from N-terminal to C-terminal), a C.sub.H1 domain, a hinge, a C.sub.H2 domain, and a C.sub.H3 domain. A functional fragment of a heavy chain includes a fragment that is capable of specifically recognizing an epitope (e.g., recognizing the epitope with a K.sub.D in the micromolar, nanomolar, or picomolar range), that is capable of expressing and secreting from a cell, and that comprises at least one CDR.

(42) The term identity when used in connection with sequence includes identity as determined by a number of different algorithms known in the art that can be used to measure nucleotide and/or amino acid sequence identity. In some embodiments described herein, identities are determined using a ClustalW v. 1.83 (slow) alignment employing an open gap penalty of 10.0, an extend gap penalty of 0.1, and using a Gonnet similarity matrix (MACVECTOR 10.0.2, MacVector Inc., 2008). The length of the sequences compared with respect to identity of sequences will depend upon the particular sequences, but in the case of a light chain constant domain, the length should contain sequence of sufficient length to fold into a light chain constant domain that is capable of self-association to form a canonical light chain constant domain, e.g., capable of forming two beta sheets comprising beta strands and capable of interacting with at least one C.sub.H1 domain of a human or a mouse. In the case of a C.sub.H1 domain, the length of sequence should contain sequence of sufficient length to fold into a C.sub.H1 domain that is capable of forming two beta sheets comprising beta strands and capable of interacting with at least one light chain constant domain of a mouse or a human.

(43) The phrase immunoglobulin molecule includes two immunoglobulin heavy chains and two immunoglobulin light chains. The heavy chains may be identical or different, and the light chains may be identical or different.

(44) The phrase light chain includes an immunoglobulin light chain sequence from any organism, and unless otherwise specified includes human and light chains and a VpreB, as well as surrogate light chains. Light chain variable (V.sub.L) domains typically include three light chain CDRs and four framework (FR) regions, unless otherwise specified. Generally, a full-length light chain includes, from amino terminus to carboxyl terminus, a V.sub.L domain that includes FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4, and a light chain constant domain. Light chains include those, e.g., that do not selectively bind either a first or a second epitope selectively bound by the epitope-binding protein in which they appear. Light chains also include those that bind and recognize, or assist the heavy chain with binding and recognizing, one or more epitopes selectively bound by the epitope-binding protein in which they appear. Common light chains are those derived from a rearranged human V1-39J5 sequence or a rearranged human V3-20J1 sequence, and include somatically mutated (e.g., affinity matured) versions.

(45) The phrase micromolar range is intended to mean 1-999 micromolar; the phrase nanomolar range is intended to mean 1-999 nanomolar; the phrase picomolar range is intended to mean 1-999 picomolar.

(46) The phrase somatically mutated includes reference to a nucleic acid sequence from a B cell that has undergone class-switching, wherein the nucleic acid sequence of an immunoglobulin variable region (e.g., a heavy chain variable domain or including a heavy chain CDR or FR sequence) in the class-switched B cell is not identical to the nucleic acid sequence in the B cell prior to class-switching, such as, for example, a difference in a CDR or framework nucleic acid sequence between a B cell that has not undergone class-switching and a B cell that has undergone class-switching. Somatically mutated includes reference to nucleic acid sequences from affinity-matured B cells that are not identical to corresponding immunoglobulin variable region sequences in B cells that are not affinity-matured (i.e., sequences in the genome of germline cells). The phrase somatically mutated also includes reference to an immunoglobulin variable region nucleic acid sequence from a B cell after exposure of the B cell to an epitope of interest, wherein the nucleic acid sequence differs from the corresponding nucleic acid sequence prior to exposure of the B cell to the epitope of interest. The phrase somatically mutated refers to sequences from antibodies that have been generated in an animal, e.g., a mouse having human immunoglobulin variable region nucleic acid sequences, in response to an immunogen challenge, and that result from the selection processes inherently operative in such an animal.

(47) The term unrearranged, with reference to a nucleic acid sequence, includes nucleic acid sequences that exist in the germline of an animal cell.

(48) The phrase variable domain includes an amino acid sequence of an immunoglobulin light or heavy chain (modified as desired) that comprises the following amino acid regions, in sequence from N-terminal to C-terminal (unless otherwise indicated): FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.

(49) Universal Light Chain

(50) Prior efforts to make useful multispecific epitope-binding proteins, e.g., bispecific antibodies, have been hindered by variety of problems that frequently share a common paradigm: in vitro selection or manipulation of sequences to rationally engineer, or to engineer through trial-and-error, a suitable format for pairing a heterodimeric bispecific human immunoglobulin. Unfortunately, most if not all of the in vitro engineering approaches provide largely ad hoc fixes that are suitable, if at all, for individual molecules. On the other hand, in vivo methods for employing complex organisms to select appropriate pairings that are capable of leading to human therapeutics have not been realized.

(51) Mice containing human immunoglobulin loci, variable and constant regions randomly inserted into the mouse genome, are known in the art. Initial strains of such mice contained a limited number of human immunoglobulin gene segments. Specifically, a handful of strains containing human immunoglobulin light chain gene segments contained either one, three or four human immunoglobulin V.sub.L gene segments and five human immunoglobulin J.sub.L gene segments (Taylor et al. 1992, Nucleic Acids Research 20(23): 6287-6295; Fishwild et al. 1996, Nature Biotechnology 14: 845-851; Lonberg et al. 1994, Nature 368: 856-859; Green et al. 1994, Nature Genetics 7:13-21; Green and Jakobovits 1998, J. Exp. Med. 188(3): 483-495; Green 1999, J. Immunol. Methods 231: 11-23). These mice that contained only a few human immunoglobulin V.sub.L gene segments as part of fully human transgenes randomly inserted into the mouse genome demonstrated compromised B cell numbers, impaired B cell development and other immune deficiencies. Expression of the human immunoglobulin V.sub.L genes, as detected by surface expression of human C on B cells, was lower than the endogenous light chain as compared to wild type. Surprisingly, the present invention provides mice whose B cell numbers and development is nearly wild-type in respects when mice are engineered at the endogenous immunoglobulin light chain loci to contain either one or two human immunoglobulin V gene segments (e.g., Examples 2 and 14, Tables 3, 25 and 26, and FIGS. 4, 10A-18). Further, in some embodiments, mice provided by the present invention, are able to generate several high-affinity reverse chimeric antibodies containing human V.sub.H and V.sub.L domains in response to antigen, wherein the V.sub.L domains each contain one of two possible human V.sub.L gene segments and one of five possible human J.sub.L gene segments (e.g., see Examples 5-10, 12, and 14). Thus, in contrast to preliminary strains of mice engineered with human immunoglobulin light chain miniloci (i.e., a limited number of human immunoglobulin gene segments), presently provided engineered mice that contain a limited number of human immunoglobulin V.sub.L gene segments (either one or two) and, in some embodiments, two or more (e.g., 2, 3, 4, or 5) human immunoglobulin J.sub.L gene segments, surprisingly exhibit normal B cell numbers, normal immunoglobulin light chain expression, and normal B cell development. Further, such provided mice also show no reduced or impaired ability to mount robust immune responses to multiple antigens as a result of a limited immunoglobulin light chain repertoire. Accordingly, mice are 00249 provided that comprise a humanized V.sub.L locus comprising no more than two unrearranged human immunoglobulin V.sub.L gene segments and two or more (e.g., 2, 3, 4, or 5) human immunoglobulin J.sub.L gene segmentsor no more than two rearranged human V.sub.LJ.sub.L segmentsand that exhibit wild-type B cell populations in number, and exhibit wild-type B cell development.

(52) Generally, native mouse sequences are frequently not a good source for human therapeutic sequences. For at least that reason, generating mouse heavy chain immunoglobulin variable regions that pair with a common human light chain is of limited practical utility. More in vitro engineering efforts would be expended in a trial-and-error process to try to humanize the mouse heavy chain variable sequences while hoping to retain epitope specificity and affinity while maintaining the ability to couple with the common human light chain, with uncertain outcome. At the end of such a process, the final product may maintain some of the specificity and affinity, and associate with the common light chain, but ultimately immunogenicity in a human would likely remain a profound risk.

(53) Therefore, a suitable mouse for making human therapeutics would include a suitably large repertoire of human heavy chain variable region gene segments in place of endogenous mouse heavy chain variable region gene segments. The human heavy chain variable region gene segments should be able to rearrange and recombine with an endogenous mouse heavy chain constant domain to form a reverse chimeric heavy chain (i.e., a heavy chain comprising a human variable domain and a mouse constant region). The heavy chain should be capable of class switching and somatic hypermutation so that a suitably large repertoire of heavy chain variable domains are available for the mouse to select one that can associate with the limited repertoire of human light chain variable regions.

(54) A mouse that selects a common light chain for a plurality of heavy chains has a practical utility. In various embodiments, antibodies that express in a mouse that can only express a common light chain will have heavy chains that can associate and express with an identical or substantially identical light chain. This is particularly useful in making bispecific antibodies. For example, such a mouse can be immunized with a first immunogen to generate a B cell that expresses an antibody that specifically binds a first epitope. The mouse (or a mouse genetically the same) can be immunized with a second immunogen to generate a B cell that expresses an antibody that specifically binds the second epitope. Variable heavy chain regions can be cloned from the B cells and expressed with the same heavy chain constant region, and the same variable light chain region (e.g., a common light chain) in a cell to make a bispecific antibody, wherein the variable heavy chain component of the bispecific antibody has been selected by a mouse to associate and express with the variable light chain (or common light chain) component.

(55) The inventors have engineered a mouse for generating immunoglobulin light chains that will suitably pair with a rather diverse family of heavy chains, including heavy chains whose variable regions depart from germline sequences, e.g., affinity matured or somatically mutated variable regions. In various embodiments, the mouse is devised to pair human light chain variable domains with human heavy chain variable domains that comprise somatic mutations, thus enabling a route to high affinity binding proteins suitable for use as human therapeutics.

(56) The genetically engineered mouse, through the long and complex process of antibody selection within an organism, makes biologically appropriate choices in pairing a diverse collection of human heavy chain variable domains with a limited number of human light chain options. In order to achieve this, the mouse is engineered to present a limited number of human light chain variable domain options in conjunction with a wide diversity of human heavy chain variable domain options. Upon challenge with an immunogen, the mouse maximizes the number of solutions in its repertoire to develop an antibody to the immunogen, limited largely or solely by the number or light chain options in its repertoire. In various embodiments, this includes allowing the mouse to achieve suitable and compatible somatic mutations of the light chain variable domain that will nonetheless be compatible with a relatively large variety of human heavy chain variable domains, including in particular somatically mutated human heavy chain variable domains.

(57) To achieve a limited repertoire of light chain options, the mouse is engineered to render nonfunctional or substantially nonfunctional its ability to make, or rearrange, a native mouse light chain variable domain. This can be achieved, e.g., by deleting the mouse's light chain variable region gene segments. The endogenous mouse locus can then be modified by an exogenous suitable human light chain variable region gene segment of choice, operably linked to the endogenous mouse light chain constant domain, in a manner such that the exogenous human variable region gene segments can combine with the endogenous mouse light chain constant region gene and form a rearranged reverse chimeric light chain gene (human variable, mouse constant). In various embodiments, the light chain variable region is capable of being somatically mutated. In various embodiments, to maximize ability of the light chain variable region to acquire somatic mutations, the appropriate enhancer(s) is retained in the mouse. For example, in modifying a mouse light chain locus to replace endogenous mouse light chain gene segments with human light chain gene segments, the mouse intronic enhancer and mouse 3.sup.+ enhancer are functionally maintained, or undisrupted.

(58) A genetically engineered mouse is provided that expresses a limited repertoire of reverse chimeric (human variable, mouse constant) light chains associated with a diversity of reverse chimeric (human variable, mouse constant) heavy chains. In various embodiments, the endogenous mouse light chain gene segments are deleted and replaced with a single (or two) rearranged human light chain region, operably linked to the endogenous mouse C gene. In embodiments for maximizing somatic hypermutation of the rearranged human light chain region, the mouse intronic enhancer and the mouse 3.sup.+ enhancer are maintained. In various embodiments, the mouse also comprises a nonfunctional light chain locus, or a deletion thereof or a deletion that renders the locus unable to make a light chain.

(59) A genetically engineered mouse is provided that, in various embodiments, comprises a light chain variable region locus lacking endogenous mouse light chain V.sub.L and J.sub.L gene segments and comprising a rearranged human light chain variable region, in one embodiment a rearranged human V.sub.L/J.sub.L sequence, operably linked to a mouse constant region, wherein the locus is capable of undergoing somatic hypermutation, and wherein the locus expresses a light chain comprising the human V.sub.L/J.sub.L sequence linked to a mouse constant region. Thus, in various embodiments, the locus comprises a mouse 3.sup.+ enhancer, which is correlated with a normal, or wild type, level of somatic hypermutation.

(60) The genetically engineered mouse in various embodiments when immunized with an antigen of interest generates B cells that exhibit a diversity of rearrangements of human immunoglobulin heavy chain variable regions that express and function with one or with two rearranged light chains, including embodiments where the one or two light chains comprise human light chain variable regions that comprise, e.g., 1 to 5 somatic mutations. In various embodiments, the human light chains so expressed are capable of associating and expressing with any human immunoglobulin heavy chain variable region expressed in the mouse.

(61) In addition to genetically engineered mice comprising restricted immunoglobulin light chain repertoire (e.g., a single human V.sub.L gene segment or no more than two human V.sub.L gene segments and, one human J.sub.L gene segment or, optionally, two or more human J.sub.L gene segments) as described herein, also provided herein are other genetically modified non-human animals that comprise a single hum V.sub.L gene segment or no more than two human V.sub.L gene segments. In some embodiments, such non-human animals comprise a single rearranged human V.sub.L region composed of a rearranged human V.sub.LJ.sub.L sequence. In some embodiments, such non-human animals comprise no more than two human V.sub.L gene segments and two or more (e.g., 2, 3, 4, or 5 human J.sub.L gene segments. In various embodiments, human gene segments are operably linked to a non-human light chain constant region, e.g., a mouse a rat light chain constant region.

(62) Such non-human animals may be selected from a group consisting of a mouse, rat, rabbit, pig, bovine (e.g., cow, bull, buffalo), deer, sheep, goat, chicken, cat, dog, ferret, primate (e.g., marmoset, rhesus monkey). For the non-human animals where suitable genetically modifiable ES cells are not readily available, other methods are employed to make a non-human animal comprising genetic modifications as described herein. Such methods include, e.g., modifying a non-ES cell genome (e.g., a fibroblast or an induced pluripotent cell) and employing nuclear transfer to transfer the modified genome to a suitable cell, e.g., an oocyte, and gestating the modified cell (e.g., the modified oocyte) in a non-human animal under suitable conditions to form an embryo.

(63) In some embodiments, a non-human animal of the present invention is a mammal. In some embodiments, a non-human animal of the present invention is a small mammal, e.g., of the superfamily Dipodoidea or Muroidea. In some embodiments, a genetically modified animal of the present invention is a rodent. In some embodiments, a rodent of the present invention is selected from a mouse, a rat, and a hamster. In some embodiments, a rodent of the present invention is selected from the superfamily Muroidea. In some embodiments, a genetically modified animal of the present invention is from a family selected from Calomyscidae (e.g., mouse-like hamsters), Cricetidae (e.g., hamster, New World rats and mice, voles), Muridae (true mice and rats, gerbils, spiny mice, crested rats), Nesomyidae (climbing mice, rock mice, with-tailed rats, Malagasy rats and mice), Platacanthomyidae (e.g., spiny dormice), and Spalacidae (e.g., mole rates, bamboo rats, and zokors). In some certain embodiments, a genetically modified rodent of the present invention is selected from a true mouse or rat (family Muridae), a gerbil, a spiny mouse, and a crested rat. In some certain embodiments, a genetically modified mouse of the present invention is from a member of the family Muridae. In some embodiment, an non-human animal of the present invention is a rodent. In some certain embodiments, a rodent of the present invention is selected from a mouse and a rat. In some embodiments, a non-human animal of the present invention is a mouse.

(64) In some embodiments, a non-human animal of the present invention is a rodent that is a mouse of a C57BL strain selected from C57BL/A, C57BL/An, C57BL/GrFa, C57BL/KaLwN, C57BL/6, C57BL/6J, C57BL/6ByJ, C57BL/6NJ, C57BL/10, C57BL/10ScSn, C57BL/10Cr, and C57BL/Ola. In some certain embodiments, a mouse of the present invention is a 129 strain selected from the group consisting of a strain that is 129P1, 129P2, 129P3, 1291, 129S1 (e.g., 129S1/SV, 129S1/Svlm), 129S2, 129S4, 129S5, 129S9/SvEvH, 129S6 (129/SvEvTac), 129S7, 129S8, 129T1, 129T2 (see, e.g., Festing et al., 1999, Mammalian Genome 10:836; Auerbach et al., 2000, Biotechniques 29(5):1024-1028, 1030, 1032). In some certain embodiments, a genetically modified mouse of the present invention is a mix of an aforementioned 129 strain and an aforementioned C57BL/6 strain. In some certain embodiments, a mouse of the present invention is a mix of aforementioned 129 strains, or a mix of aforementioned BL/6 strains. In some certain embodiments, a 129 strain of the mix as described herein is a 129S6 (129/SvEvTac) strain. In some embodiment, a mouse of the present invention is a BALB strain, e.g., BALB/c strain. In some embodiments, a mouse of the present invention is a mix of a BALB strain and another aforementioned strain.

(65) In some embodiments, a non-human animal of the present invention is a rat. In some certain embodiments, a rat of the present invention is selected from a Wistar rat, an LEA strain, a Sprague Dawley strain, a Fischer strain, F344, F6, and Dark Agouti. In some certain embodiments, a rat strain as described herein is a mix of two or more strains selected from the group consisting of Wistar, LEA, Sprague Dawley, Fischer, F344, F6, and Dark Agouti.

(66) Epitope-binding Proteins Binding More than One Epitope

(67) Compositions and methods described herein can be used to make binding proteins that bind more than one epitope with high affinity, e.g., bispecific antibodies. Advantages of the invention include the ability to select suitably high binding (e.g., affinity matured) heavy chain immunoglobulin chains each of which will associate with a single light chain.

(68) Several techniques for making bispecific antibody fragments from recombinant cell culture have been reported. However, synthesis and expression of bispecific binding proteins has been problematic, in part due to issues associated with identifying a suitable light chain that can associate and express with two different heavy chains, and in part due to isolation issues. In various embodiments, compositions and methods described herein provide the advantage of full length bispecific antibodies that do not require special modification(s) to maintain traditional immunoglobulin structure by increasing stability/interaction of the components (FIG. 7A). In various embodiments, such modification(s) has proven cumbersome and served as an obstacle to development of bispecific antibody technology and their potential use in treating for human disease. Thus, in various embodiments, through providing a natural immunoglobulin structure (i.e., full length) having the added property of multiple specificities, full length bispecific antibodies maintain their critical effector functions that previous bispecific fragments lack, and further provide therapeutics that demonstrate the important pharmacokinetic parameter of a longer half-life.

(69) Methods and compositions described herein allow for a genetically modified mouse to select, through otherwise natural processes, a suitable light chain that can associate and express with more than one heavy chain, including heavy chains that are somatically mutated (e.g., affinity matured). Human V.sub.L and V.sub.H sequences from suitable B cells of immunized mice as described herein that express affinity matured antibodies having reverse chimeric heavy chains (i.e., human variable and mouse constant) can be identified and cloned in frame in an expression vector with a suitable human constant region gene sequence (e.g., a human IgG1). Two such constructs can be prepared, wherein each construct encodes a human heavy chain variable domain that binds a different epitope. One of the human V.sub.LS (e.g., human V1-39J5 or human V3-20J1), in germline sequence or from a B cell wherein the sequence has been somatically mutated, can be fused in frame to a suitable human constant region gene (e.g., a human constant gene). These three fully human heavy and light constructs can be placed in a suitable cell for expression. The cell will express two major species: a homodimeric heavy chain with the identical light chain, and a heterodimeric heavy chain with the identical light chain. To allow for a facile separation of these major species, one of the heavy chains is modified to omit a Protein A-binding determinant, resulting in a differential affinity of a homodimeric binding protein from a heterodimeric binding protein. Compositions and methods that address this issue are described in U.S. Ser. No. 12/832,838, filed 25 Jun. 2010, entitled Readily Isolated Bispecific Antibodies with Native Immunoglobulin Format, published as US 2010/0331527A1, hereby incorporated by reference.

(70) In one aspect, an epitope-binding protein as described herein is provided, wherein human V.sub.L and V.sub.H sequences are derived from mice described herein that have been immunized with an antigen comprising an epitope of interest.

(71) In one embodiment, an epitope-binding protein is provided that comprises a first and a second polypeptide, the first polypeptide comprising, from N-terminal to C-terminal, a first epitope-binding region that selectively binds a first epitope, followed by a constant region that comprises a first C.sub.H3 region of a human IgG selected from IgG1, IgG2, IgG4, and a combination thereof; and, a second polypeptide comprising, from N-terminal to C-terminal, a second epitope-binding region that selectively binds a second epitope, followed by a constant region that comprises a second C.sub.H3 region of a human IgG selected from IgG1, IgG2, IgG4, and a combination thereof, wherein the second C.sub.H3 region comprises a modification that reduces or eliminates binding of the second C.sub.H3 domain to protein A.

(72) In one embodiment, the second C.sub.H3 region comprises an H95R modification (by IMGT exon numbering; H435R by EU numbering). In another embodiment, the second C.sub.H3 region further comprises a Y96F modification (IMGT; Y436F by EU).

(73) In one embodiment, the second C.sub.H3 region is from a modified human IgG1, and further comprises a modification selected from the group consisting of D16E, L18M, N44S, K52N, V57M, and V82I (IMGT; D356E, L358M, N384S, K392N, V397M, and V422I by EU).

(74) In one embodiment, the second C.sub.H3 region is from a modified human IgG2, and further comprises a modification selected from the group consisting of N44S, K52N, and V82I (IMGT; N384S, K392N, and V422I by EU).

(75) In one embodiment, the second C.sub.H3 region is from a modified human IgG4, and further comprises a modification selected from the group consisting of Q15R, N44S, K52N, V57M, R69K, E79Q, and V82I (IMGT; Q355R, N384S, K392N, V397M, R409K, E419Q, and V422I by EU).

(76) One method for making an epitope-binding protein that binds more than one epitope is to immunize a first mouse in accordance with the invention with an antigen that comprises a first epitope of interest, wherein the mouse comprises an endogenous immunoglobulin light chain variable region locus that does not contain an endogenous mouse V.sub.L that is capable of rearranging and forming a light chain, wherein at the endogenous mouse immunoglobulin light chain variable region locus is a single rearranged human V.sub.L region operably linked to the mouse endogenous light chain constant region gene, and the rearranged human V.sub.L region is selected from a human V1-39J5 and a human V3-20J1, and the endogenous mouse V.sub.H gene segments have been replaced in whole or in part with human V.sub.H gene segments, such that immunoglobulin heavy chains made by the mouse are solely or substantially heavy chains that comprise human variable domains and mouse constant domains. When immunized, such a mouse will make a reverse chimeric antibody, comprising only one of two human light chain variable domains (e.g., one of human V1-39J5 or human V3-20J1). Once a B cell is identified that encodes a V.sub.H that binds the epitope of interest, the nucleotide sequence of the V.sub.H (and, optionally, the V.sub.L) can be retrieved (e.g., by PCR) and cloned into an expression construct in frame with a suitable human immunoglobulin constant domain. This process can be repeated to identify a second V.sub.H domain that binds a second epitope, and a second V.sub.H gene sequence can be retrieved and cloned into an expression vector in frame to a second suitable immunoglobulin constant domain. The first and the second immunoglobulin constant domains can the same or different isotype, and one of the immunoglobulin constant domains (but not the other) can be modified as described herein or in US 2010/0331527A1, and epitope-binding protein can be expressed in a suitable cell and isolated based on its differential affinity for Protein A as compared to a homodimeric epitope-binding protein, e.g., as described in US 2010/0331527A1.

(77) In one embodiment, a method for making a bispecific epitope-binding protein is provided, comprising identifying a first affinity-matured (e.g., comprising one or more somatic hypermutations) human V.sub.H nucleotide sequence (V.sub.H1) from a mouse as described herein, identifying a second affinity-matured (e.g., comprising one or more somatic hypermutations) human V.sub.H nucleotide sequence (V.sub.H2) from a mouse as described herein, cloning V.sub.H1 in frame with a human heavy chain lacking a Protein A-determinant modification as described in US 2010/0331527A1 for form heavy chain 1 (HC1), cloning V.sub.H2 in frame with a human heavy chain comprising a Protein A-determinant as described in US 2010/0331527A1 to form heavy chain 2 (HC2), introducing an expression vector comprising HC1 and the same or a different expression vector comprising HC2 into a cell, wherein the cell also expresses a human immunoglobulin light chain that comprises a human V1-39/human J5 or a human V3-20/human J1 fused to a human light chain constant domain, allowing the cell to express a bispecific epitope-binding protein comprising a V.sub.H domain encoded by V.sub.H1 and a V.sub.H domain encoded by V.sub.H2, and isolating the bispecific epitope-binding protein based on its differential ability to bind Protein A as compared with a monospecific homodimeric epitope-binding protein. In a specific embodiment, HC1 is an IgG1, and HC2 is an IgG1 that comprises the modification H95R (IMGT; H435R by EU) and further comprises the modification Y96F (IMGT; Y436F by EU). In one embodiment, the V.sub.H domain encoded by V.sub.H1, the V.sub.H domain encoded by V.sub.H2, or both, are somatically mutated.

(78) Human V.sub.H Genes that Express with a Common Human V.sub.L

(79) A variety of human variable regions from affinity-matured antibodies raised against four different antigens were expressed with either their cognate light chain, or at least one of a human light chain selected from human V1-39/J5, human V3-20/J1, or human VpreB/J5 (see Example 1). For antibodies to each of the antigens, somatically mutated high affinity heavy chains from different gene families paired successfully with rearranged human germline V1-39J5 and V3-20J1 regions and were secreted from cells expressing the heavy and light chains. For V1-39J5 and V3-20J1, V.sub.H domains derived from the following human V.sub.H gene families expressed favorably: 1-2, 1-8, 1-24, 2-5, 3-7, 3-9, 3-11, 3-13, 3-15, 3-20, 3-23, 3-30, 3-33, 3-48, 4-31, 4-39, 4-59, 5-51, and 6-1. Thus, a mouse that is engineered to express a limited repertoire of human V.sub.L domains from one or both of V1-39J5 and V3-20J1 will generate a diverse population of somatically mutated human V.sub.H domains from a V.sub.H locus modified to replace mouse V.sub.H gene segments with human V.sub.H gene segments.

(80) Mice genetically engineered to express reverse chimeric (human variable, mouse constant) immunoglobulin heavy chains associated with a single rearranged light chain (e.g., a V1-39/J or a V3-20/J), when immunized with an antigen of interest, generated B cells that comprised a diversity of human V.sub.H rearrangements and expressed a diversity of high-affinity antigen-specific antibodies with diverse properties with respect to their ability to block binding of the antigen to its ligand, and with respect to their ability to bind variants of the antigen (see Examples 5 through 10).

(81) Thus, the mice and methods described herein are useful in making and selecting human immunoglobulin heavy chain variable domains, including somatically mutated human heavy chain variable domains, that result from a diversity of rearrangements, that exhibit a wide variety of affinities (including exhibiting a K.sub.D of about a nanomolar or less), a wide variety of specificities (including binding to different epitopes of the same antigen), and that associate and express with the same or substantially the same human immunoglobulin light chain variable region.

(82) Fully Human Bispecific Antibodies Having a Common Light Chain

(83) As a first step in various embodiments, the first and second nucleic acid sequences that each encode human heavy chain variable domains (and any additional nucleic acid sequences forming the bispecific antibody) are selected from parent monoclonal antibodies having desired characteristics such as, for example, capable of binding different epitopes (see FIGS. 7A and 7B), having different affinities, etc. Normally, the nucleic acid sequences encoding the human heavy chain variable domains are isolated from immunized mice, as described herein, to allow for fusing with human heavy chain constant regions to be suitable for human administration. Further modifications to the sequence(s) can be made by introducing mutations that add additional functionality to the bispecific antibody can be achieved, which include, for example, increasing serum half-life (e.g., see U.S. Pat. No. 7,217,797) and/or increasing antibody-dependent cell-mediated cytotoxicity (e.g., see U.S. Pat. No. 6,737,056). Introducing mutations into the constant regions of antibodies is known in the art. Additionally, part of the bispecific antibody can be made recombinantly in cell culture and other part(s) of the molecule can be made by those techniques mentioned above.

(84) Several techniques for the producing antibodies have been described. For example, in various embodiments chimeric antibodies are produced in mice as described herein. Antibodies can be isolated directly from B cells of an immunized mouse (e.g., see U.S. 2007/0280945A1) and/or the B cells of the immunized mouse can be used to make hybridomas (Kohler and Milstein, 1975, Nature 256:495-497). DNA encoding the antibodies (human heavy and/or light chains) from mice as described herein is readily isolated and sequenced using conventional techniques. Hybridoma and/or B cells of derived from mice as described herein serve as a preferred source of such DNA. Once isolated, the DNA may be placed into expression vectors, which are then transfected into host cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. The DNA also may be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the murine sequences.

(85) In various embodiments, following isolation of the DNA and selection of the first and second nucleic acid sequences that encode the first and second human heavy chain variable domains having the desired specificities/affinities, and a third nucleic acid sequence that encodes a human light chain domain (a germline rearranged sequence or a light chain sequence isolated from a mouse as described herein), the three nucleic acids sequences encoding the molecules are expressed to form the bispecific antibody using recombinant techniques which are widely available in the art. Often, the expression system of choice will involve a mammalian cell expression vector and host so that the bispecific antibody is appropriately glycosylated (e.g., in the case of bispecific antibodies comprising antibody domains which are glycosylated). However, the molecules can also be produced in the prokaryotic expression systems. Normally, the host cell will be transformed with DNA encoding both the first human heavy chain variable domain, the second human heavy chain variable domain, the human light chain domain on a single vector or independent vectors. However, it is possible to express the first human heavy chain variable domain, second human heavy chain variable domain, and human light chain domain (the bispecific antibody components) in independent expression systems and couple the expressed polypeptides in vitro. In various embodiments, the human light chain domain comprises a germline sequence. In various embodiments, the human light chain domain comprises no more than one, no more than two, no more than three, no more than four, or no more than five somatic hypermutations with the light chain variable sequence of the light chain domain.

(86) In various embodiments, the nucleic acid(s) (e.g., cDNA or genomic DNA) encoding the two heavy chains and single human light chain is inserted into a replicable vector for further cloning (amplification of the DNA) and/or for expression. Many vectors are available, and generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence. Each component may be selected individually or based on a host cell choice or other criteria determined experimentally. Several examples of each component are known in the art.

(87) Expression and cloning vectors usually contain a promoter that is recognized by the host organism and is operably linked to the nucleic acid sequences that encode each or all the components of the bispecific antibody. A large number of promoters recognized by a variety of potential host cells are well known. These promoters are operably linked to bispecific antibody-encoding DNA by removing the promoter from the source DNA by restriction enzyme digestion and inserting the isolated promoter sequence into the vector.

(88) Expression vectors used in eukaryotic host cells (yeast, fungi, insect, plant, animal, human, or nucleated cells from other multicellular organisms) may also contain sequences necessary for the termination of transcription and for stabilizing the mRNA. Such sequences are commonly available from the 5 and, occasionally 3, untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA encoding the bispecific antibody components. Suitable expression vectors for various embodiments include those that provide for the transient expression in mammalian cells of DNA encoding the bispecific antibody. In general, transient expression involves the use of an expression vector that is able to replicate efficiently in a host cell, such that the host cell accumulates many copies of the expression vector and, in turn, synthesizes high levels of a desired polypeptide encoded by the expression vector. Transient expression systems, comprising a suitable expression vector and a host cell, allow for the convenient positive identification of polypeptides encoded by cloned DNAs, as well as for the rapid screening of bispecific antibodies having desired binding specificities/affinities or the desired gel migration characteristics relative to the parental antibodies having homodimers of the first or second human heavy chain variable domains.

(89) In various embodiments, once the DNA encoding the components of the bispecific antibody are assembled into the desired vector(s) as described above, they are introduced into a suitable host cell for expression and recovery. Transfecting host cells can be accomplished using standard techniques known in the art appropriate to the host cell selected (e.g., electroporation, nuclear microinjection, bacterial protoplast fusion with intact cells, or polycations, e.g., polybrene, polyornithine, etc.).

(90) A host cell is chosen, in various embodiments, that best suits the expression vector containing the components and allows for the most efficient and favorable production of the bispecific antibody species. Exemplary host cells for expression include those of prokaryotes and eukaryotes (single-cell or multiple-cell), bacterial cells (e.g., strains of E. coli, Bacillus spp., Streptomyces spp., etc.), mycobacteria cells, fungal cells, yeast cells (e.g., S. cerevisiae, S. pombe, P. pastoris, P. methanolica, etc.), plant cells, insect cells (e.g., SF-9, SF-21, baculovirus-infected insect cells, Trichoplusia ni, etc.), non-human animal cells, human cells, or cell fusions such as, for example, hybridomas or quadromas. In various embodiments, the cell is a human, monkey, ape, hamster, rat, or mouse cell. In various embodiments, the cell is eukaryotic cell selected from CHO (e.g., CHO K1, DXB-11 CHO, Veggie-CHO), COS (e.g., COS-7), retinal cell, Vero, CV1, kidney (e.g., HEK293, 293 EBNA, MSR 293, MDCK, HaK, BHK), HeLa, HepG2, WI38, MRC 5, Colo205, HB 8065, HL-60, (e.g., BHK21), Jurkat, Daudi, A431 (epidermal), CV-1, U937, 3T3, L cell, C127 cell, SP2/0, NS-0, MMT 060562, Sertoli cell, BRL 3A cell, HT1080 cell, myeloma cell, tumor cell, and a cell line derived from an aforementioned cell. In various embodiments, the cell comprises one or more viral genes, e.g. a retinal cell that expresses a viral gene (e.g., a PER.C6 cell).

(91) Mammalian host cells used to produce the bispecific antibody may be cultured in a variety of media. Commercially available media such as Ham's F10 (Sigma), Minimal Essential Medium ((MEM), Sigma), RPMI-1640 (Sigma), and Dulbeccols Modified Eagle's Medium ((DMEM), Sigma) are suitable for culturing the host cells. Media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleosides (such as adenosine and thymidine), antibiotics (such as GENTAMYCIN), trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other supplements may also be included at appropriate concentrations as known to those skilled in the art. The culture conditions, such as temperature, pH, and the like, are, in various embodiments, those previously used with the host cell selected for expression, and will be apparent to those skilled in the art.

(92) The bispecific antibody is in various embodiments recovered from the culture medium as a secreted polypeptide, although it also may be recovered from host cell lysate when directly produced without a secretory signal. If the bispecific antibody is membrane-bound, it can be released from the membrane using a suitable detergent solution (e.g., Triton-X 100). Preferably, the bispecific antibodies described herein involves the use of a first immunoglobulin C.sub.H3 domain and a second immunoglobulin C.sub.H3 domain, wherein the first and second immunoglobulin C.sub.H3 domains differ from one another by at least one amino acid, and wherein at least one amino acid difference reduces binding of the bispecific antibody to Protein A as compared to a bi-specific antibody lacking the amino acid difference (see U.S. 2010/0331527A1; herein incorporated by reference). In one embodiment, the first immunoglobulin C.sub.H3 domain binds Protein A and the second immunoglobulin C.sub.H3 domain contains a mutation that reduces or abolishes Protein A binding such as an H95R modification (by IMGT exon numbering; H435R by EU numbering). The second C.sub.H3 may further comprise a Y96F modification (by IMGT; Y436F by EU). Further modifications that may be found within the second C.sub.H3 include: D16E, L18M, N44S, K52N, V57M, and V82I (by IMGT; D356E, L358M, N384S, K392N, V397M, and V422I by EU) in the case of IgG1 antibodies; N44S, K52N, and V82I (IMGT; N384S, K392N, and V422I by EU) in the case of IgG2 antibodies; and Q15R, N44S, K52N, V57M, R69K, E79Q, and V82I (by IMGT; Q355R, N384S, K392N, V397M, R409K, E419Q, and V422I by EU) in the case of IgG4 antibodies. Variations on the bi-specific antibody format described above are contemplated within the scope of the present invention.

(93) Because of the dual nature of bispecific antibodies (i.e., may be specific for different epitopes of one polypeptide or may contain antigen-binding domains specific for more than one target polypeptide, see FIG. 7B; see also, e.g., Tutt et al., 1991, J. Immunol. 147:60-69; Kufer et al., 2004, Trends Biotechnol. 22:238-244), they offer many useful advantages for therapeutic application. For example, the bispecific antibodies can be used for redirected cytotoxicity (e.g., to kill tumor cells), as a vaccine adjuvant, for delivering thrombolytic agents to clots, for converting enzyme activated prodrugs at a target site (e.g., a tumor), for treating infectious diseases, targeting immune complexes to cell surface receptors, or for delivering immunotoxins to tumor cells.

(94) The bispecific antibodies described herein can also be used in several therapeutic and non-therapeutic and/or diagnostic assay methods, such as, enzyme immunoassays, two-site immunoassays, in vitro or in vivo immunodiagnosis of various diseases (e.g., cancer), competitive binding assays, direct and indirect sandwich assays, and immunoprecipitation assays. Other uses for the bispecific antibodies will be apparent to those skilled in the art.

(95) The following examples are provided so as to describe to those of ordinary skill in the art how to make and use methods and compositions of the invention, and are not intended to limit the scope of what the inventors regard as their invention. Efforts have been made to ensure accuracy with respect to numbers used (e.g., amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, molecular weight is average molecular weight, temperature is indicated in Celsius, and pressure is at or near atmospheric.

EXAMPLES

(96) The following examples are provided so as to describe to those of ordinary skill in the art how to make and use methods and compositions of the invention, and are not intended to limit the scope of what the inventors regard as their invention. Efforts have been made to ensure accuracy with respect to numbers used (e.g., amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, temperature is indicated in Celsius, pressure is at or near atmospheric, parts are by parts by weight, and molecular weight is average molecular weight.

Example 1

Identification of Human VH Regions that Associate with Selected Human VL Regions

(97) An in vitro expression system was constructed to determine if a single rearranged human germline light chain could be co-expressed with human heavy chains from antigen specific human antibodies.

(98) Methods for generating human antibodies in genetically modified mice are known (see e.g., U.S. Pat. No. 6,596,541, Regeneron Pharmaceuticals, VELOCIMMUNE). The VELOCIMMUNE technology involves generation of a genetically modified mouse having a genome comprising human heavy and light chain variable regions operably linked to endogenous mouse constant region loci such that the mouse produces an antibody comprising a human variable region and a mouse constant region in response to antigenic stimulation. The DNA encoding the variable regions of the heavy and light chains of the antibodies produced from a VELOCIMMUNE mouse are fully human. Initially, high affinity chimeric antibodies are isolated having a human variable region and a mouse constant region. As described below, the antibodies are characterized and selected for desirable characteristics, including affinity, selectivity, epitope, etc. The mouse constant regions are replaced with a desired human constant region to generate a fully human antibody containing a non-IgM isotype, for example, wild type or modified IgG1, IgG2, IgG3 or IgG4. While the constant region selected may vary according to specific use, high affinity antigen-binding and target specificity characteristics reside in the variable region.

(99) A VELOCIMMUNE mouse was immunized with a growth factor that promotes angiogenesis (Antigen C) and antigen-specific human antibodies were isolated and sequenced for V gene usage using standard techniques recognized in the art. Selected antibodies were cloned onto human heavy and light chain constant regions and 69 heavy chains were selected for pairing with one of three human light chains: (1) the cognate light chain linked to a human constant region, (2) a rearranged human germline V1-39J5 linked to a human constant region, or (3) a rearranged human germline V3-20J1 linked to a human constant region. Each heavy chain and light chain pair was co-transfected in CHO-K1 cells using standard techniques. Presence of antibody in the supernatant was detected by anti-human IgG in an ELISA assay. Antibody titer (ng/ml) was determined for each heavy chain/light chain pair and titers with the different rearranged germline light chains were compared to the titers obtained with the parental antibody molecule (i.e., heavy chain paired with cognate light chain) and percent of native titer was calculated (Table 1). V.sub.H: Heavy chain variable gene. ND: no expression detected under current experimental conditions.

(100) TABLE-US-00001 TABLE 1 Antibody Titer (ng/mL) Percent of Native Titer V.sub.H Cognate LC V1-39J5 V3-20J1 V1-39J5 V3-20J1 3-15 63 23 11 36.2 17.5 1-2 103 53 ND 51.1 3-23 83 60 23 72.0 27.5 3-33 15 77 ND 499.4 4-31 22 69 17 309.4 76.7 3-7 53 35 28 65.2 53.1 22 32 19 148.8 89.3 1-24 3 13 ND 455.2 3-33 1 47 ND 5266.7 3-33 58 37 ND 63.1 110 67 18 60.6 16.5 3-23 127 123 21 96.5 16.3 3-33 28 16 2 57.7 7.1 3-23 32 50 38 157.1 119.4 18 45 18 254.3 101.7 3-9 1 30 23 2508.3 1900.0 3-11 12 26 6 225.9 48.3 1-8 16 ND 13 81.8 3-33 54 81 10 150.7 19.1 34 9 ND 25.9 3-20 7 14 54 203.0 809.0 3-33 19 38 ND 200.5 3-11 48 ND 203 423.6 11 23 8 212.7 74.5 3-33 168 138 182 82.0 108.2 3-20 117 67 100 57.5 86.1 3-23 86 61 132 70.7 154.1 3-33 20 12 33 60.9 165.3 4-31 69 92 52 133.8 75.0 3-23 87 78 62 89.5 71.2 1-2 31 82 51 263.0 164.6 3-23 53 93 151 175.4 285.4 11 8 17 75.7 151.4 3-33 114 36 27 31.6 23.4 3-15 73 39 44 53.7 59.6 3-33 1 34 16 5600.0 2683.3 3-9 58 112 57 192.9 97.6 3-33 67 20 105 30.1 157.0 3-33 34 21 24 62.7 70.4 3-20 10 49 91 478.4 888.2 3-33 66 32 25 48.6 38.2 3-23 17 59 56 342.7 329.8 58 108 19 184.4 32.9 68 54 20 79.4 29.9 3-33 42 35 32 83.3 75.4 29 19 13 67.1 43.9 3-9 24 34 29 137.3 118.4 3-30/33 17 33 7 195.2 43.1 3-7 25 70 74 284.6 301.6 3-33 87 127 ND 145.1 6-1 28 56 ND 201.8 3-33 56 39 20 69.9 36.1 3-33 10 53 1 520.6 6.9 3-33 20 67 10 337.2 52.3 3-33 11 36 18 316.8 158.4 3-23 12 42 32 356.8 272.9 3-33 66 95 15 143.6 22.5 3-15 55 68 ND 123.1 32 68 3 210.9 10.6 1-8 28 48 ND 170.9 3-33 124 192 21 154.3 17.0 3-33 0 113 ND 56550.0 3-33 10 157 1 1505.8 12.5 3-33 6 86 15 1385.5 243.5 3-23 70 115 22 163.5 31.0 3-7 71 117 21 164.6 29.6 3-33 82 100 47 122.7 57.1 3-7 124 161 41 130.0 33.5

(101) In a similar experiment, VELOCIMMUNE mice were immunized with several different antigens and selected heavy chains of antigen specific human antibodies were tested for their ability to pair with different rearranged human germline light chains (as described above). The antigens used in this experiment included an enzyme involved in cholesterol homeostasis (Antigen A), a serum hormone involved in regulating glucose homeostasis (Antigen B), a growth factor that promotes angiogenesis (Antigen C) and a cell-surface receptor (Antigen D). Antigen specific antibodies were isolated from mice of each immunization group and the heavy chain and light chain variable regions were cloned and sequenced. From the sequence of the heavy and light chains, V gene usage was determined and selected heavy chains were paired with either their cognate light chain or a rearranged human germline V1-39J5 region. Each heavy/light chain pair was co-transfected in CHO-K1 cells and the presence of antibody in the supernatant was detected by anti-human IgG in an ELISA assay. Antibody titer (g/ml) was determined for each heavy chain/light chain pairing and titers with the different rearranged human germline light chains were compared to the titers obtained with the parental antibody molecule (i.e., heavy chain paired with cognate light chain) and percent of native titer was calculated (Table 2). V.sub.H: Heavy chain variable gene. V: light chain variable gene. ND: no expression detected under current experimental conditions.

(102) TABLE-US-00002 TABLE 2 Titer (g/ml) V.sub.H + Percent of Antigen Antibody V.sub.H V V.sub.H Alone V.sub.H + V V1-39J5 Native Titer A 320 1-18 2-30 0.3 3.1 2.0 66 321 2-5 2-28 0.4 0.4 1.9 448 334 2-5 2-28 0.4 2.7 2.0 73 313 3-13 3-15 0.5 0.7 4.5 670 316 3-23 4-1 0.3 0.2 4.1 2174 315 3-30 4-1 0.3 0.2 3.2 1327 318 4-59 1-17 0.3 4.6 4.0 86 B 257 3-13 1-5 0.4 3.1 3.2 104 283 3-13 1-5 0.4 5.4 3.7 69 637 3-13 1-5 0.4 4.3 3.0 70 638 3-13 1-5 0.4 4.1 3.3 82 624 3-23 1-17 0.3 5.0 3.9 79 284 3-30 1-17 0.3 4.6 3.4 75 653 3-33 1-17 0.3 4.3 0.3 7 268 4-34 1-27 0.3 5.5 3.8 69 633 4-34 1-27 0.6 6.9 3.0 44 C 730 3-7 1-5 0.3 1.1 2.8 249 728 3-7 1-5 0.3 2.0 3.2 157 691 3-9 3-20 0.3 2.8 3.1 109 749 3-33 3-15 0.3 3.8 2.3 62 750 3-33 1-16 0.3 3.0 2.8 92 724 3-33 1-17 0.3 2.3 3.4 151 706 3-33 1-16 0.3 3.6 3.0 84 744 1-18 1-12 0.4 5.1 3.0 59 696 3-11 1-16 0.4 3.0 2.9 97 685 3-13 3-20 0.3 0.5 3.4 734 732 3-15 1-17 0.3 4.5 3.2 72 694 3-15 1-5 0.4 5.2 2.9 55 743 3-23 1-12 0.3 3.2 0.3 10 742 3-23 2-28 0.4 4.2 3.1 74 693 3-23 1-12 0.5 4.2 4.0 94 D 136 3-23 2-28 0.4 5.0 2.7 55 155 3-30 1-16 0.4 1.0 2.2 221 163 3-30 1-16 0.3 0.6 3.0 506 171 3-30 1-16 0.3 1.0 2.8 295 145 3-43 1-5 0.4 4.4 2.9 65 49 3-48 3-11 0.3 1.7 2.6 155 51 3-48 1-39 0.1 1.9 0.1 4 159 3-7 6-21 0.4 3.9 3.6 92 169 3-7 6-21 0.3 1.3 3.1 235 134 3-9 1-5 0.4 5.0 2.9 58 141 4-31 1-33 2.4 4.2 2.6 63 142 4-31 1-33 0.4 4.2 2.8 67

(103) The results obtained from these experiments demonstrate that somatically mutated, high affinity heavy chains from different gene families are able to pair with rearranged human germline V1-39J5 and V3-20J1 regions and be secreted from the cell as a normal antibody molecule. As shown in Table 1, antibody titer was increased for about 61% (42 of 69) heavy chains when paired with the rearranged human V1-39J5 light chain and about 29% (20 of 69) heavy chains when paired with the rearranged human V3-20J1 light chain as compared to the cognate light chain of the parental antibody. For about 20% (14 of 69) of the heavy chains, both rearranged human germline light chains conferred an increase in expression as compared to the cognate light chain of the parental antibody. As shown in Table 2, the rearranged human germline V1-39J5 region conferred an increase in expression of several heavy chains specific for a range of different classes of antigens as compared to the cognate light chain for the parental antibodies. Antibody titer was increased by more than two-fold for about 35% (15/43) of the heavy chains as compared to the cognate light chain of the parental antibodies. For two heavy chains (315 and 316), the increase was greater than ten-fold as compared to the parental antibody. Within all the heavy chains that showed increase expression relative to the cognate light chain of the parental antibody, family three (V.sub.H3) heavy chains are over represented in comparison to other heavy chain variable region gene families. This demonstrates a favorable relationship of human V.sub.H3 heavy chains to pair with rearranged human germline V1-39J5 and V3-20J1 light chains.

Example 2

Generation of a Rearranged Human Germline Light Chain Locus

(104) Various rearranged human germline light chain targeting vectors were made using VELOCIGENE technology (see, e.g., U.S. Pat. No. 6,586,251 and Valenzuela et al. (2003) High-throughput engineering of the mouse genome coupled with high-resolution expression analysis, Nature Biotech. 21(6): 652-659) to modify mouse genomic Bacterial Artificial Chromosome (BAC) clones 302g12 and 254m04 (Invitrogen). Using these two BAC clones, genomic constructs were engineered to contain a single rearranged human germline light chain region and inserted into an endogenous light chain locus that was previously modified to delete the endogenous K variable and joining gene segments.

(105) Construction of Rearranged Human Germline Light Chain Targeting Vectors.

(106) Three different rearranged human germline light chain regions were made using standard molecular biology techniques recognized in the art. The human variable gene segments used for constructing these three regions included rearranged human V1-39J5 sequence, a rearranged human V3-20J1 sequence and a rearranged human VpreBJ5 sequence.

(107) A DNA segment containing exon 1 (encoding the leader peptide) and intron 1 of the mouse V3-7 gene was made by de novo DNA synthesis (Integrated DNA Technologies). Part of the 5.sup.+ untranslated region up to a naturally occurring BlpI restriction enzyme site was included. Exons of human V1-39 and V3-20 genes were PCR amplified from human genomic BAC libraries. The forward primers had a 5.sup.+ extension containing the splice acceptor site of intron 1 of the mouse V3-7 gene. The reverse primer used for PCR of the human V1-39 sequence included an extension encoding human J5, whereas the reverse primer used for PCR of the human V3-20 sequence included an extension encoding human J1. The human VpreBJ5 sequence was made by de novo DNA synthesis (Integrated DNA Technologies). A portion of the human J-C intron including the splice donor site was PCR amplified from plasmid pBS-296-HA18-PIScel. The forward PCR primer included an extension encoding part of either a human J5, J1, or J5 sequence. The reverse primer included a PI-Scel site, which was previously engineered into the intron.

(108) The mouse V3-7 exon1/intron 1, human variable light chain exons, and human J-C intron fragments were sewn together by overlap extension PCR, digested with BlpI and PI-Scel, and ligated into plasmid pBS-296-HA18-PlScel, which contained the promoter from the human V3-15 variable gene segment. A loxed hygromycin cassette within plasmid pBS-296-HA18-PIScel was replaced with a FRTed hygromycin cassette flanked by NotI and Ascl sites. The NotI/PI-Scel fragment of this plasmid was ligated into modified mouse BAC 254m04, which contained part of the mouse J-C intron, the mouse C exon, and about 75 kb of genomic sequence downstream of the mouse locus, which provided a 3.sup.+ homology arm for homologous recombination in mouse ES cells. The NotI/Ascl fragment of this BAC was then ligated into modified mouse BAC 302g12, which contained a FRTed neomycin cassette and about 23 kb of genomic sequence upstream of the endogenous K locus for homologous recombination in mouse ES cells.

(109) Rearranged Human Germline V1-39J5 Targeting Vector (FIG. 1). Restriction enzyme sites were introduced at the 5 and 3 ends of an engineered light chain insert for cloning into a targeting vector: an Ascl site at the 5 end and a PI-Scel site at the 3 end. Within the 5 Ascl site and the 3 PI-Scel site the targeting construct from 5 to 3 included a 5 homology arm containing sequence 5 to the endogenous mouse light chain locus obtained from mouse BAC clone 302g12, a FRTed neomycin resistance gene, an genomic sequence including the human V3-15 promoter, a leader sequence of the mouse V3-7 variable gene segment, a intron sequence of the mouse V3-7 variable gene segment, an open reading frame of a rearranged human germline V1-39J5 region, a genomic sequence containing a portion of the human J-C intron, and a 3 homology arm containing sequence 3 of the endogenous mouse J5 gene segment obtained from mouse BAC clone 254m04 (FIG. 1, middle). Genes and/or sequences upstream of the endogenous mouse light chain locus and downstream of the most 3 J gene segment (e.g., the endogenous 3 enhancer) were unmodified by the targeting construct (see FIG. 1). The sequence of the engineered human V1-39J5 locus is shown in SEQ ID NO: 1.

(110) Targeted insertion of the rearranged human germline V1-39J5 region into BAC DNA was confirmed by polymerase chain reaction (PCR) using primers located at sequences within the rearranged human germline light chain region. Briefly, the intron sequence 3 to the mouse V3-7 leader sequence was confirmed with primers ULC-m1F (AGGTGAGGGT ACAGATAAGT GTTATGAG; SEQ ID NO: 2) and ULC-m1R (TGACAAATGC CCTAATTATA GTGATCA; SEQ ID NO: 3). The open reading frame of the rearranged human germline V1-39J5 region was confirmed with primers 1633-h2F (GGGCAAGTCA GAGCATTAGC A; SEQ ID NO: 4) and 1633-h2R (TGCAAACTGG ATGCAGCATA G; SEQ ID NO: 5). The neomycin cassette was confirmed with primers neoF (GGTGGAGAGG CTATTCGGC; SEQ ID NO: 6) and neoR (GAACACGGCG GCATCAG; SEQ ID NO: 7). Targeted BAC DNA was then used to electroporate mouse ES cells to created modified ES cells for generating chimeric mice that express a rearranged human germline V1-39J5 region.

(111) Positive ES cell clones were confirmed by TAQMAN screening and karyotyping using probes specific for the engineered V1-39J5 light chain region inserted into the endogenous locus. Briefly, probe neoP (TGGGCACAAC AGACAATCGG CTG; SEQ ID NO: 8) which binds within the neomycin marker gene, probe ULC-m1P (CCATTATGAT GCTCCATGCC TCTCTGTTC; SEQ ID NO: 9) which binds within the intron sequence 3 to the mouse V3-7 leader sequence, and probe 1633h2P (ATCAGCAGAA ACCAGGGAAA GCCCCT; SEQ ID NO: 10) which binds within the rearranged human germline V1-39J5 open reading frame. Positive ES cell clones were then used to implant female mice to give rise to a litter of pups expressing the germline V1-39J5 light chain region.

(112) Alternatively, ES cells bearing the rearranged human germline V1-39J5 light chain region are transfected with a construct that expresses FLP in order to remove the FRTed neomycin cassette introduced by the targeting construct. Optionally, the neomycin cassette is removed by breeding to mice that express FLP recombinase (e.g., U.S. Pat. No. 6,774,279). Optionally, the neomycin cassette is retained in the mice.

(113) Rearranged Human Germline V3-20J1 Targeting Vector (FIG. 2). In a similar fashion, an engineered light chain locus expressing a rearranged human germline V3-20J1 region was made using a targeting construct including, from 5 to 3, a 5 homology arm containing sequence 5 to the endogenous mouse light chain locus obtained from mouse BAC clone 302g12, a FRTed neomycin resistance gene, a genomic sequence including the human V3-15 promoter, a leader sequence of the mouse V3-7 variable gene segment, an intron sequence of the mouse V3-7 variable gene segment, an open reading frame of a rearranged human germline V3-20J1 region, a genomic sequence containing a portion of the human J-C intron, and a 3 homology arm containing sequence 3 of the endogenous mouse J5 gene segment obtained from mouse BAC clone 254m04 (FIG. 2, middle). The sequence of the engineered human V3-20J1 locus is shown in SEQ ID NO: 11.

(114) Targeted insertion of the rearranged human germline V3-20J1 region into BAC DNA was confirmed by polymerase chain reaction (PCR) using primers located at sequences within the rearranged human germline V3-20J1 light chain region. Briefly, the intron sequence 3 to the mouse V3-7 leader sequence was confirmed with primers ULC-ml F (SEQ ID NO: 2) and ULC-ml R (SEQ ID NO: 3). The open reading frame of the rearranged human germline V3-20J1 region was confirmed with primers 1635-h2F (TCCAGGCACC CTGTCTTTG; SEQ ID NO: 12) and 1635-h2R (AAGTAGCTGC TGCTAACACT CTGACT; SEQ ID NO: 13). The neomycin cassette was confirmed with primers neoF (SEQ ID NO: 6) and neoR (SEQ ID NO: 7). Targeted BAC DNA was then used to electroporate mouse ES cells to created modified ES cells for generating chimeric mice that express the rearranged human germline V3-20J1 light chain.

(115) Positive ES cell clones were confirmed by TAQMAN screening and karyotyping using probes specific for the engineered V3-20J1 light chain region inserted into the endogenous K light chain locus. Briefly, probe neoP (SEQ ID NO: 8) which binds within the neomycin marker gene, probe ULC-m1P (SEQ ID NO: 9) which binds within the mouse V3-7 leader sequence, and probe 1635h2P (AAAGAGCCAC CCTCTCCTGC AGGG; SEQ ID NO: 14) which binds within the human V3-20J1 open reading frame. Positive ES cell clones were then used to implant female mice. A litter of pups expressing the human germline V3-20J1 light chain region.

(116) Alternatively, ES cells bearing human germline V3-20J1 light chain region can be transfected with a construct that expresses FLP in order to remove the FRTed neomycin cassette introduced by the targeting construct. Optionally, the neomycin cassette may be removed by breeding to mice that express FLP recombinase (e.g., U.S. Pat. No. 6,774,279). Optionally, the neomycin cassette is retained in the mice.

(117) Rearranged Human Germline VpreBJ5 Targeting Vector (FIG. 3). In a similar fashion, an engineered light chain locus expressing a rearranged human germline VpreBJ5 region was made using a targeting construct including, from 5 to 3, a 5 homology arm containing sequence 5 to the endogenous mouse light chain locus obtained from mouse BAC clone 302g12, a FRTed neomycin resistance gene, an genomic sequence including the human V3-15 promoter, a leader sequence of the mouse V3-7 variable gene segment, an intron sequence of the mouse V3-7 variable gene segment, an open reading frame of a rearranged human germline VpreBJ5 region, a genomic sequence containing a portion of the human J-C intron, and a 3 homology arm containing sequence 3 of the endogenous mouse J5 gene segment obtained from mouse BAC clone 254m04 (FIG. 3, middle). The sequence of the engineered human VpreBJ5 locus is shown in SEQ ID NO: 15.

(118) Targeted insertion of the rearranged human germline VpreBJ5 region into BAC DNA was confirmed by polymerase chain reaction (PCR) using primers located at sequences within the rearranged human germline VpreBJ5 region light chain region. Briefly, the intron sequence 3 to the mouse V3-7 leader sequence was confirmed with primers ULC-ml F (SEQ ID NO: 2) and ULC-m1R (SEQ ID NO: 3). The open reading frame of the rearranged human germline VpreBJ5 region was confirmed with primers 1616-h1F (TGTCCTCGGC CCTTGGA; SEQ ID NO: 16) and 1616-h1R (CCGATGTCAT GGTCGTTCCT; SEQ ID NO: 17). The neomycin cassette was confirmed with primers neoF (SEQ ID NO: 6) and neoR (SEQ ID NO: 7). Targeted BAC DNA was then used to electroporate mouse ES cells to created modified ES cells for generating chimeric mice that express the rearranged human germline VpreBJ5 light chain.

(119) Positive ES cell clones are confirmed by TAQMAN screening and karyotyping using probes specific for the engineered VpreBJ5 light chain region inserted into the endogenous light chain locus. Briefly, probe neoP (SEQ ID NO:8), which binds within the neomycin marker gene, probe ULC-m1P (SEQ ID NO: 9), which binds within the mouse IgV3-7 leader sequence, and probe 1616h1P (ACAATCCGCC TCACCTGCAC CCT; SEQ ID NO: 18) which binds within the human VpreBJ5 open reading frame. Positive ES cell clones are then used to implant female mice to give rise to a litter of pups expressing a germline light chain region.

(120) Alternatively, ES cells bearing the rearranged human germline VpreBJ5 light chain region are transfected with a construct that expresses FLP in order to remove the FRTed neomycin cassette introduced by the targeting construct. Optionally, the neomycin cassette is removed by breeding to mice that express FLP recombinase (e.g., U.S. Pat. No. 6,774,279). Optionally, the neomycin cassette is retained in the mice.

Example 3

Generation of Mice Expressing a Single Rearranged Human Light Chain

(121) Targeted ES cells described above were used as donor ES cells and introduced into an 8-cell stage mouse embryo by the VELOCIMOUSE method (see, e.g., U.S. Pat. No. 7,294,754 and Poueymirou et al. (2007) FO generation mice that are essentially fully derived from the donor gene-targeted ES cells allowing immediate phenotypic analyses Nature Biotech. 25(1): 91-99. VELOCIMICE independently bearing an engineered human germline V1-39J5 light chain region, a V3-20J1 light chain region or a VpreBJ5 light chain region are identified by genotyping using a modification of allele assay (Valenzuela et al., supra) that detects the presence of the unique rearranged human germline light chain region.

(122) Pups are genotyped and a pup heterozygous or homozygous for the unique rearranged human germline light chain region are selected for characterizing expression of the rearranged human germline light chain region.

(123) Flow Cytometry. Expression of the rearranged human light chain region in the normal antibody repertoire of common light chain mice was validated by analysis of immunoglobulin and expression in splenocytes and peripheral blood of common light chain mice. Cell suspensions from harvested spleens and peripheral blood of wild type (n=5), V1-39J5 common light chain heterozygote (n=3), V1-39J5 common light chain homozygote (n=3), V3-20J1 common light chain heterozygote (n=2), and V3-20J1 common light chain homozygote (n=2) mice were made using standard methods and stained with CD19.sup.+, Ig.sup.+ and Ig.sup.+ using fluorescently labeled antibodies (BD Pharmigen).

(124) Briefly, 110.sup.6 cells were incubated with anti-mouse CD16/CD32 (clone 2.4G2, BD Pharmigen) on ice for 10 minutes, followed by labeling with the following antibody cocktail for 30 minutes on ice: APC conjugated anti-mouse CD19 (clone 1D3, BD Pharmigen), PerCP-Cy5.5 conjugated anti-mouse CD3 (clone 17A2, BioLegend), FITC conjugated anti-mouse Ig (clone 187.1, BD Pharmigen), PE conjugated anti-mouse Ig (clone RML-42, BioLegend). Following staining, cells were washed and fixed in 2% formaldehyde. Data acquisition was performed on an LSRII flow cytometer and analyzed with FlowJo. Gating: total B cells (CD19.sup.+CD3.sup.+), Ig.sup.+ B cells (Ig.sup.+Ig.sup.CD19.sup.+CD3.sup.), Ig.sup.+ B cells (Ig.sup.Ig.sup.+CD19.sup.+CD3.sup.). Data gathered from blood and splenocyte samples demonstrated similar results. Table 3 sets forth the percent positive CD19.sup.+ B cells from peripheral blood of one representative mouse from each group that are Ig.sup.+, Ig.sup.+, or Ig.sup.+Ig.sup.+. Percent of CD19.sup.+ B cells in peripheral blood from wild type (WT) and mice homozygous for either the V1-39J5 or V3-20J1 common light chain are shown in FIG. 4.

(125) TABLE-US-00003 TABLE 3 CD19.sup.+ B cells Mouse Ig.sup.+ Ig.sup.+ Ig.sup.+Ig.sup.+ Wild type 4.8 93 0.53 V1-39J5 1.4 93 2.6 V3-20J1 4.2 88 6

(126) Common Light Chain Expression. Expression of each common light chain (V1-39J5 and V3-20J1) was analyzed in heterozygous and homozygous mice using a quantitative PCR assay (e.g. TAQMAN).

(127) Briefly, CD19.sup.+ B cells were purified from the spleens of wild type, mice homozygous for a replacement of the mouse heavy chain and light chain variable region loci with corresponding human heavy chain and light chain variable region loci (H), as well as mice homozygous and heterozygous for each rearranged human light chain region (V1-39J5 or V3-20J1) using mouse CD19 Microbeads (Miltenyi Biotec) according to manufacturer's specifications. Total RNA was purified from CD19.sup.+ B cells using RNeasy Mini kit (Qiagen) according to manufacturer's specifications and genomic RNA was removed using an RNase-free DNase on-column treatment (Qiagen). 200 ng mRNA was reverse-transcribed into cDNA using the First Stand cDNA Synthesis kit (Invitrogen) and the resulting cDNA was amplified with the Taqman Universal PCR Master Mix (Applied Biosystems). All reactions were performed using the ABI 7900 Sequence Detection System (Applied Biosystems) using primers and Taqman MGB probes spanning (1) the V-J junction for both common light chains, (2) the V gene alone (i.e. V1-39 and V3-20), and (3) the mouse C region. Table 4 sets forth the sequences of the primers and probes employed for this assay. Relative expression was normalized to expression of the mouse C region. Results are shown in FIGS. 5A, 5B and 5C.

(128) TABLE-US-00004 TABLE4 Region Primer/ProbeDescription(5-3) SEQIDNOs: V1-39J5 (Sense)AGCAGTCTGCAACCTGAAGATTT 19 Junction (Anti-sense)GTTTAATCTCCAGTCGTGTCCCTT 20 (Probe)CCTCCGATCACCTTC 21 V1-39 (Sense)AAACCAGGGAAAGCCCCTAA 22 (Anti-sense)ATGGGACCCCACTTTGCA 23 (Probe)CTCCTGATCTATGCTGCAT 24 V3-20J1 (Sense)CAGCAGACTGGAGCCTGAAGA 25 Junction (Anti-sense)TGATTTCCACCTTGGTCCCTT 26 (Probe)TAGCTCACCTTGGACGTT 27 V3-20 (Sense)CTCCTCATCTATGGTGCATCCA 28 (Anti-sense)GACCCACTGCCACTGAACCT 29 (Probe)CCACTGGCATCCC 30 MouseC (Sense)TGAGCAGCACCCTCACGTT 31 (Anti-sense)GTGGCCTCACAGGTATAGCTGTT 32 (Probe)ACCAAGGACGAGTATGAA 33

(129) Antigen Specific Common Light Chain Antibodies. Common light chain mice bearing either a V1-39J5 or V3-20J1 common light chain at the endogenous mouse light chain locus were immunized with -galactosidase and antibody titer was measured.

(130) Briefly, -galactosidase (Sigma) was emulsified in titermax adjuvant (Sigma), as per manufacturer's directions. Wild type (n=7), V1-39J5 common light chain homozygotes (n=2) and V3-20J1 common light chain homozygotes (n=5) were immunized by subcutaneous injection with 100 g -galactosidase/Titermax. Mice were boosted by subcutaneous injection two times, 3 weeks apart, with 50 g -galactosidase/Titermax. After the second boost, blood was collected from anaesthetized mice using a retro-orbital bleed into serum separator tubes (BD Biosciences) as per manufacturer's directions. To measure anti--galactosidase IgM or IgG antibodies, ELISA plates (Nunc) were coated with 1 g/mL -galactosidase overnight at 4 C. Excess antigen was washed off before blocking with PBS with 1% BSA for one hour at room temperature. Serial dilutions of serum were added to the plates and incubated for one hour at room temperature before washing. Plates were then incubated with HRP conjugated anti-IgM (Southern Biotech) or anti-lgG (Southern Biotech) for one hour at room temperature. Following another wash, plates were developed with TMB substrate (BD Biosciences). Reactions were stopped with 1N sulfuric acid and OD.sub.450 was read using a Victor X5 Plate Reader (Perkin Elmer). Data was analyzed with GraphPad Prism and signal was calculated as the dilution of serum that is two times above background. Results are shown in FIGS. 6A and 6B.

(131) As shown in this Example, the ratio of / B cells in both the splenic and peripheral compartments of V1-39J5 and V3-20J1 common light chain mice demonstrated a near wild type pattern (Table 3 and FIG. 4). VpreBJ5 common light chain mice, however, demonstrated fewer peripheral B cells, of which about 1-2% express the engineered human light chain region (data not shown). The expression levels of the V1-39J5 and V3-20J1 rearranged human light chain regions from the endogenous light chain locus were elevated in comparison to an endogenous light chain locus containing a complete replacement of mouse V and J gene segments with human V and J gene segments (FIGS. 5A, 5B and 5C). The expression levels of the VpreBJ5 rearranged human light chain region demonstrated similar high expression from the endogenous light chain locus in both heterozygous and homozygous mice (data not shown). This demonstrates that in direct competition with the mouse , , or both endogenous light chain loci, a single rearranged human V.sub.L/J.sub.L sequence can yield better than wild type level expression from the endogenous light chain locus and give rise to normal splenic and blood B cell frequency. Further, the presence of an engineered light chain locus having either a human V1-39J5 or human V3-20J1 sequence was well tolerated by the mice and appear to function in wild type fashion by representing a substantial portion of the light chain repertoire in the humoral component of the immune response (FIGS. 6A and 6B).

Example 4

Breeding of Mice Expressing a Single Rearranged Human Germline Light Chain

(132) This Example describes several other genetically modified mouse strains that can be bred to any one of the common light chain mice described herein to create multiple genetically modified mouse strains harboring multiple genetically modified immunoglobulin loci.

(133) Endogenous Ig Knockout (KO). To optimize the usage of the engineered light chain locus, mice bearing one of the rearranged human germline light chain regions are bred to another mouse containing a deletion in the endogenous light chain locus. In this manner, the progeny obtained will express, as their only light chain, the rearranged human germline light chain region as described in Example 2. Breeding is performed by standard techniques recognized in the art and, alternatively, by a commercial breeder (e.g., The Jackson Laboratory). Mouse strains bearing an engineered light chain locus and a deletion of the endogenous light chain locus are screened for presence of the unique light chain region and absence of endogenous mouse light chains.

(134) Humanized Endogenous Heavy Chain Locus. Mice bearing an engineered human germline light chain locus are bred with mice that contain a replacement of the endogenous mouse heavy chain variable gene locus with the human heavy chain variable gene locus (see U.S. Pat. No. 6,596,541; the VELOCIMMUNE mouse, Regeneron Pharmaceuticals, Inc.). The VELOCIMMUNE mouse comprises a genome comprising human heavy chain variable regions operably linked to endogenous mouse constant region loci such that the mouse produces antibodies comprising a human heavy chain variable region and a mouse heavy chain constant region in response to antigenic stimulation. The DNA encoding the variable regions of the heavy chains of the antibodies is isolated and operably linked to DNA encoding the human heavy chain constant regions. The DNA is then expressed in a cell capable of expressing the fully human heavy chain of the antibody.

(135) Mice bearing a replacement of the endogenous mouse V.sub.H locus with the human V.sub.H locus and a single rearranged human germline V.sub.L region at the endogenous light chain locus are obtained. Reverse chimeric antibodies containing somatically mutated heavy chains (human V.sub.H and mouse C.sub.H) with a single human light chain (human V.sub.L and mouse C.sub.L) are obtained upon immunization with an antigen of interest. V.sub.H and V.sub.L nucleotide sequences of B cells expressing the antibodies are identified and fully human antibodies are made by fusion the V.sub.H and V.sub.L nucleotide sequences to human C.sub.H and C.sub.L nucleotide sequences in a suitable expression system.

Example 5

Generation of Antibodies from Mice Expressing Human Heavy Chains and a Rearranged Human Germline Light Chain Region

(136) After breeding mice that contain the engineered human light chain region to various desired strains containing modifications and deletions of other endogenous Ig loci (as described in Example 4), selected mice can be immunized with an antigen of interest.

(137) Generally, a VELOCIMMUNE mouse containing one of the single rearranged human germline light chain regions is challenged with an antigen, and lymphatic cells (such as B-cells) are recovered from serum of the animals. The lymphatic cells are fused with a myeloma cell line to prepare immortal hybridoma cell lines, and such hybridoma cell lines are screened and selected to identify hybridoma cell lines that produce antibodies containing human heavy chain variables and a rearranged human germline light chains which are specific to the antigen used for immunization. DNA encoding the variable regions of the heavy chains and the light chain are isolated and linked to desirable isotypic constant regions of the heavy chain and light chain. Due to the presence of the endogenous mouse sequences and any additional cis-acting elements present in the endogenous locus, the single light chain of each antibody may be somatically mutated. This adds additional diversity to the antigen-specific repertoire comprising a single light chain and diverse heavy chain sequences. The resulting cloned antibody sequences are subsequently expressed in a cell, such as a CHO cell. Alternatively, DNA encoding the antigen-specific chimeric antibodies or the variable domains of the light and heavy chains is identified directly from antigen-specific lymphocytes.

(138) Initially, high affinity chimeric antibodies are isolated having a human variable region and a mouse constant region. As described above, the antibodies are characterized and selected for desirable characteristics, including affinity, selectivity, epitope, etc. The mouse constant regions are replaced with a desired human constant region to generate the fully human antibody containing a somatically mutated human heavy chain and a single light chain derived from a rearranged human germline light chain region of the invention. Suitable human constant regions include, for example wild type or modified IgG1 or IgG4.

(139) Separate cohorts of VELOCIMMUNE mice containing a replacement of the endogenous mouse heavy chain locus with human V.sub.H, D.sub.H, and J.sub.H gene segments and a replacement of the endogenous mouse light chain locus with either the engineered germline V1-39J5 human light chain region or the engineered germline V3-20J1 human light chain region (described above) were immunized with a human cell-surface receptor protein (Antigen E). Antigen E is administered directly onto the hind footpad of mice with six consecutive injections every 3-4 days. Two to three micrograms of Antigen E are mixed with 10 g of CpG oligonucleotide (Cat # tlrl-modn-ODN1826 oligonucleotide; InVivogen, San Diego, Calif.) and 25 g of Adju-Phos (Aluminum phosphate gel adjuvant, Cat# H-71639-250; Brenntag Biosector, Frederikssund, Denmark) prior to injection. A total of six injections are given prior to the final antigen recall, which is given 3-5 days prior to sacrifice. Bleeds after the 4th and 6th injection are collected and the antibody immune response is monitored by a standard antigen-specific immunoassay.

(140) When a desired immune response is achieved splenocytes are harvested and fused with mouse myeloma cells to preserve their viability and form hybridoma cell lines. The hybridoma cell lines are screened and selected to identify cell lines that produce Antigen E-specific common light chain antibodies. Using this technique several anti-Antigen E-specific common light chain antibodies (i.e., antibodies possessing human heavy chain variable domains, the same human light chain variable domain, and mouse constant domains) are obtained.

(141) Alternatively, anti-Antigen E common light chain antibodies are isolated directly from antigen-positive B cells without fusion to myeloma cells, as described in U.S. 2007/0280945A1, herein specifically incorporated by reference in its entirety. Using this method, several fully human anti-Antigen E common light chain antibodies (i.e., antibodies possessing human heavy chain variable domains, either an engineered human V1-39J5 light chain or an engineered human V3-20J1 light chain region, and human constant domains) were obtained.

(142) The biological properties of the exemplary anti-Antigen E common light chain antibodies generated in accordance with the methods of this Example are described in detail in the sections set forth below.

Example 6

Heavy Chain Gene Segment Usage in Antigen-Specific Common Light Chain Antibodies

(143) To analyze the structure of the human anti-Antigen E common light chain antibodies produced, nucleic acids encoding heavy chain antibody variable regions were cloned and sequenced. From the nucleic acid sequences and predicted amino acid sequences of the antibodies, gene usage was identified for the heavy chain variable region (HCVR) of selected common light chain antibodies obtained from immunized VELOCIMMUNE mice containing either the engineered human V1-39J5 light chain or engineered human V3-20J1 light chain region. Results are shown in Tables 5 and 6, which demonstrate that mice according to the invention generate antigen-specific common light chain antibodies from a variety of human heavy chain gene segments, due to a variety of rearrangements, when employing either a mouse that expresses a light chain from only a human V1-39- or a human V3-20-derived light chain. Human V.sub.H gene segments of the 2, 3, 4, and 5 families rearranged with a variety of human D.sub.H segments and human J.sub.H segments to yield antigen-specific antibodies.

(144) TABLE-US-00005 TABLE 5 V1-39J5 Common Light Chain Antibodies HCVR Antibody V.sub.H D.sub.H J.sub.H 2952 2-5 6-6 1 5978 2-5 6-6 1 5981 2-5 3-22 1 6027 3-13 6-6 5 3022 3-23 3-10 4 3028 3-23 3-3 4 5999 3-23 6-6 4 6009 3-23 2-8 4 6011 3-23 7-27 4 5980 3-30 1-1 4 3014 3-30 1-7 4 3015 3-30 1-7 4 3023 3-30 1-7 4 3024 3-30 1-7 4 3032 3-30 1-7 4 6024 3-30 1-7 4 6025 3-30 1-7 4 6031 3-30 1-7 4 6007 3-30 3-3 4 2982 3-30 3-22 5 6001 3-30 3-22 5 6005 3-30 3-22 5 6035 3-30 5-5 2 3013 3-30 5-12 4 3042 3-30 5-12 4 2955 3-30 6-6 1 3043 3-30 6-6 3 3018 3-30 6-6 4 2949 3-30 6-6 5 2950 3-30 6-6 5 2954 3-30 6-6 5 2978 3-30 6-6 5 3016 3-30 6-6 5 3017 3-30 6-6 5 3033 3-30 6-6 5 3041 3-30 6-6 5 5979 3-30 6-6 5 5998 3-30 6-6 5 6004 3-30 6-6 5 6010 3-30 6-6 5 6019 3-30 6-6 5 6021 3-30 6-6 5 6022 3-30 6-6 5 6023 3-30 6-6 5 6030 3-30 6-6 5 6032 3-30 6-6 5 2985 3-30 6-13 4 2997 3-30 6-13 4 3011 3-30 6-13 4 3047 3-30 6-13 4 5982 3-30 6-13 4 6002 3-30 6-13 4 6003 3-30 6-13 4 6012 3-30 6-13 4 6013 3-30 6-13 4 6014 3-30 6-13 4 6015 3-30 6-13 4 6016 3-30 6-13 4 6017 3-30 6-13 4 6020 3-30 6-13 4 6034 3-30 6-13 4 2948 3-30 7-27 4 2987 3-30 7-27 4 2996 3-30 7-27 4 3005 3-30 7-27 4 3012 3-30 7-27 4 3020 3-30 7-27 4 3021 3-30 7-27 4 3025 3-30 7-27 4 3030 3-30 7-27 4 3036 3-30 7-27 4 5997 3-30 7-27 4 6033 3-30 7-27 4 3004 3-30 7-27 5 6028 3-30 7-27 6 3010 4-59 3-16 3 3019 4-59 3-16 3 6018 4-59 3-16 3 6026 4-59 3-16 3 6029 4-59 3-16 3 6036 4-59 3-16 3 6037 4-59 3-16 3 2964 4-59 3-22 3 3027 4-59 3-16 4 3046 5-51 5-5 3 6000 1-69 6-13 4 6006 1-69 6-6 5 6008 1-69 6-13 4

(145) TABLE-US-00006 TABLE 6 V3-20J1 Common Light Chain Antibodies HCVR Antibody V.sub.H D.sub.H J.sub.H 5989 3-30 3-3 3 5994 3-33 1-7 4 5985 3-33 2-15 4 5987 3-33 2-15 4 5995 3-33 2-15 4 2968 4-39 1-26 3 5988 4-39 1-26 3 5990 4-39 1-26 3 5992 4-39 1-26 3 2975 5-51 6-13 5 2972 5-51 3-16 6 5986 5-51 3-16 6 5993 5-51 3-16 6 5996 5-51 3-16 6 5984 3-53 1-1 4

Example 7

Determination of Blocking Ability of Antigen-Specific Common Light Chain Antibodies by LUMINEX Assay

(146) Ninety-eight human common light chain antibodies raised against Antigen E were tested for their ability to block binding of Antigen E's natural ligand (Ligand Y) to Antigen E in a bead-based assay.

(147) The extracellular domain (ECD) of Antigen E was conjugated to two myc epitope tags and a 6 histidine tag (Antigen E-mmH) and amine-coupled to carboxylated microspheres at a concentration of 20 g/mL in MES buffer. The mixture was incubated for two hours at room temperature followed by bead deactivation with 1M Tris pH 8.0 followed by washing in PBS with 0.05% (v/v) Tween-20. The beads were then blocked with PBS (Irvine Scientific, Santa Ana, Calif.) containing 2% (w/v) BSA (Sigma-Aldrich Corp., St. Louis, Mo.). In a 96-well filter plate, supernatants containing Antigen E-specific common light chain antibodies were diluted 1:15 in buffer. A negative control containing a mock supernatant with the same media components as for the antibody supernatant was prepared. Antigen E-labeled beads were added to the supernatants and incubated overnight at 4 C. Biotinylated-Ligand Y protein was added to a final concentration of 0.06 nM and incubated for two hours at room temperature. Detection of biotinylated-Ligand Y bound to Antigen E-myc-myc-6His labeled beads was determined with R-Phycoerythrin conjugated to Streptavidin (Moss Inc, Pasadena, Md.) followed by measurement in a LUMINEX flow cytometry-based analyzer. Background Mean Fluorescence Intensity (MFI) of a sample without Ligand Y was subtracted from all samples. Percent blocking was calculated by division of the background-subtracted MFI of each sample by the adjusted negative control value, multiplying by 100 and subtracting the resulting value from 100.

(148) In a similar experiment, the same 98 human common light chain antibodies raised against Antigen E were tested for their ability to block binding of Antigen E to Ligand Y-labeled beads.

(149) Briefly, Ligand Y was amine-coupled to carboxylated microspheres at a concentration of 20 g/mL diluted in MES buffer. The mixture and incubated two hours at room temperature followed by deactivation of beads with 1M Tris pH 8 then washing in PBS with 0.05% (v/v) Tween-20. The beads were then blocked with PBS (Irvine Scientific, Santa Ana, Calif.) containing 2% (w/v) BSA (Sigma-Aldrich Corp., St. Louis, Mo.). In a 96-well filter plate, supernatants containing Antigen E-specific common light chain antibodies were diluted 1:15 in buffer. A negative control containing a mock supernatant with the same media components as for the antibody supernatant was prepared. A biotinylated-Antigen E-mmH was added to a final concentration of 0.42 nM and incubated overnight at 4 C. Ligand Y-labeled beads were then added to the antibody/Antigen E mixture and incubated for two hours at room temperature. Detection of biotinylated-Antigen E-mmH bound to Ligand Y-beads was determined with R-Phycoerythrin conjugated to Streptavidin (Moss Inc, Pasadena, Md.) followed by measurement in a LUMINEX flow cytometry-based analyzer. Background Mean Fluorescence Intensity (MFI) of a sample without Antigen E was subtracted from all samples. Percent blocking was calculated by division of the background-subtracted MFI of each sample by the adjusted negative control value, multiplying by 100 and subtracting the resulting value from 100.

(150) Tables 7 and 8 show the percent blocking for all 98 anti-Antigen E common light chain antibodies tested in both LUMINEX assays. ND: not determined under current experimental conditions.

(151) TABLE-US-00007 TABLE 7 V1-39J5 Common Light Chain Antibodies % Blocking of % Blocking of Antibody Antigen E-Labeled Beads Antigen E In Solution 2948 81.1 47.8 2948G 38.6 ND 2949 97.6 78.8 2949G 97.1 73.7 2950 96.2 81.9 2950G 89.8 31.4 2952 96.1 74.3 2952G 93.5 39.9 2954 93.7 70.1 2954G 91.7 30.1 2955 75.8 30.0 2955G 71.8 ND 2964 92.1 31.4 2964G 94.6 43.0 2978 98.0 95.1 2978G 13.9 94.1 2982 92.8 78.5 2982G 41.9 52.4 2985 39.5 31.2 2985G 2.0 5.0 2987 81.7 67.8 2987G 26.6 29.3 2996 87.3 55.3 2996G 95.9 38.4 2997 93.4 70.6 2997G 9.7 7.5 3004 79.0 48.4 3004G 60.3 40.7 3005 97.4 93.5 3005G 77.5 75.6 3010 98.0 82.6 3010G 97.9 81.0 3011 87.4 42.8 3011G 83.5 41.7 3012 91.0 60.8 3012G 52.4 16.8 3013 80.3 65.8 3013G 17.5 15.4 3014 63.4 20.7 3014G 74.4 28.5 3015 89.1 55.7 3015G 58.8 17.3 3016 97.1 81.6 3016G 93.1 66.4 3017 94.8 70.2 3017G 87.9 40.8 3018 85.4 54.0 3018G 26.1 12.7 3019 99.3 92.4 3019G 99.3 88.1 3020 96.7 90.3 3020G 85.2 41.5 3021 74.5 26.1 3021G 81.1 27.4 3022 65.2 17.6 3022G 67.2 9.1 3023 71.4 28.5 3023G 73.8 29.7 3024 73.9 32.6 3024G 89.0 10.0 3025 70.7 15.6 3025G 76.7 24.3 3027 96.2 61.6 3027G 98.6 75.3 3028 92.4 29.0 3028G 87.3 28.8 3030 6.0 10.6 3030G 41.3 14.2 3032 76.5 31.4 3032G 17.7 11.0 3033 98.2 86.1 3033G 93.6 64.0 3036 74.7 32.7 3036G 90.1 51.2 3041 95.3 75.9 3041G 92.4 51.6 3042 88.1 73.3 3042G 60.9 25.2 3043 90.8 65.8 3043G 92.8 60.3

(152) TABLE-US-00008 TABLE 8 V3-20J1 Common Light Chain Antibodies % Blocking of % Blocking of Antibody Antigen E-Labeled Beads Antigen E In Solution 2968 97.1 73.3 2968G 67.1 14.6 2969 51.7 20.3 2969G 37.2 16.5 2970 92.2 34.2 2970G 92.7 27.2 2971 23.4 11.6 2971G 18.8 18.9 2972 67.1 38.8 2972G 64.5 39.2 2973 77.7 27.0 2973G 51.1 20.7 2974 57.8 12.4 2974G 69.9 17.6 2975 49.4 18.2 2975G 32.0 19.5 2976 1.0 1.0 2976G 50.4 20.4

(153) In the first LUMINEX experiment described above, 80 common light chain antibodies containing the V1-39J5 engineered light chain were tested for their ability to block Ligand Y binding to Antigen E-labeled beads. Of these 80 common light chain antibodies, 68 demonstrated >50% blocking, while 12 demonstrated <50% blocking (6 at 25-50% blocking and 6 at <25% blocking). For the 18 common light chain antibodies containing the V3-20J1 engineered light chain, 12 demonstrated >50% blocking, while 6 demonstrated <50% blocking (3 at 25-50% blocking and 3 at <25% blocking) of Ligand Y binding to Antigen E-labeled beads.

(154) In the second LUMINEX experiment described above, the same 80 common light chain antibodies containing the V1-39J5 engineered light chain were tested for their ability to block binding of Antigen E to Ligand Y-labeled beads. Of these 80 common light chain antibodies, 36 demonstrated >50% blocking, while 44 demonstrated <50% blocking (27 at 25-50% blocking and 17 at <25% blocking). For the 18 common light chain antibodies containing the V3-20J1 engineered light chain, 1 demonstrated >50% blocking, while 17 demonstrated <50% blocking (5 at 25-50% blocking and 12 at <25% blocking) of Antigen E binding to Ligand Y-labeled beads.

(155) The data of Tables 7 and 8 establish that the rearrangements described in Tables 5 and 6 generated anti-Antigen E-specific common light chain antibodies that blocked binding of Ligand Y to its cognate receptor Antigen E with varying degrees of efficacy, which is consistent with the anti-Antigen E common light chain antibodies of Tables 5 and 6 comprising antibodies with overlapping and non-overlapping epitope specificity with respect to Antigen E.

Example 8

Determination of Blocking Ability of Antigen-Specific Common Light Chain Antibodies by ELISA

(156) Human common light chain antibodies raised against Antigen E were tested for their ability to block Antigen E binding to a Ligand Y-coated surface in an ELISA assay.

(157) Ligand Y was coated onto 96-well plates at a concentration of 2 g/mL diluted in PBS and incubated overnight followed by washing four times in PBS with 0.05% Tween-20. The plate was then blocked with PBS (Irvine Scientific, Santa Ana, Calif.) containing 0.5% (w/v) BSA (Sigma-Aldrich Corp., St. Louis, Mo.) for one hour at room temperature. In a separate plate, supernatants containing anti-Antigen E common light chain antibodies were diluted 1:10 in buffer. A mock supernatant with the same components of the antibodies was used as a negative control. Antigen E-mmH (described above) was added to a final concentration of 0.150 nM and incubated for one hour at room temperature. The antibody/Antigen E-mmH mixture was then added to the plate containing Ligand Y and incubated for one hour at room temperature. Detection of Antigen E-mmH bound to Ligand Y was determined with Horse-Radish Peroxidase (HRP) conjugated to anti-Penta-His antibody (Qiagen, Valencia, Calif.) and developed by standard colorimetric response using tetramethylbenzidine (TMB) substrate (BD Biosciences, San Jose, Calif.) neutralized by sulfuric acid. Absorbance was read at OD450 for 0.1 sec. Background absorbance of a sample without Antigen E was subtracted from all samples. Percent blocking was calculated by division of the background-subtracted MFI of each sample by the adjusted negative control value, multiplying by 100 and subtracting the resulting value from 100.

(158) Tables 9 and 10 show the percent blocking for all 98 anti-Antigen E common light chain antibodies tested in the ELISA assay. ND: not determined under current experimental conditions.

(159) TABLE-US-00009 TABLE 9 V1-39J5 Common Light Chain Antibodies % Blocking of Antibody Antigen E In Solution 2948 21.8 2948G 22.9 2949 79.5 2949G 71.5 2950 80.4 2950G 30.9 2952 66.9 2952G 47.3 2954 55.9 2954G 44.7 2955 12.1 2955G 25.6 2964 34.8 2964G 47.7 2978 90.0 2978G 90.2 2982 59.0 2982G 20.4 2985 10.5 2985G ND 2987 31.4 2987G ND 2996 29.3 2996G ND 2997 48.7 2997G ND 3004 16.7 3004G 3.5 3005 87.2 3005G 54.3 3010 74.5 3010G 84.6 3011 19.4 3011G ND 3012 45.0 3012G 12.6 3013 39.0 3013G 9.6 3014 5.2 3014G 17.1 3015 23.7 3015G 10.2 3016 78.1 3016G 37.4 3017 61.6 3017G 25.2 3018 40.6 3018G 14.5 3019 94.6 3019G 92.3 3020 80.8 3020G ND 3021 7.6 3021G 20.7 3022 2.4 3022G 15.0 3023 9.1 3023G 19.2 3024 7.5 3024G 15.2 3025 ND 3025G 13.9 3027 61.4 3027G 82.7 3028 40.3 3028G 12.3 3030 ND 3030G 9.5 3032 ND 3032G 13.1 3033 77.1 3033G 32.9 3036 17.6 3036G 24.6 3041 59.3 3041G 30.7 3042 39.9 3042G 16.1 3043 57.4 3043G 46.1

(160) TABLE-US-00010 TABLE 10 V3-20J1 Common Light Chain Antibodies % Blocking of Antibody Antigen E In Solution 2968 68.9 2968G 15.2 2969 10.1 2969G 23.6 2970 34.3 2970G 41.3 2971 6.3 2971G 27.1 2972 9.6 2972G 35.7 2973 20.7 2973G 23.1 2974 ND 2974G 22.0 2975 8.7 2975G 19.2 2976 4.6 2976G 26.7

(161) As described in this Example, of the 80 common light chain antibodies containing the V1-39J5 engineered light chain tested for their ability to block Antigen E binding to a Ligand Y-coated surface, 22 demonstrated >50% blocking, while 58 demonstrated <50% blocking (20 at 25-50% blocking and 38 at <25% blocking). For the 18 common light chain antibodies containing the V3-20J1 engineered light chain, one demonstrated >50% blocking, while 17 demonstrated <50% blocking (5 at 25-50% blocking and 12 at <25% blocking) of Antigen E binding to a Ligand Y-coated surface.

(162) These results are also consistent with the Antigen E-specific common light chain antibody pool comprising antibodies with overlapping and non-overlapping epitope specificity with respect to Antigen E.

Example 9

BIACORE Affinity Determination for Antigen-Specific Common Light Chain Antibodies

(163) Equilibrium dissociation constants (K.sub.D) for selected antibody supernatants were determined by SPR (Surface Plasmon Resonance) using a BIACORE T100 instrument (GE Healthcare). All data was obtained using HBS-EP (10 mM Hepes, 150 mM NaCl, 0.3 mM EDTA, 0.05% Surfactant P20, pH 7.4) as both the running and sample buffers, at 25 C. Antibodies were captured from crude supernatant samples on a CM5 sensor chip surface previously derivatized with a high density of anti-human Fc antibodies using standard amine coupling chemistry. During the capture step, supernatants were injected across the anti-human Fc surface at a flow rate of 3 L/min, for a total of 3 minutes. The capture step was followed by an injection of either running buffer or analyte at a concentration of 100 nM for 2 minutes at a flow rate of 35 L/min. Dissociation of antigen from the captured antibody was monitored for 6 minutes. The captured antibody was removed by a brief injection of 10 mM glycine, pH 1.5. All sensorgrams were double referenced by subtracting sensorgrams from buffer injections from the analyte sensorgrams, thereby removing artifacts caused by dissociation of the antibody from the capture surface. Binding data for each antibody was fit to a 1:1 binding model with mass transport using BIAcore T100 Evaluation software v2.1. Results are shown in Tables 11 and 12.

(164) TABLE-US-00011 TABLE 11 V1-39J5 Common Light Chain Antibodies 100 nM Antigen E Antibody K.sub.D (nM) T.sub.1/2 (min) 2948 8.83 28 2948G 95.0 1 2949 3.57 18 2949G 6.37 9 2950 4.91 17 2950G 13.6 5 2952 6.25 7 2952G 7.16 4 2954 2.37 24 2954G 5.30 9 2955 14.4 6 2955G 12.0 4 2964 14.8 6 2964G 13.0 9 2978 1.91 49 2978G 1.80 58 2982 6.41 19 2982G 16.3 9 2985 64.4 9 2985G 2.44 8 2987 21.0 11 2987G 37.6 4 2996 10.8 9 2996G 24.0 2 2997 7.75 19 2997G 151 1 3004 46.5 14 3004G 1.93 91 3005 2.35 108 3005G 6.96 27 3010 4.13 26 3010G 2.10 49 3011 59.1 5 3011G 41.7 5 3012 9.71 20 3012G 89.9 2 3013 20.2 20 3013G 13.2 4 3014 213 4 3014G 36.8 3 3015 29.1 11 3015G 65.9 0 3016 4.99 17 3016G 18.9 4 3017 9.83 8 3017G 55.4 2 3018 11.3 36 3018G 32.5 3 3019 1.54 59 3019G 2.29 42 3020 5.41 39 3020G 41.9 6 3021 50.1 6 3021G 26.8 4 3022 25.7 17 3022G 20.8 12 3023 263 9 3023G 103 5 3024 58.8 7 3024G 7.09 10 3025 35.2 6 3025G 42.5 8 3027 7.15 6 3027G 4.24 18 3028 6.89 37 3028G 7.23 22 3030 46.2 7 3030G 128 3 3032 53.2 9 3032G 13.0 1 3033 4.61 17 3033G 12.0 5 3036 284 12 3036G 18.2 10 3041 6.90 12 3041G 22.9 2 3042 9.46 34 3042G 85.5 3 3043 9.26 29 3043G 13.1 22

(165) TABLE-US-00012 TABLE 12 V3-20J1 Common Light Chain Antibodies 100 nM Antigen E Antibody K.sub.D (nM) T.sub.1/2 (min) 2968 5.50 8 2968G 305 0 2969 34.9 2 2969G 181 1 2970G 12.3 3 2971G 32.8 22 2972 6.02 13 2972G 74.6 26 2973 5.35 39 2973G 11.0 44 2974 256 0 2974G 138 0 2975 38.0 2 2975G 134 1 2976 6.73 10 2976G 656 8

(166) The binding affinities of common light chain antibodies comprising the rearrangements shown in Tables 5 and 6 vary, with nearly all exhibiting a K.sub.D in the nanomolar range. The affinity data is consistent with the common light chain antibodies resulting from the combinatorial association of rearranged variable domains described in Tables 5 and 6 being high-affinity, clonally selected, and somatically mutated. Coupled with data previously shown, the common light chain antibodies described in Tables 5 and 6 comprise a collection of diverse, high-affinity antibodies that exhibit specificity for one or more epitopes on Antigen E.

Example 10

Determination of Binding Specificities of Antigen-Specific Common Light Chain Antibodies by LUMINEX Assay

(167) Selected anti-Antigen E common light chain antibodies were tested for their ability to bind to the ECD of Antigen E and Antigen E ECD variants, including the cynomolgous monkey ortholog (Mf Antigen E), which differs from the human protein in approximately 10% of its amino acid residues; a deletion mutant of Antigen E lacking the last 10 amino acids from the C-terminal end of the ECD (Antigen E-ACT); and two mutants containing an alanine substitution at suspected locations of interaction with Ligand Y (Antigen E-Ala1 and AntigenE-Ala2). The Antigen E proteins were produced in CHO cells and each contained a myc-myc-His C-terminal tag.

(168) For the binding studies, Antigen E ECD protein or variant protein (described above) from 1 mL of culture medium was captured by incubation for 2 hr at room temperature with 110.sup.6 microsphere (LUMINEX) beads covalently coated with an anti-myc monoclonal antibody (MAb 9E10, hybridoma cell line CRL-1729; ATCC, Manassas, Va.). The beads were then washed with PBS before use. Supernatants containing anti-Antigen E common light chain antibodies were diluted 1:4 in buffer and added to 96-well filter plates. A mock supernatant with no antibody was used as negative control. The beads containing the captured Antigen E proteins were then added to the antibody samples (3000 beads per well) and incubated overnight at 4 C. The following day, the sample beads were washed and the bound common light chain antibody was detected with a R-phycoerythrin-conjugated anti-human IgG antibody. The fluorescence intensity of the beads (approximately 100 beads counted for each antibody sample binding to each Antigen E protein) was measured with a LUMINEX flow cytometry-based analyzer, and the median fluorescence intensity (MFI) for at least 100 counted beads per bead/antibody interaction was recorded. Results are shown in Tables 13 and 14.

(169) TABLE-US-00013 TABLE 13 V1-39J5 Common Light Chain Antibodies Mean Fluorescence Intensity (MFI) Antigen Antigen Antigen Antigen Mf Antibody E-ECD E-CT E-Ala1 E-Ala2 Antigen E 2948 1503 2746 4953 3579 1648 2948G 537 662 2581 2150 863 2949 3706 4345 8169 5678 5142 2949G 3403 3318 7918 5826 5514 2950 3296 4292 7756 5171 4749 2950G 2521 2408 7532 5079 3455 2952 3384 1619 1269 168 911 2952G 3358 1001 108 55 244 2954 2808 3815 7114 5039 3396 2954G 2643 2711 7620 5406 3499 2955 1310 2472 4738 3765 1637 2955G 1324 1802 4910 3755 1623 2964 5108 1125 4185 346 44 2964G 4999 729 4646 534 91 2978 6986 2800 14542 10674 8049 2978G 5464 3295 11652 8026 6452 2982 4955 2388 13200 9490 6772 2982G 3222 2013 8672 6509 4949 2985 1358 832 4986 3892 1669 2985G 43 43 128 244 116 2987 3117 1674 7646 5944 2546 2987G 3068 1537 9202 6004 4744 2996 4666 1917 12875 9046 6459 2996G 2752 1736 8742 6150 4873 2997 5164 2159 12167 8361 5922 2997G 658 356 3392 2325 1020 3004 2794 1397 8542 6268 3083 3004G 2753 1508 8267 5808 4345 3005 5683 2221 12900 9864 5868 3005G 4344 2732 10669 7125 5880 3010 4829 1617 2642 3887 44 3010G 3685 1097 2540 3022 51 3011 2859 2015 7855 5513 3863 3011G 2005 1072 6194 4041 3181 3012 3233 2221 8543 5637 3307 3012G 968 378 3115 2261 1198 3013 2343 1791 6715 4810 2528 3013G 327 144 1333 1225 370 3014 1225 1089 5436 3621 1718 3014G 1585 851 5178 3705 2411 3015 3202 2068 8262 5554 3796 3015G 1243 531 4246 2643 1611 3016 4220 2543 8920 5999 5666 3016G 2519 1277 6344 4288 4091 3017 3545 2553 8700 5547 5098 3017G 1972 1081 5763 3825 3038 3018 2339 1971 6140 4515 2293 3018G 254 118 978 1020 345 3019 5235 1882 7108 4249 54 3019G 4090 1270 4769 3474 214 3020 3883 3107 8591 6602 4420 3020G 2165 1209 6489 4295 2912 3021 1961 1472 6872 4641 2742 3021G 2091 1005 6430 3988 2935 3022 2418 793 7523 2679 36 3022G 2189 831 6182 3051 132 3023 1692 1411 5788 3898 2054 3023G 1770 825 5702 3677 2648 3024 1819 1467 6179 4557 2450 3024G 100 87 268 433 131 3025 1853 1233 6413 4337 2581 3025G 1782 791 5773 3871 2717 3027 4131 1018 582 2510 22 3027G 3492 814 1933 2596 42 3028 4361 2545 9884 5639 975 3028G 2835 1398 7124 3885 597 3030 463 277 1266 1130 391 3030G 943 302 3420 2570 1186 3032 2083 1496 6594 4402 2405 3032G 295 106 814 902 292 3033 4409 2774 8971 6331 5825 3033G 2499 1234 6745 4174 4210 3036 1755 1362 6137 4041 1987 3036G 2313 1073 6387 4243 3173 3041 3674 2655 8629 5837 4082 3041G 2519 1265 6468 4274 3320 3042 2653 2137 7277 5124 3325 3042G 1117 463 4205 2762 1519 3043 3036 2128 7607 5532 3366 3043G 2293 1319 6573 4403 3228

(170) TABLE-US-00014 TABLE 14 V3-20J1 Common Light Chain Antibodies Mean Fluorescence Intensity (MFI) Antigen Antigen Antigen Antigen Mf Antibody E-ECD E-CT E-Ala1 E-Ala2 Antigen E 2968 6559 3454 14662 3388 29 2968G 2149 375 9109 129 22 2969 2014 1857 7509 5671 3021 2969G 1347 610 6133 4942 2513 2970 5518 1324 14214 607 32 2970G 4683 599 12321 506 31 2971 501 490 2506 2017 754 2971G 578 265 2457 2062 724 2972 2164 2158 8408 6409 3166 2972G 1730 992 6364 4602 2146 2973 3527 1148 3967 44 84 2973G 1294 276 1603 28 44 2974 1766 722 8821 241 19 2974G 2036 228 8172 135 26 2975 1990 1476 8669 6134 2468 2975G 890 315 4194 3987 1376 2976 147 140 996 1079 181 2976G 1365 460 6024 3929 1625

(171) The anti-Antigen E common light chain antibody supernatants exhibited high specific binding to the beads linked to Antigen E-ECD. For these beads, the negative control mock supernatant resulted in negligible signal (<10 MFI) when combined with the Antigen E-ECD bead sample, whereas the supernatants containing anti-Antigen E common light chain antibodies exhibited strong binding signal (average MFI of 2627 for 98 antibody supernatants; MFI >500 for 91/98 antibody samples).

(172) As a measure of the ability of the selected anti-Antigen E common light chain antibodies to identify different epitopes on the ECD of Antigen E, the relative binding of the antibodies to the variants were determined. All four Antigen E variants were captured to the anti-myc LUMINEX beads as described above for the native Antigen E-ECD binding studies, and the relative binding ratios (MFI.sub.variant/MFI.sub.Antigen E-ECD) were determined. For 98 tested common light chain antibody supernatants shown in Tables 12 and 13, the average ratios (MFI.sub.variant/MFI.sub.Antigen E-ECD) differed for each variant, likely reflecting different capture amounts of proteins on the beads (average ratios of 0.61, 2.9, 2.0, and 1.0 for Antigen E-CT, Antigen E-Ala1, Antigen E-Ala2, and Mf Antigen E, respectively). For each protein variant, the binding for a subset of the 98 tested common light chain antibodies showed greatly reduced binding, indicating sensitivity to the mutation that characterized a given variant. For example, 19 of the common light chain antibody samples bound to the Mf Antigen E with MFI.sub.variant/MFI.sub.Antigen E-ECD of <8%. Since many in this group include high or moderately high affinity antibodies (5 with K.sub.D<5 nM, 15 with K.sub.D<50 nM), it is likely that the lower signal for this group results from sensitivity to the sequence (epitope) differences between native Antigen E-ECD and a given variant rather than from lower affinities.

(173) These data establish that the common light chain antibodies described in Tables 5 and 6 represent a diverse group of Antigen-E-specific common light chain antibodies that specifically recognize more than one epitope on Antigen E.

Example 11

Light Chain Shuffling in Common Light Chain Antibodies

(174) Heavy chains of selected antigen-specific common light chain antibodies were tested for binding to Antigen E after repairing the heavy chains with either a germline V1-39J5 or a germline V3-20J1 engineered light chain (as described in Example 1).

(175) Briefly, 247 heavy chains of Antigen E-specific common light chain antibodies (V1-39J5 and V3-20J1) were transfected with either a germline V1-39 or a germline V3-20 engineered light chain and rescreened for binding to Antigen E by a LUMINEX assay (as described in Example 7 and Example 10). Binding to Antigen E was confirmed by BIACORE (as described in Example 9). The results are shown in Table 15.

(176) As shown in this Example, twenty-eight common light chain antibodies specific for Antigen E were capable of binding to Antigen E when repaired with a germline form of the light chain.

(177) TABLE-US-00015 TABLE 15 Original Repaired No. No. Confirmed Light Chain Light Chain Tested Binders 1-39 1-39 198 23 3-20 3-20 49 5

Example 12

Heavy Chain Gene Usage and Somatic Hypermutation Frequency in Common Light Chain Antibodies

(178) Heavy and light chain sequences (>6000) of antibodies raised in VELCOIMMUNE mice (e.g., U.S. Pat. Nos. 6,596,541 and 7,105,348) were compiled with heavy and light chain sequences (>600) of common light chain antibodies obtained by a multi-antigen immunization scheme employing the engineered light chain mice (described above) to compare heavy chain gene segment usage and somatic hypermutation frequencies of the antibody chains.

(179) Heavy Chain Gene Usage. Heavy and light chain sequences obtained from VELOCIMMUNE mice containing a replacement of the endogenous mouse heavy chain locus with human V.sub.H, D.sub.H, and J.sub.H gene segments and a replacement of the endogenous mouse light chain locus with either the engineered germline V1-39J5 human light chain region or the engineered germline V3-20J1 human light chain region (as described in Example 2) immunized with a human cell-surface receptor (Antigen E), a heterodimer of two human cell-surface glycoproteins (Antigen F), a human cytokine receptor (Antigen G) and a human tumor differentiation antigen (Antigen H) were analyzed for heavy chain gene segment usage and V.sub.H and J.sub.H gene segments were recorded. Results are shown in Tables 16-18. Percentages in Tables 16-18 represent rounded values and in some cases may not equal 100% when added together.

(180) Table 16 sets forth the percent heavy chain family usage for antibodies from VELCOIMMUNE mice (VI), antibodies from VELCOIMMUNE mice having a cognate V1-39 light chain (VI-V1-39), antibodies from V1-39 engineered light chain mice (V1-39), antibodies from VELCOIMMUNE mice having a cognate V3-20 light chain (VI-V3-20), and antibodies from V3-20 engineered light chain mice (V3-20). Table 17 sets forth the percent V.sub.H and J.sub.H gene usage for antibodies from VELCOIMMUNE mice (VI), antibodies from VELCOIMMUNE mice having a cognate V1-39 light chain (VI-V1-39), antibodies from V1-39 engineered light chain mice (V1-39), antibodies from VELCOIMMUNE mice having a cognate V3-20 light chain (VI-V3-20), and antibodies from V3-20 engineered light chain mice (V3-20). Table 18 sets forth the percent V.sub.H gene usage for antibodies from V1-39 engineered light chain mice (V1-39 Mice) from each immunization group (Antigens E, F, G and H) and the percent V.sub.H gene usage for antibodies from V3-20 engineered light chain mice (V3-20 Mice) from selected immunization groups (Antigens E and G).

(181) As shown in this Example, heavy chain gene usage for antigens tested in V1-39J5-engineered light chain mice was characterized by a preponderance of V.sub.H family III subgroups (V.sub.H3-7, V.sub.H3-9, V.sub.H3-11, V.sub.H3-13, V.sub.H3-20, V.sub.H3-23, V.sub.H3-30, V.sub.H3-33 and V.sub.H3-48). Notable usage of other V.sub.H family subgroups was characterized by usage of V.sub.H1-18, V.sub.H1-69, V.sub.H2-5, V.sub.H4-59 and V.sub.H6-1. For antigens tested in V3-20J1 engineered light chain mice, heavy chain gene usage was characterized by a preponderance of V.sub.H family III, V.sub.H family IV and V.sub.H family V subgroups (V.sub.H3-11, V.sub.H3-30, V.sub.H3-33, V.sub.H4-39, V.sub.H4-59 and V.sub.H5-51). Notable usage of other V.sub.H family subgroups was characterized by usage of V.sub.H1-18, V.sub.H1-69, V.sub.H2-70 and V.sub.H6-1.

(182) Somatic Hypermutation Frequency. Heavy and light chains from antibodies raised in VELCOIMMUNE mice and the engineered light chain mice (described above) were aligned to germline sequences according to the heavy and light chain gene usage demonstrated for each heavy and/or light chain. Amino acid changes for each framework region (FW) and complementarity determining region (CDR) for both heavy and light chain of each sequence were calculated. Results are shown in Tables 19-22. Percentages in Tables 21-24 represent rounded values and in some cases may not equal 100% when added together.

(183) Table 19 sets forth the number of amino acid (AA) changes observed in each FW and CDR region of heavy chains of antibodies from VELCOIMMUNE mice, heavy chains of antibodies from V1-39 engineered light chain mice (V1-39 Mice) and heavy chains of antibodies from V3-20 engineered light chain mice (V3-20 Mice). Table 20 sets forth the number of amino acid (AA) changes observed in each FW and CDR region of light chains of antibodies from VELCOIMMUNE mice, the light chain of antibodies from V1-39 engineered mice (V1-39 Mice) and the light chain of antibodies from V3-20 engineered mice (V3-20 Mice). Table 21 sets forth the number of amino acid (AA) changes observed in each FW and CDR region of heavy chains of antibodies from V1-39 engineered light chain mice (V1-39 Mice) for selected immunization groups (Antigens E, F and H). Table 22 sets forth the number of amino acid (AA) changes observed in each FW and CDR region of heavy chains of antibodies from V3-20 engineered light chain mice (V3-20 Mice) for selected immunization groups (Antigens E and G).

(184) TABLE-US-00016 TABLE 16 V.sub.H Family Vl Vl V1-39 V1-39 Vl V3-20 V3-20 1 9.0 14.8 3.3 7.1 4.9 2 2.2 1.8 4.6 0 1.6 3 77.8 69.8 77.3 61.4 29.5 4 8.4 8.3 11.2 27.1 39.3 5 0.9 0 0.7 4.3 23.0 6 1.7 5.3 3.0 0 1.6

(185) TABLE-US-00017 TABLE 17 V.sub.H Gene Vl Vl V1-39 V1-39 Vl V3-20 V3-20 1-2 3.9 8.3 0 2.9 0 1-3 0 0 0 0 0 1-8 1.3 0.6 0 1.4 0 1-18 3.0 0.6 1.3 2.1 1.6 1-24 0.4 3.6 0 0.7 0 1-46 0.1 0 0 0 0 1-58 0 0 0 0 0 1-69 0.3 1.8 2.0 0 3.3 2-5 1.9 0 4.6 0 0 2-26 0.2 1.8 0.0 0 0 2-70 0.1 0 0 0 1.6 3-7 3.0 14.8 0 1.4 0 3-9 8.5 3.6 29.6 16.4 0 3-11 5.4 10.7 0 7.1 1.6 3-13 3.2 1.8 0.7 2.1 0 3-15 4.0 4.7 0.3 0.7 0 3-20 1.0 0.6 0.3 5.0 0 3-21 0.8 0.6 0 2.1 0 3-23 20.4 8.9 3.3 8.6 0 3-30 17.6 4.1 35.2 12.9 1.6 3-33 12.6 14.8 0 5.0 26.2 3-43 0.2 0.6 0 0 0 3-48 0.8 1.2 7.2 0 0 3-53 0.3 3.6 0.3 0 0 3-64 0 0 0.3 0 0 3-72 0 0 0 0 0 3-73 0 0 0 0 0 4-31 2.7 0 0.7 8.6 0 4-34 1.8 0.6 0.3 14.3 0 4-39 1.6 0.6 3.0 2.1 14.8 4-59 2.3 7.1 7.2 2.1 24.6 5-51 0.9 0 0.7 4.3 23.0 6-1 1.7 5.3 3.0 0 1.6 J.sub.H Gene Vl Vl V1-39 V1-39 Vl V3-20 V3-20 1 1.5 1.2 7.1 0 0 2 4.5 2.4 0.7 5.0 26.9 3 10.5 16.6 13.1 13.6 26.9 4 44.0 34.3 32.3 50.7 9.6 5 9.6 10.1 16.8 7.9 1.9 6 29.7 35.5 30.0 22.9 34.6

(186) TABLE-US-00018 TABLE 18 V1-39 Mice V3-20 Mice V.sub.H Antigen Antigen Gene Antigen E Antigen F Antigen G H Antigen E G 1-2 0 0 0 0 0 0 1-3 0 0 0 0 0 0 1-8 0 0 0 0 0 0 1-18 0 0 0 8.3 0 3.1 1-24 0 0 0 0 0 0 1-46 0 0 0 0 0 0 1-58 0 0 0 0 0 0 1-69 2.9 0 25.0 0 0 6.3 2-5 8.2 0 0 0 0 0 2-26 0 0 0 0 0 0 2-70 0 0 0 0 0 3.1 3-7 0 0 0 0 0 0 3-9 1.2 98.8 0 14.6 0 0 3-11 0 0 0 0 0 3.1 3-13 0.6 0 25.0 0 0 0 3-15 0 1.2 0 0 0 0 3-20 0 0 25.0 0 0 0 3-21 0 0 0 0 0 0 3-23 4.1 0 25.0 4.2 0 0 3-30 62.9 0 0 0 3.4 0 3-33 0 0 0 0 13.8 37.5 3-43 0 0 0 0 0 0 3-48 0.6 0 0 43.8 0 0 3-53 1.6 0 0 0 0 0 3-64 1.6 0 0 0 0 0 3-72 0 0 0 0 0 0 3-73 0 0 0 0 0 0 4-31 0 0 0 4.2 0 0 4-34 0 0 0 2.1 0 0 4-39 5.3 0 0 0 31.0 0 4-59 11.8 0 0 4.2 3.4 43.8 5-51 1.2 0 0 0 48.3 0 6-1 0 0 0 18.8 0 3.1

(187) TABLE-US-00019 TABLE 19 # AA Changes FW1 CDR1 FW2 CDR2 FW3 CDR3 Heavy Chains of Antibodies from VELCOIMMUNE Mice 0 63 32 36 26 12 82 1 23 32 41 31 22 17 2 9 25 17 23 27 1 3 4 10 5 16 13 0 4 0 1 1 3 12 0 >5 1 0 0 1 14 0 Heavy Chains of Antibodies from V1-39 Mice 0 65 8 34 30 9 37 1 25 26 35 34 19 54 2 9 44 23 20 33 9 3 1 19 8 12 22 0 4 0 3 0 5 11 0 >5 1 0 0 0 7 0 Heavy Chains of Antibodies from V3-20 Mice 0 57 8 54 16 8 93 1 41 43 34 39 21 7 2 2 25 10 18 20 0 3 0 15 2 21 13 0 4 0 10 0 3 20 0 >5 0 0 0 2 18 0

(188) TABLE-US-00020 TABLE 20 # AA Changes FW1 CDR1 FW2 CDR2 FW3 CDR3 Light Chains of Antibodies from VELCOIMMUNE Mice 0 65 24 49 60 33 23 1 24 20 34 31 27 38 2 9 27 16 9 18 28 3 1 20 1 0 14 7 4 0 7 0 0 4 3 >5 1 1 0 0 3 0 Light Chains of Antibodies from V1-39 Mice 0 91 75 80 90 71 63 1 9 19 17 10 21 27 2 0 5 1 1 5 8 3 0 0 1 0 2 1 4 0 0 0 0 2 1 >5 0 0 0 0 0 0 Light Chains of Antibodies from V3-20 Mice 0 90 47 93 97 63 57 1 10 27 3 3 20 43 2 0 27 3 0 17 0 3 0 0 0 0 0 0 4 0 0 0 0 0 0 >5 0 0 0 0 0 0

(189) TABLE-US-00021 TABLE 21 # AA Changes FW1 CDR1 FW2 CDR2 FW3 CDR3 Heavy Chains of Anti-Antigen E Antibodies from V1-39 Mice 0 75 8 49 41 14 36 1 21 25 33 35 25 52 2 4 43 14 18 28 12 3 0 20 4 5 16 0 4 0 5 0 1 12 0 >5 1 0 0 0 5 0 Heavy Chains of Anti-Antigen F Antibodies from V1-39 Mice 0 52 0 6 6 2 15 1 35 24 32 35 15 78 2 11 59 46 22 49 7 3 0 17 16 24 29 0 4 0 0 0 12 4 0 >5 1 0 0 0 1 0 Heavy Chains of Anti-Antigen H Antibodies from V1-39 Mice 0 54 21 29 33 4 77 1 17 35 50 27 6 23 2 23 21 15 21 25 0 3 6 21 4 15 27 0 4 0 2 2 2 15 0 >5 0 0 0 2 23 0

(190) TABLE-US-00022 TABLE 22 # AA Changes FW1 CDR1 FW2 CDR2 FW3 CDR3 Heavy Chains of Anti-Antigen E Antibodies from V3-20 Mice 0 79 17 62 24 17 90 1 21 28 34 55 31 10 2 0 28 3 21 24 0 3 0 14 0 0 10 0 4 0 14 0 0 3 0 >5 0 0 0 0 14 0 Heavy Chains of Anti-Antigen G Antibodies from V3-20 Mice 0 38 0 47 9 0 97 1 59 56 34 25 13 3 2 3 22 16 16 16 0 3 0 16 3 41 16 0 4 0 6 0 6 34 0 >5 0 0 0 3 22 0

Example 13

Binding Affinity of Bispecific Antibodies Having Universal Light Chains

(191) Fully human bispecific antibodies were constructed from cloned human heavy chain variable regions of selected monospecific anti-Antigen E common light chain antibodies (described in Example 5) using standard recombinant DNA techniques known in the art. Table 23 sets forth the pairing of human heavy chains (HC-1 and HC-2) from selected parental monospecific antibodies; each pair employed with a germline rearranged human V1-39/J1 light chain for construction of each bispecific antibody.

(192) Binding of bispecific or parental monospecific anti-Antigen E antibodies to the extracellular domain (ECD) of Antigen E was determined using a real-time surface plasmon resonance biosensor assay on a BIACORE 2000 instrument (GE Healthcare). A CM5 BIACORE sensor surface derivatized with anti-c-myc-specific monoclonal antibody (Clone#9E10) using EDC-NHS chemistry was used to capture the C-terminal myc-myc-hexahistidine tagged ECD of Antigen E (AntigenE-mmh). Around 190 RUs of AntigenE-mmh was captured on the BIACORE sensor surface, followed by the injection of 300 nM and 50 nM concentrations of different bispecific or parental monospecific anti-Antigen E antibodies at a flow rate of 50 l/min. The experiment was performed at 25 C. in HBST running buffer (0.01M HEPES pH 7.4, 0.15M NaCl, 3 mM EDTA, 0.05% v/v Surfactant P20). The amount of antibody binding to AntigenE-mmh surface at 300 nM concentration was recorded three seconds before the end of antibody injection and plotted.

(193) Table 24 and FIG. 8 set forth the binding responses (BIACORE units; RU) observed for each bispecific antibody (BsAb) and monospecific parental antibody (PAb-1, PAb-2). Since each antibody was injected under saturating conditions over an identical AntigenE-mmh surface, the binding response reflects the binding stoichiometry for each antibody binding to the antigen capture surface.

(194) As shown in this Example, the observed binding response for each bispecific antibody was approximately 2-fold greater than the binding response for each parental monospecific antibody (Table 24 and FIG. 8), demonstrating functional construction of bispecific antibodies using heavy chains of antigen-specific monoclonal antibodies and a common light chain where each Fab arm in the bispecific antibody molecule binds simultaneously to distinct epitopes on the extracelluar domain of a cell surface receptor (Antigen E; see FIG. 7B, bottom left).

(195) TABLE-US-00023 TABLE 23 Bispecific Antibody Parent HC-1 Parent HC-2 3108 2952 2978 3109 2978 3022 3111 2952 3005 3112 3022 3005

(196) TABLE-US-00024 TABLE 24 Binding Response (RU) Bispecific Antibody PAb-1 PAb-2 BsAb 3108 236 229 485 3109 236 197 408 3111 202 229 435 3112 202 197 345

Example 14

Generation and Analysis of Mice Expressing Two Human Light Chains

(197) Using the methods described above in Example 2, two additional engineered light chain loci containing two human V gene segments (e.g., a human V1-39 and human V3-20 gene segment) were constructed (FIG. 9). One engineered light chain locus contained two human V gene segments and five human J gene segments in unrearranged configuration (DLC-5J). The second engineered light chain locus contained two human V gene segments and one human J gene segment in unrearranged configuration (DLC-1J). For each of the two additional engineered light chain loci, the human gene segments were flanked 3.sup.+ with recombination signal sequences to allow for in vivo rearrangement of the human gene segments in B cells.

(198) Modified BAC DNA clones separately containing each of the the engineered light chain loci operably linked to mouse sequences (i.e., upstream and downstream sequences of the endogenous immunoglobulin light chain locus) were confirmed by PCR using primers located at sequences within each engineered light chain locus containing the two human V gene segments followed by electroporation into ES cells to create mice that express either of the two human V gene segments (as described above). Positive ES cell clones that contain either of the engineered light chain loci described above were confirmed by TAQMAN screening and karyotyping using probes specific for the engineered light chain loci (as described above). Confirmed ES cell clones were then used to implant female mice to give rise to a litter of pups expressing a human light chain variable domain fused with a mouse C domain, referred to herein as Dual Light Chain (DLC) mice.

(199) Alternatively, ES cells bearing the engineered light chain locus may be transfected with a construct that expresses FLP in order to remove the FRTed neomycin cassette introduced by the targeting construct. Optionally, the neomycin cassette is removed by breeding to mice that express FLP recombinase (e.g., U.S. Pat. No. 6,774,279). Optionally, the neomycin cassette is retained in the mice.

(200) Flow Cytometry. B cell populations and B cell development in DLC mice were validated by flow cytometry analysis of splenocyte and bone marrow preparations. Cell suspensions from mice homozygous for two human V gene segments and five human J gene segments (n=4), mice homozygous for two human V gene segments and one human J gene segment (n=4), and wild type mice (n=4) were made using standard methods (described above) and stained with fluorescently labeled antibodies (as described in Example 3).

(201) Briefly, 110.sup.6 cells were incubated with anti-mouse CD16/CD32 (clone 2.4G2, BD Pharmigen) on ice for 10 minutes, followed by labeling with the following antibody cocktail for 30 minutes on ice: APC-H7 conjugated anti-mouse CD19 (clone 1D3, BD Pharmigen), Pacific Blue conjugated anti-mouse CD3 (clone 17A2, BioLegend), FITC conjugated anti-mouse Ig (clone 187.1, BD Pharmigen) or anti-mouse CD43 (clone 1B11, BioLegend), PE conjugated anti-mouse Ig (clone RML-42, BioLegend) or anti-mouse c-kit (clone 2B8, BioLegend), PerCP-Cy5.5 conjugated anti-mouse IgD (BioLegend), PE-Cy7 conjugated anti-mouse IgM (clone 11/41, eBioscience), APC conjugated anti-mouse B220 (clone RA3-6B2, eBioscience). Following staining, cells were washed and fixed in 2% formaldehyde. Data acquisition was performed on an LSRII flow cytometer and analyzed with FlowJo (Tree Star, Inc.). Gating: total B cells (CD19.sup.+CD3.sup.),Ig.sup.+ B cells (Ig.sup.+Ig.sup.CD19.sup.+CD3.sup.), Ig.sup.+ B cells (Ig.sup.Ig.sup.+CD19.sup.+CD3.sup.). Results for the bone marrow compartment are shown in FIG. 10A-FIG. 12B. Results for the splenic compartment are shown in FIG. 13A-FIG. 16.

(202) As shown in this Example, DLC-5J mice demonstrate normal B cell populations within the splenic and bone marrow compartments (FIG. 10A-16). DLC-5J mice demonstrated immature, mature and pre/pro B cell populations within the bone marrow compartment that are substantially the same as observed in wild-type litter mates. In fact, the DLC-5J locus was capable of competing with the endogenous light chain locus to yield a : ratio that is substantially the same as that observed in wild-type mice (FIG. 14B). Also, DLC-5J mice demonstrate a normal peripheral B cell development as progression of B cells through various stages in the splenic compartment (e.g., immature, mature, T1, T2 T3, marginal zone precursor, marginal zone, follicular-I, follicular-III, etc.) occurs in a manner substantially the same as observed in wild type mice (FIG. 15A-16). In contrast, DLC-1J mice demonstrated a lower overall number of B cells and an increased light chain usage as compared to the engineered light chain (data not shown).

(203) Dual Light Chain Expression. Expression of both human V gene segments was analyzed in homozygous mice using a quantitative PCR assay in accordance with in Example 3. Briefly, CD19.sup.+ B cells were purified from bone marrow and whole spleens of wild type mice, mice homozygous for a replacement of the mouse heavy chain and light chain variable loci with corresponding human heavy chain and light chain variable region loci (H), as well as mice homozygous for an engineered light chain loci containing two human V gene segments and either five human J gene segments (DLC-5J) or one human J gene segment (DLC-1J). Relative expression was normalized to expression of mouse C region (n=3 to 5 mice per group). Results are shown in FIG. 17 and FIG. 18.

(204) Expression of light chains containing a rearranged human V3-20 or human V1-39 gene segment were detected in both the bone marrow and spleen of DLC-5J and DLC-1J mice (FIG. 17 and FIG. 18). In the bone marrow compartment, expression of both human V3-20-derived and human V1-39-derived light chains in both strains of DLC mice was significantly higher as compared to mice comprising a replacement of mouse V and J gene segment with corresponding human V and J gene segments (H; FIG. 17). Human V3-20-derived light chain expression was observed at about six-fold (DLC-5J) to fifteen-fold (DLC-1J) higher than in HK mice. DLC-1J mice demonstrated about two-fold higher expression of human V3-20-derived light chains over DLC-5J mice in the bone marrow compartment. Human V1-39-derived light chain expression was observed at about six-fold (DLC-5J) to thirteen-fold (DLC-1J) higher than in HK mice. DLC-1J mice demonstrated about two-fold higher expression of human V1-39-derived light chains over DLC-5J mice in the bone marrow compartment.

(205) In the splenic compartment, expression of both human V3-20-derived and human V1-39-derived light chains in both strains of DLC mice was significantly higher as compared to HK mice (FIG. 18). Human V3-20-derived light chain expression was observed at about four-fold (DLC-5J) and eight-fold (DLC-1J) higher than in HK mice. DLC-1J mice demonstrated about two-fold higher expression of human V3-20-derived light chains over DLC-5J mice in the splenic compartment. Human V1-39-derived light chain expression was observed at about four-fold (DLC-5J) to five-fold (DLC-1J) higher than in HK mice. DLC-1J mice demonstrated similar expression of human V1-39-derived light chains as compared to DLC-5J mice in the splenic compartment.

(206) Human V.sub.L/J.sub.L Usage in DLC-5J Mice. Mice homozygous for two unrearranged human V gene segments and five unrearranged human J gene segments (DLC-5J) were analyzed for human V/J gene segment usage in splenic B cells by reverse-transcriptase polymerase chain reaction (RT-PCR).

(207) Briefly, spleens from homozygous DLC-5J (n=3) and wild type (n=2) mice were harvested and meshed in 10 mL of RPMI 1640 (Sigma) containing 10% heat-inactivated fetal bovine serum using frosted glass slides to create single cell suspensions. Splenocytes were pelleted with a centrifuge (1200 rpm for five minutes) and red blood cells were lysed in 5 mL of ACK lysing buffer (GIBCO) for three minutes. Splenocytes were diluted with PBS (Irvine Scientific), filtered with a 0.7 m cell strainer and centrifuged again to pellet cells, which was followed by resuspension in 1 mL of PBS.

(208) RNA was isolated from pelleted splenocytes using AllPrep DNA/RNA mini kit (Qiagen) according to manufacturer's specifications. RT-PCR was performed on splenocyte RNA using 5 RACE (Rapid Amplification of cDNA ends) System with primers specific for the mouse C gene according to manufacturer's specifications (Invitrogen). The primers specific for the mouse C gene were 3 mlgC RACE1 (AAGAAGCACA CGACTGAGGC AC; SEQ ID NO: 34) and mlgC3-1 (CTCACTGGAT GGTGGGAAGA TGGA; SEQ ID NO: 35). PCR products were gel-purified and cloned into pCR2.1-TOPO vector (TOPO TA Cloning Kit, Invitrogen) and sequenced with M13 Forward (GTAAAACGAC GGCCAG; SEQ ID NO: 36) and M13 Reverse (CAGGAAACAG CTATGAC; SEQ ID NO: 37) primers located within the vector at locations flanking the cloning site. Ten clones from each spleen sample were sequenced. Sequences were compared to the mouse and human immunoglobulin sets from the IMGT/V-QUEST reference directory sets to determine V/J usage. Table 25 sets forth the V/J combinations for selected clones observed in RT-PCR clones from each splenocyte sample. Table 26 sets forth the amino acid sequence of the human V/human J and human J/mouse C junctions of selected RT-PCR clones from DLC-5J homozygous mice. Lower case letters indicate mutations in the amino acid sequence of the variable region or non-template additions resulting from N and/or P additions during recombination.

(209) As shown in this Example, mice homozygous for two unrearranged human V gene segments and five unrearranged human J gene segments (DLC-5J) operably linked to the mouse C gene are able to productively recombine both human V gene segments to multiple human J gene segments to produce a limited immunoglobulin light chain repertoire. Among the rearrangements in DLC-5J homozygous mice shown in Table 25, unique human V/J rearrangements were observed for V1-39/J2 (1), V1-39/J3 (1), V3-20/J1 (7), V3-20/J2 (4) and V3-20/J3 (1). Further, such unique rearrangements demonstrated junctional diversity through the presence of unique amino acids within the CDR3 region of the light chain (Table 26) resulting from either mutation and/or the recombination of the human V and J gene segments during development. All the rearrangements showed functional read through into mouse C (Table 26).

(210) Taken together, these data demonstrate that mice engineered to present a choice of no more than two human V.sub.L gene segments, both of which are capable of rearranging (e.g., with one or more and, in some embodiments, up to five human J.sub.L gene segments) and encoding a human V.sub.L domain of an immunoglobulin light chain have B cell numbers and development that is nearly wild-type in all aspects. Such mice produce a collection of antibodies having immunoglobulin light chains that have one of two possible human V.sub.L gene segments present in the collection. This collection of antibodies is produced by the mouse in response to antigen challenge and are associated with a diversity of reverse chimeric (human variable/mouse constant) heavy chains.

(211) TABLE-US-00025 TABLE 25 Mouse V/J ID No. Genotype Clone Combination 1089451 DLC-5J 1-2 1-39/3 1-4 3-20/2 1-7 3-20/1 1-8 3-20/2 1089452 DLC-5J 2-2 3-20/1 2-3 3-20/1 2-6 3-20/2 2-8 3-20/2 2-9 3-20/1 2-10 1-39/2 1092594 DLC-5J 3-1 3-20/1 3-2 3-20/1 3-4 3-20/1 3-6 3-20/3 3-9 3-20/2 1092587 WT 1-1 19-93/1 1-2 6-25/1 1-3 4-91/5 1-5 3-10/4 1-6 4-86/4 1-8 19-93/1 1-10 19-93/2 1092591 WT 2-1 19-93/1 2-3 6-20/5 2-4 6-25/5 2-5 1-117/1 2-6 8-30/1 2-7 8-19/2 2-8 8-30/1 2-10 1-117/1

(212) TABLE-US-00026 TABLE26 SequenceofhV/hJ/mC Junction Clone V/J (CDR3underlined,mIgCitalics) SEQIDNO: 2-10 1-39/2 QPEDFATYYCQQSYSTPYTFGQGTKLEIKRADAAPTVSI 38 1-2 1-39/3 QPEDFATYYCQQSYSTPFTFGPGTKVDIKRADAAPTVSI 39 1-7 3-20/1 EPEDFAVYYCQQYGSSPrTFGQGTKVEIKRADAAPTVSI 40 2-2 3-20/1 EPEDFAVYYCQQYGSSrTFGQGTKVEIKRADAAPTVSI 41 2-3 3-20/1 EPEDFAVYYCQQYGSSPWTFGQGTKVEIKRADAAPTVSI 42 2-9 3-20/1 dPEDFAVYYCQQYGSSPrTFGQGTKVEIKRADAAPTVSI 44 3-1 3-20/1 EPEDFAVYYCQQYGSSPrTFGQGTKVEIKRADAAPTVSI 45 3-2 3-20/1 EPEDFAVYYCQQYGSSPWTFGQGTKVEIKRADAAPTVSI 46 3-4 3-20/1 EPEDFAVYYCQQYGSSPPTFGQGTKVEIKRADAAPTVSI 47 3-9 3-20/2 EPEDFAVYYCQQYGSSPYTFGQGTKLEIKRADAAPTVSI 48 3-6 3-20/3 EPEDFAVYYCQQYGSSiFTFGPGTKVDIKRADAAPTVSI 49