ANTIBODY BINDING TO CARBONIC ANHYDRASE AND USE THEREOF

20190276557 ยท 2019-09-12

    Inventors

    Cpc classification

    International classification

    Abstract

    Provided is an antibody that recognizes and binds to carbonic anhydrase or antigen-binding fragment, a nucleic acid molecule coding for the antibody or antigen-binding fragment, a vector carrying the nucleic acid molecule, a host cell including the nucleic acid molecule or the vector, and use of the antibody or antigen-binding fragment thereof in the alleviation, prevention, treatment or diagnosis of solid cancers.

    Claims

    1-12. (canceled)

    13. An antibody or antigen-binding fragment thereof binding to carbonic anhydrase 12 (CA XII), comprising V.sub.H-CDRs comprising the amino acid sequences of SEQ ID NOs: 14, 15 and 28 and V.sub.L-CDRs comprising the amino acid sequences of SEQ ID NOs: 29, 30 and 31.

    14. The antibody or antigen-binding fragment according to claim 13, wherein the V.sub.L-CDR1 comprises an amino acid sequence of SEQ ID NO: 32 or 33, or the V.sub.L-CDR2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:34 to 42.

    15. The antibody or antigen-binding fragment according to claim 13, wherein the antibody further comprises V.sub.H-framework sequence comprising amino acid sequences of SEQ ID NOs: 43 to 46.

    16. The antibody or antigen-binding fragment according to claim 13, wherein the antibody further comprises V.sub.L-framework sequence comprising amino acid sequences of SEQ ID NOs: 47, 48, 51 and 52.

    17. The antibody or antigen-binding fragment according to claim 16, wherein the antibody further comprises V.sub.L-framework sequences comprising an amino acid sequence of SEQ ID NO: 48 which comprise an amino acid sequence of SEQ ID NO: 49 or 50.

    18. The antibody or antigen-binding fragment according to claim 13, wherein the antibody comprises V.sub.H-region amino acid sequence comprising an amino acid sequence of SEQ ID NO: 53, and V.sub.L-region amino acid sequence comprising an amino acid sequence selected from the group consisting of amino acid sequences of SEQ ID NOs: 54 to 63.

    19-21. (canceled)

    22. The antibody or antigen-binding fragment according to claim 13, wherein the antibody has an agonist activity to CA XII.

    23. The antibody or antigen-binding fragment according to claim 13, wherein the antigen-binding fragment is scFv, (scFv).sub.2, Fab, Fab or F(ab).sub.2 of the anti-CA-XII antibody.

    24. The antibody or antigen-binding fragment according to claim 13, wherein the antibody or the antigen-binding fragment is coupled to labeling agent, toxin, or anti-tumor agent.

    25. The antibody or antigen-binding fragment according to claim 24, wherein the labeling agent is selected from the group consisting of a radioisotope, a hapten, a fluorescent material, a chromogen, and a dye.

    26. The antibody or antigen-binding fragment according to claim 24, wherein the toxin is a radioisotope, a small molecule, a peptide or a protein.

    27. The antibody or antigen-binding fragment according to claim 24, wherein the antibody or antigen-binding fragment is coupled with a toxin to form a fusion protein.

    28. The antibody or antigen-binding fragment according to claim 24, wherein the fucoses bound to the antibody or antigen-binding fragment are partly or completely removed.

    29. A nucleic acid molecule encoding the antibody or antigen-binding fragment of the antibody that binds to non-catalytic domain of carbonic anhydrase according to claim 13.

    30. A vector introduced by a nucleic acid molecule encoding the antibody or antigen-binding fragment of the antibody that binds to non-catalytic domain of carbonic anhydrase according to claim 13.

    31. A host expressing the antibody or antigen-binding fragment of the antibody that binds to non-catalytic domain of carbonic anhydrase according to claim 13.

    32-33. (canceled)

    34. A pharmaceutical composition for prevention, alleviation or treatment of solid cancer, comprising the antibody or antigen-binding fragment of the antibody that binds to non-catalytic domain of carbonic anhydrase according to claim 13.

    35-37. (canceled)

    38. The pharmaceutical composition according to claim 34, further comprising an anti-cancer chemical drug or other anti-cancer antibody.

    39. (canceled)

    40. A composition for detecting a solid cancer, comprising the antibody or antigen-binding fragment of the antibody that binds to non-catalytic domain of carbonic anhydrase according to claim 13, wherein a sample is determined as the solid cancer if the sample shows a positive reaction to the antibody or antigen-binding fragment.

    41. The composition for detecting a solid cancer according to claim 40, wherein the antibody or the antigen-binding fragment is coupled to a labeling agent.

    42-43. (canceled)

    Description

    BRIEF DESCRIPTION OF DRAWINGS

    [0085] FIG. 1 shows titers of the solid tumor-specific mouse monoclonal antibody, 27B6 in peripheral blood, as measured according to Example 1.

    [0086] FIG. 2 shows the antigen specificity and affinity of the 27B6 chimeric antibody, as measured according to Example 2;

    [0087] FIG. 3 illustrates a procedure of screening titers of the 4B4 monoclonal antibody in peripheral blood, as measured according to Example 3,

    [0088] FIG. 4 shows the antigen specificity and affinity of the 4B4 chimeric antibody, as measured according to Example 4;

    [0089] FIGS. 5a, 5b and 5c show expression patterns of the mouse chimeric antibody 4B4 on the carbonic anhydrase 12 antigen in various breast cancer cells, as measured according to Example 5.

    [0090] FIG. 6 shows electrophoretograms of antigens isolated and purified from the lung adenocarcinomic A549 cell line through columns fabricated with chimeric antibody 4B4 and chimeric antibody 27B6.

    [0091] FIG. 7 shows the identification of carbonic anhydrase 12 as an antigen for the 4B4 and the 27B6 monoclonal antibody, as analyzed by ELISA assay.

    [0092] FIG. 8 shows the identification of carbonic anhydrase 12 as an antigen for the 4B4 and the 27B6 monoclonal antibody, as analyzed by Western blotting assay in Example 6,

    [0093] FIG. 9 shows epitope mapping processes and results of 27B6 and 4B4 monoclonal antibodies.

    [0094] FIG. 10 shows the complement-dependent cytotoxic effects of chimeric antibody 27B6, as analyzed according to Example 8,

    [0095] FIG. 11 shows antibody-dependent cell-mediated cytotoxic effects of the 27B6 chimeric antibody, as analyzed according to Example 9-1,

    [0096] FIG. 12 shows antibody-dependent cell-mediated cytotoxic effects of the 27B6 chimeric antibody on triple-negative breast cancer cell lines, as analyzed according to Example 9-2,

    [0097] FIG. 13 shows the antibody-dependent cell-mediated cytotoxic effects of the defucosylated 27B6 chimeric antibody in the various solid tumors, as analyzed according to Example 10-1,

    [0098] FIG. 14 shows the antibody-dependent cell-mediated cytotoxic effects of the defucosylated 4B4 and 27B6 chimeric antibodies in the breast cancer cell line, as analyzed by a luciferase assay in Example 10-2.

    [0099] FIG. 15 shows the expression levels of the CA12 antigen on triple-negative breast cancer cell lines and the binding of 27B6 and 4B4 chimeric antibodies to the cell surface of the cell lines, as analyzed according to Example 11.

    [0100] FIG. 16 shows the inhibitory activities of 27B6 and 4B4 chimeric antibodies against tumor growth in triple-negative breast cancer animal models.

    [0101] FIG. 17 shows the inhibitory activity of the 4B4 antibody against triple-negative breast cancer, as analyzed according to Example 11.

    [0102] FIGS. 18 and 19 show that the binding of the 4B4 antibody alone to tumor cells does not affect the growth of the tumor cells according to Example 12

    [0103] FIG. 20 shows the effect of a combination of the 27B6 antibody and radiotherapy, as analyzed according to Example 13.

    [0104] FIG. 21 shows the results of ELISA Test for the affinity binding to CA-XII of the selected clone (phage displayed scFv) selected according to Example 14.

    [0105] FIG. 22 shows the sequence of the light chain variable region (VL) and CDR1 and CDR2 sequences of 10 clones (clone numbers #1, 2, 8, 11, 15, 19, 22, 25, 26 and 30) selected according to Example 14 and the sequences of CDR1 and CDR2 Array.

    [0106] FIG. 23 and FIG. 24 are graphs showing affinity test results of full length IgG of 10 clones (clone numbers #1, 2, 8, 11, 15, 19, 22, 25, 26 and 30) selected according to Example 14.

    [0107] FIG. 25 shows the binding of the humanized antibody DNP004 according to Example 15 in the CA-XII positive and triple negative breast cancer cell line MDAMB-231.

    [0108] FIG. 26 is a photograph showing the result of analyzing physical properties of candidate antibody groups using SDS-PAGE according to Example 16.

    [0109] FIG. 27 shows the evaluation of the binding force of the candidate antibody groups with the CA XII positive cell line according to Example 16.

    [0110] FIG. 28 and FIG. 29 show results of binding profiles of DNP004 humanized antibody against carbonic anhydrase XII antigen in various breast cancer cells according to Example 17. FIG. text missing or illegible when filed

    [0111] FIG. 30 shows the results of antibody-dependent cytotoxic effect of DNP004 humanized antibody in a breast cancer cell line according to Example 18.

    [0112] FIG. 31 shows the results of the antibody-dependent cytotoxic effect of DNP004 humanized antibody in a lung cancer cell line according to Example 18.

    [0113] FIG. 32 shows the results of the antibody-dependent cytotoxic effects of DNP004 humanized antibody in liver cancer cell line according to Example 18.

    [0114] FIG. 33 shows the results of the antibody-dependent cytotoxic effects of DNP004 humanized antibody in stomach cancer cell line according to Example 18.

    [0115] FIGS. 34 to 35 show the results of the antitumor effect of a DNP004 humanized antibody in a triple negative breast cancer mouse model according to Example 19.

    [0116] FIG. 36 shows the results of the antitumor effect of DNP004 humanized antibody in an animal model of kidney cancer cell line according to Example 19

    MODE FOR INVENTION

    [0117] A better understanding of the present invention may be obtained through the following examples which are set forth to illustrate, but are not to be construed as limiting the present invention.

    EXAMPLE 1: PRODUCTION OF MONOCLONAL ANTIBODY FOR CA-XII (27B6)

    [0118] The development of novel antibodies specific for CA12 was achieved in the following experiments. The developed antibodies were observed to be specific for solid tumors, such as adenocarcinoma of the lungs, breast cancer, colorectal cancer, and prostate cancer, as they reacted with antigens expressed specifically in the tumors. They were designated 27B6 and 4B4, respectively.

    1-1: Design of Target Site for Construction of 27B6 Monoclonal Antibody

    [0119] An antibody specific for solid tumor cells was fabricated. For this, mice were immunized directly with solid tumor cells, and monoclonal antibodies were established using a cell fusion technique. Thereafter, an antigen to which the solid tumor cell-specific monoclonal antibody was bound was analyzed and identified.

    1-2: Mice Immunization

    [0120] A549 cells, which are adenocarcinomic human alveolar-basal epithelial cells, were immunized, and a selection was made of an antibody that was positive to the A549 cell line, but L132 during a hybridoma selection process using flowcytometry. The percentage of positive cells to monoclonal antibody was calculated as the number of cells binding to DNP004 antibody in 5000 cells of the test subject, so as to present as %, (negative) is referred to the case that the number of positive cells is less than 10%, and + (positive) is referred to the case that the number of positive cells is in the range of 10 to 30% . ++ means that the number of positive cells are in the range of 30 to 70%, and +++ means that the number of positive cells are 70 to 100%.

    [0121] To the end, Balb/c female mice with 6 weeks old were each IP (intraperitoneal cavity)-injected with the A549 cell line (ATCC CCL-185) at a dose of 110.sup.7 cells three times at regular intervals of three weeks, followed by removing sera from the veins. A dilution of the serum was added to A549 cells. After being left for 30 min at 4 C. to react, the dilution was mixed with 3 ml of PBS and centrifuged for 3 min at 1500 rpm. Unbound antibodies were washed off. A 200-fold dilution of the secondary antibody goat anti-mouse Ig-FITC (DINONA INC, Korea) was used to detect the bound antibodies. After reaction for 15 min at 4 C., the reaction mixture was washed with 3 ml of PBS in the same manner. The sera were measured for antibody titer to A549 cells by flow cytometry. The sera immunized with A549 cells were observed to be highly positive to A549 cells (results not shown). Briefly, three days before a cell fusion experiment, 50 g of anti-CD40 agonist mAb was added to boost an immune reaction, and A549 (ATCC CCL-185) was injected at a dose of 110.sup.7 cells to induce the amplification of an antibody to a surface antigen of A549.

    1-3: Preparation of Hybridoma Cell

    [0122] The spleen was excised from the immunized mice, and a suspension of single splenocytes was obtained and washed twice with RPMI (GIBCO). Viable cells were counted using a 1:1 (v/v) mixture of 0.4% trypan blue (Sigma), which stains only dead cells. The X63 mouse myeloma cell line (ATCC CRL-1580) was employed as a cell fusion partner, and washed and counted in the same manner as the splenocytes.

    [0123] The myeloma cells were mixed at a ratio of 1:5 with the splenocytes and centrifuged. The pellet thus obtained was slowly added over 1 min with 1 ml of 50% PEG (polyethylene glycol) 1500 preheated to 37 C. After being incubated for about 1 min, the cell mixture was slowly diluted with an RPMI medium and centrifuged. The resulting cell pellet was resuspended in RPMI (20% FBS) containing 1HAT (hypoxanthine-aminopterin-thymidine), plated at a volume of 150 l/well into 96-well plates, and grown in a 37 C. CO.sub.2 incubator. HAT was fed over a predetermined time after the fusion. When a colony was observed in the wells, 150 l of an HT medium was added to each well, followed by incubation for 48 hours in a 37 C., 5% CO.sub.2 incubator. Then, three-color immunofluorescence staining was performed before flow cytometry. Briefly, the lung adenocarcinoma cell line A549 and the normal lung cell line L132 were immunologically stained with two different dyes and mixed at a ratio of 1:1. This cell mixture was incubated with 100 l of a supernatant of the hybridoma cell culture at 4 C. for 30 min and centrifuged, together with 3 ml of PBS, at 1500 rpm for 3 min to remove unbound antibodies. The bound antibodies were detected by incubation with a 200-fold dilution of the secondary antibody goat anti-Mouse Ig-APC (DINONA INC, Korea) at 4 C. for 15 min, followed by washing with 3 ml of PBS in the same manner. Thereafter, the hybridoma cells were measured via flow cytometry.

    [0124] An examination was made to see whether the antibody binds to peripheral blood. For this, PBMC (peripheral blood mononuclear cells from the Korean Red Cross Blood Services) was incubated with 100 l of a hybridoma supernatant at 4 C. for 30 min, and centrifuged, together with 3 ml of PBS, at 1,500 rpm for 3 min to wash off unbound antibodies. A 200-fold dilution of the secondary antibody goat anti-mouse Ig-FITC (DINONA INC, Korea) was used to detect the bound antibodies. After reaction for 15 min at 4 C., the reaction mixture was washed with 3 ml of PBS in the same manner. The antibody titer was measured using flow cytometry, and the results are shown (FIG. 1). FIG. 1 shows titers of the lung adenocarcinoma-specific 27B6 monoclonal antibody in the peripheral blood, as measured via flow cytometry.

    [0125] In this manner, the antibody that was positive to the lung cancer cell line A549 and negative to the normal lung cell line L132 and all of granulocytes, lymphocytes and monocytes of the peripheral blood were selected and designated 27B6. Finally, during a limiting dilution procedure, 27B6 hybridoma cells were diluted and selected for single colony growth.

    [0126] The 27B6 hybridoma cell line was deposited on Feb. 14, 2012, with the Korean Cell Line Bank, located at 28, Yongon-Dong, Chongno-gu, Seoul, Korea, and received Accession No. KCLRF-BP-00280 on Feb. 20, 2012.

    1-4: Determination of Isotype for 27B6 Monoclonal Antibody

    [0127] The 27B6 monoclonal antibody prepared in Example 1-3 was analyzed for isotype, using a mouse immunoglobulin isotyping ELISA kit (BD Biosciences, USA). Briefly, isotyping was performed with anti-murine isotype specific antisera (IgG1, IgG2a, IgG2b, IgG3, IgM, IgA, Kappa, Lambda) while peroxidase-labeled goat anti-mouse IgG served as a secondary antibody. Color development was induced with ortho-phenylenediamine (OPD) and a hydrogen peroxide substrate. Absorbance at 450 nm was read.

    [0128] As a result, the 27B6 monoclonal antibody was identified as mouse IgG1/kappa light chain (results not shown).

    1-5: CDR Sequences of 27B6 Antibody

    [0129] An antibody cloning procedure is illustrated in FIG. 1. Specifically, the 27B6 antibody gene was cloned using Mouse Ig-Primer Set (Millipore, Cat. #: 69831). PCR was performed using the mouse Ig-primer set from the RNA isolated from the 27B6 hybridoma, inserted into a pGem-T vector (Promega, Cat. #: A3600), and sequenced to confirm the DNA sequence. The mouse antibody gene was identified through the IMGT site (www.imgt.org). Heavy and light chain sequences including the CDR sequences of the 27B6 Ab are represented by SEQ ID NOs: 12 and 13, respectively. CDR1 to CDR3 of the heavy chain variable region are shown in SEQ ID NOs: 6 to 8, respectively, and CDR1 to CDR3 of the light chain variable region are shown in SEQ ID NOs: 9 to 11, respectively (see the Table 2).

    EXAMPLE 2: PRODUCTION OF 27B6 CHIMERIC ANTIBODY

    [0130] When a monoclonal antibody of mouse origin is administered to the human body, the human immune system recognizes the monoclonal antibody as a foreign antigen and thus produces a human anti-mouse antibody (HAMA) to eliminate the mouse antibody from the blood. In addition, the Fc domain of the mouse antibody cannot exert its effective biological functions in the human body. Therefore, not only does the therapeutic effect sharply decrease, but also side effects such as severe allergic reactions and renal dysfunction may be induced. In order to reduce the immunogenicity of the 27B6 antibody upon administration to the human body, a chimeric antibody in which the mouse antibody, except for the variable region, was substituted with the Fc of the human antibody was constructed. The chimeric antibody was observed to be similar in antigen specificity and affinity to the original mouse 27B6 antibody.

    [0131] To construct a chimeric antibody, the 27B6-HuIgFc DNA prepared in the above-mentioned manner was transfected into the DHFR DG44 cell line derived from CHO cells, followed by a selective culturing procedure in a selective medium to establish a stable cell line producing a 27B6 recombinant antibody. Details are described as follows.

    [0132] First, three hours before transfection, the DG44 cell line (Invitrogen, Cat No. A1100001) was inoculated at a density of 110.sup.6 cells/ml into 6-well plates and incubated with 1 ml of GIBCO CD DG44 Medium (Invitrogen, USA) at 37 C. in a 5% CO.sub.2 atmosphere for 3 hours. Then, the 27B6-HuIgFc DNA was transfected into the competent DG 44 cells using an Effectene transfection reagent kit (QIAGEN, Hilden, Germany).

    [0133] On three days post transfection, the supernatant was taken and added to A549 cells which were then incubated at 4 C. for 30 min. Unbound antibodies were removed by centrifugation, together with 3 ml of PBS, at 1500 rpm for 3 min. The bound antibodies were detected by incubation with a 150-fold dilution of the secondary antibody goat anti-Mouse Ig-FITC (DINONA INC, Korea) at 4 C. for 15 min, followed by washing with 3 ml of PBS in the same manner. Thereafter, the antibody titer to A549 cells was measured using flow cytometry. Subsequently, a stable cell line was established. For this, the medium was exchanged with a Power CHO medium (LONZA, Switzerland) supplemented with 30 nM MTX (Sigma, USA) and 200 g/ml G418 (Invitrogen, USA), after which clone selection was started. Concentrations of MTX and G418 in the selection medium were increased with the repetition of clone selection rounds. Each round was set to be three weeks. The final round of clone selection was performed in a PowerCHO medium supplemented with 1000 nM MTX and 400 g/ml G418. Thereafter, the final cell line was established as a single colony through limiting dilution.

    [0134] The 27B6 chimeric antibody established in this manner was found to have antigen specificity and affinity to those of the original mouse 27B6 antibody, as measured by flow cytometry (FIG. 2). FIG. 2 shows the antigen specificity and affinity of the 27B6 chimeric antibody.

    EXAMPLE 3: PRODUCTION OF MONOCLONAL ANTIBODY FOR CA XII (4B4)

    3-1: 27B6 Pairing Antibody

    [0135] To develop another antibody which recognizes the same antigen but binds to a different epitope, 27B6 pairing antibody was developed.

    [0136] Firstly to explore the possibility of development of 27B6 paring antibody, sandwich ELISA using chimeric 27B6 and mouse serum was established. In the same manner of Example 1-2, balb/c female mice 6 weeks old were each IP (intraperitoneal cavity)-injected with the A549 cell line (110.sup.7 cells) at regular intervals of three weeks, followed by taking sera from the veins.

    [0137] Specifically, chimeric 27B6 purified antibody was added to a microplate at a concentration of 100 ng/mL and coated at 37 C. for 1 hour. Blocking buffer (Sigma) was added to 200 l/ well of 27B6-coated microplate and blocked at 37 C. for 1 hour. A549 cells were lysed at 110.sup.7 cells/ml using 1% NP40 lysis buffer. The prepared A549 lysate was added to the microplate at 50 uL/well, reacted at 37 C. for 1 hour, and then washed three times with PBS. 100 l/well of A549 immunized mouse serum 1000-fold dilution was added to the microplate and incubated at 37 C. for 1 hour and then washed three times with PBS. Finally, a secondary antibody goat anti-mouse IgG-HRP (Jackson) 2000 dilution was added at 100 L/well and incubated at 37 C. for 30 minutes, followed by 3 washes with PBS. TMB (3,3,5,5-tetramethylbenzidine) was added at 50 L/well, followed by reaction at room temperature for 10 minutes to induce color development, and 2N H2SO4 (Sigma) was added in the same amount. The absorbance was then measured at a wavelength of 450 nm.

    [0138] As was expected, the positive reaction was observed in sandwich ELISA using chimeric 27B6 and mouse serum (data not shown).

    3-2: Production of Monoclonal Antibody

    [0139] Preparation of hybridoma cells from splenocytes of the immunized mice was carried out in the same manner as in Example 1-3.

    [0140] As a result, the antibody that was positive to the lung cancer cell line A549 and negative to the normal lung cell line L132 and to all of the granulocytes, lymphocytes and monocytes in peripheral blood, like 27B6, was selected and designated 4B4. Finally, during a limiting dilution procedure, 4B4 hybridoma cells were diluted and selected for single colony growth (FIG. 3). FIG. 3 shows titers of the 4B4 monoclonal antibody in the peripheral blood, as measured by flow cytometry. The 4B4 hybridoma cell line was deposited on Feb. 14, 2012, with the Korean Cell Line Bank, located at 28 Yongon-Dong, Chongno-gu, Seoul, Korea, and received Accession No. KCLRF-BP-00279 on Feb. 20, 2012.

    3-3: Analysis of 4B4 Antibody

    [0141] The amino acid sequences of the antibody were analyzed according to the substantially same method of Example 1-5. Heavy chain sequences and light chain sequences including the CDR sequences of the 4B4 Ab obtained in Example 3-2 are represented by SEQ ID NOs: 20 and 21, respectively., and CDR1 to 3 of heavy chain are shown in SEQ ID NO: 14 to 16, and CDR1 to 3 of light chain are shown in SEQ ID NO: 17 to 19 (see Table 2).

    EXAMPLE 4: PRODUCTION OF 4B4 CHIMERIC ANTIBODY

    [0142] In order to reduce the immunogenicity of the 4B4 antibody upon administration to the human body, a chimeric antibody in which the mouse antibody, except for the variable region, was substituted with the Fc of the human antibody was constructed according to Example 2. The chimeric antibody was observed to be similar in antigen specificity and affinity to the original mouse 4B4 antibody.

    [0143] The production method of 4B4 chimeric antibody was carried out according to to the same method of <Example 2>. As a result, the prepared antibody was found to have antigen specificity and affinity similar to those of the original mouse 4B4 antibody, as measured by flow cytometry (FIG. 5). FIG. 5 shows the antigen specificity and affinity of the 4B4 chimeric antibody.

    EXAMPLE 5: ANALYSIS OF ANTIBODY EXPRESSION IN VARIOUS CELL LINES

    5-1: Antibody Expression in Various Cell Lines

    [0144] 27B6 chimeric antibody obtain in Example 2 and 4B4 chimeric antibody obtain in Example 4 were analyzed for binding to various cell lines obtained from KCLB (Korean Cell Line Bank) and SNU (Seoul National University) using flow cytometry.

    [0145] Specifically, various cell lines were obtained from KCLB (Korean Cell Line Bank) and SNU (Seoul National University). At 37 C. under a 5% CO.sub.2 atmosphere, L-132, SW-900, DU145, LNCap, MCF-7, Huh7, and Hs-578T were cultured in Dulbecco's MEM (GIBCO, Invitrogen) supplemented with 10% heat-inactivated fetal bovine serum (FBS; GIBCO, Invitrogen) and A549, NCI-H460, NCI-H417, DLD-1, HCT116, HT-29, SW-480, SW-620, LS174T, PC-3, SNU1, SNU638, SNU719, MKN1, MKN28, MKN45, MKN74, NCI-N87, SK-BR3, MDA-MB231, and MDA-MB453 were cultured in RPMI 1640 (GIBCO, Invitrogen) supplemented with 10% heat-inactivated FBS. In addition, incubation was carried out at 37 C. under a 5% CO.sub.2 atmosphere in Eagle's MEM (GIBCO, Invitrogen) supplemented with 10% heat-inactivated fetal bovine serum (FBS; GIBCO, Invitrogen) for Calu-3, Hep3B, SK-HEP-1, C3A, Hep G2, PLC/PRF/5, and BT-20, in IMDM (GIBCO, Invitrogen) supplemented with 20% heat-inactivated fetal bovine serum (FBS; GIBCO, Invitrogen) for KATO III, and in Leibovitz's L-15 medium supplemented with 10% heat-inactivated fetal bovine serum (FBS; GIBCO, Invitrogen) for SW480 and MDA-MB468.

    [0146] The cultured cancer cell lines were incubated with the 27B6 or the 4B4 monoclonal antibody of the present invention at 4 C. for 30 min, washed with PBS, and treated with FITC-conjugated goat anti-mouse IgG (DINONA INC, Korea) at 4 C. for 15 min. The cell lines were washed again with PBS before analysis by FACScaliber (Becton Dickinson, USA). The results are summarized in Table 5, below. Also, titers of the 27B6 and the 4B4 antibody were measured in various solid tumor cell lines.

    [0147] The following Table 5 shows the expression pattern of the carbonic anhydrase 12 antigen in various solid cancer cell lines. In Table 16, the percentage of positive cells for 27B6 and 4B4 monoclonal antibodies among the 5000 cells to be tested was analyzed by FACS analysis, and indicates 10% or less of the number of positive cells, + indicates the range from 10 to 30% of the number of positive cells, ++ refers to 3070% of the number of positive cells, and +++ refers to 70100% of the number of positive cells. When the number of positive cells is less than 10%, it is regarded as negative, and when the number of positive cells is 10% or higher, it is regarded as positive.

    TABLE-US-00007 TABLE 5 Origin Cell line 27B6 4B4 Lung A549 +++ +++ NCl-H460 ++ ++ Colon HCT116 + HT-29 + + LS174T +++ +++ Prostate LNCap + + Stomach SNU 719 + ++ MKN 45 + +++ Liver Huh-7 ++ Hep3B + PLC/PRF/5 +++ +++ Breast MCF-7 + + SK-BR3 +++ +++ MDAMB231 +++ +++ MDAMB453 +++ ++ BT20 + PBMC Lymphocyte Monocyte Granulocyte Cell binding profiling of 4B4 chimeric antibody performed by flow cytometry. : less than 10% of number of positive cells +: 10~30% ++: 30~70% +++: higher than 70%.

    [0148] As shown in Table 5, the 27B6 and 4B4 monoclonal antibodies of the present invention showed a positive reaction, although the degree of binding affinity was different in various types of lung cancer, colorectal cancer, stomach cancer, liver cancer and breast cancer cell line. In contrast, peripheral blood lymphocytes, mononuclear cells, and granulocytes showed all negative results. This shows that the 27B6 and 4B4 antibodies of the present invention can be used as therapeutic agents against solid tumors expressing CA XII antigen.

    5-2: Expression Pattern in Breast Cancer Cell

    [0149] 27B6 and 4B4 were observed to have positive responses to ER-, PR-, and HER2-positive breast cancer cells. Accordingly, both antibodies can be used as therapeutic agents for various breast cancer subtypes including triple-negative breast cancer.

    [0150] The binding of the 27B6 and the 4B4 monoclonal antibody to three different phenotype breast cancer cell lines was examined via flow cytometry. Cell culturing was carried out at 37 C. under a 5% CO.sub.2 atmosphere for MCF-7 cells (Breast cancer cell, ER positive) in Dulbecco's MEM (GIBCO, Invitrogen) supplemented with 10% heat-inactivated fetal bovine serum (FBS; GIBCO, Invitrogen) and for MDA-MB231 (cell lines derived from malignant breast cancer) and SK-BR-3 cells (human breast cancer cell line that overexpresses the Her2 (Neu/ErbB-2) gene product)in RPMI 1640 (GIBCO, Invitrogen) supplemented with 10% heat-inactivated FBS.

    [0151] The cultured cancer cell lines were incubated at 4 C. for 30 min with the 27B6 or the 4B4 monoclonal antibody of the present invention, washed with PBS, and treated at 4 C. for 15 min with FITC-conjugated goat anti-mouse IgG (DINONA INC, Korea). The cell lines were washed again with PBS before analysis by FACS caliber (Becton Dickinson, USA). The results are summarized in Table 6.

    TABLE-US-00008 TABLE 6 Origin Cell line Subtype Immunoprofile 4B4 Expression Breast MCF-7 Luminal ER+, PR+, HER2 +++ SK-BR3 HER2 ER, PR, HER2+ ++ MDAMB453 Basal ER, PRHER2 +++ MDAMB231 Basal ER, PRHER2 +++ MDAMB468 Basal ER, PRHER2 + HS578T Basal ER, PRHER2 + BT20 Basal ER, PRHER2

    [0152] Therefore, the antibodies 27B6 and 4B4 according to the present invention can be used not only for triple negative breast cancer but also for various types of breast cancer, because they show the positive reaction in both ER and PR as well as HER2-positive breast cancer cells.

    5-3: IHC (Immunohistochemistry)

    [0153] Antigens to which 27B6 and 4B4 monoclonal antibodies bind were analyzed for distribution in normal tissues of the human body by immunohistochemistry (IHC). Normal thymus and tonsil tissues of the human body were obtained from the Chungbuk National University Hospital and prepared into cryosections in the department of pathology in the Chungbuk National University Hospital.

    [0154] The prepared cryosections were subjected to immunohistochemical staining with 27B6 and 4B4 monoclonal antibodies of the present invention as follows. Thymus and tonsil cryosections stored at 20 C. or lower were dried at room temperature for 30-60 min, and immersed in 1PBS for 60 min. Then, the tissues were treated at room temperature for 10 min with 3% H.sub.2O.sub.2 to suppress the activity of endogenous peroxidase, washed with flowing water, and blocked at room temperature for 30 min with a goat immunoglobulin-containing serum to exclude non-specific staining with mouse antibodies. Then, the tissues were incubated at room temperature for 60 min with the primary antibody (27B6, 4B4). Each antibody was used at a concentration of 10 g/ml. Thereafter, the tissues were washed three times with 1PBS for 5 min, incubated at room temperature for 30 min with an HRP-conjugated goat anti-mouse antibody (Dako, Denmark), and then washed three times with 1PBST (0.05% Tween20, 1PBS) for 5 min. The color was developed with diaminobenzidine (DAB), followed by washing for 5 min with flowing water. The tissues were counterstained with hematoxylin and then washed for 7 min with flowing water. After staining, the slides were dehydrated and sealed. The staining results were analyzed by microscopy below.

    TABLE-US-00009 TABLE 7 Tissue 27B6 4B4 Thymus Cortex Medulla Tonsil Inter follicular T cell B cell Germinal center Basal layer Basal layer+

    [0155] As shown in Table 7, the antigens that the 27B6 and the 4B4 monoclonal antibody of the present invention recognize are distributed neither in normal thymus nor in normal tonsil tissues. Particularly, nowhere are the antigens expressed in normal mature or immature T cells or B cells. The 27B6 antibody was weakly stained in the basal layer of the tonsil, which, however, seemed to result from non-specific binding.

    EXAMPLE 6: ANALYSIS OF ANTIGEN FOR MONOCLONAL ANTIBODY

    6-1: Isolation and Purification of 4B4 and 27B6 Monoclonal Antibodies

    [0156] The lung adenocarcinoma cell line A549 that had been used to develop the 4B4 and the 27B6 monoclonal antibody was cultured. Then, 110.sup.8 cells were suspended in 50 ml of a lysis buffer (1% Nonidet P-40; NP-40 in 50 mM Tris-HCl, pH 7.4, 50 mM EDTA, and 1 mM phenyl-methyl-sulfonyl-fluoride; PMSF) and lysed for 15 min. After centrifugation, the cell debris was removed, and a cell lysate was obtained as a supernatant. The cell lysates was used to separate antigens that were recognized by 4B4 or 27B6 antibodies.

    [0157] Five mg of each of purified 4B4 and 27B6 monoclonal antibodies were dialyzed against a binding buffer (0.2 M sodium bicarbonate, 0.5M sodium chloride, pH 8.3) to afford two different antibody solutions. A 5-ml column packed with 2 ml of NHS-activated sepharose 4 Fast Flow resin (GE Healthcare) was washed with 20 ml of 1 mM HCl and then with 20 ml of a binding buffer (20 mM sodium bicarbonate, 0.5 M sodium chloride, pH 8.3) so as to allow the prepared antibodies to bind to the column. The column was blocked at the outlet thereof, loaded with either of the two different antibody solutions, and blocked at the inlet thereof. Incubation was performed at room temperature for 4 hrs. Then, 20 ml of a washing buffer (20 mM Sodium acetate, 0.5M sodium chloride, pH 5.4) was made to flow through the column so as to remove excess antibodies that were not bound to the resin. Again, the column was washed with 50 ml of a blocking buffer (0.1 M ethanolamine, 0.5 M sodium chloride, pH 8.3) to remove remaining reaction groups. The two columns were washed with 20 ml of a stock buffer (20 mM Tris-HCl, 150 mM NaCl, 0.02% sodium azide, pH 8.0), and refrigerated until use.

    [0158] The prepared columns were applied to FPLC (Acta FPLC) so that the antibodies bound to the resin could recognize antigens and thus could allow for the separation of the antigens. The lung adenocarcinomic A549 cell line lysates was loaded to the column coupled to FPLC and used as an antigenic source that was recognized by 4B4 and 27B6 monoclonal antibodies. Antigen separation was performed in a four-step process: equilibrium; sample loading; washing and second washing; elution. An equilibrium buffer and a wash buffer have the same composition: 0.5% Tween-80, 20 mM Sodium phosphate, 150 mM sodium chloride, pH 7.4. This buffer was used in an amount of 10 ml for equilibrium and in an amount of 20 ml for washing. An elution buffer contained 0.3 M Glycine, 0.1 M sucrose, 0.1 M Mannitol, 1.0 M urea, and 0.5% Tween-80, had a pH of 3.0, and was used in an amount of 20 ml for washing. For the second washing, a mixture in which the elution buffer was mixed at a ratio of 25% with the washing buffer was employed. 5 ml of TCA was added to 20 ml of the eluted solution obtained during the antigen separation and stored for 30 min in a refrigerator. After centrifugation, the pellet was further washed twice with acetone. The finally obtained pellet was suspended in 1SDS-PAGE sample buffer, subjected to electrophoresis, and stained with Coomassie blue. As described above, antigens that were isolated and purified through the columns respectively fabricated with 4B4 and 27B6 antibodies are shown in FIG. 6. FIG. 6 shows electrophoretograms of antigens isolated and purified from the lung adenocarcinoma A549 cell line through columns fabricated with 4B4 and 27B6 monoclonal antibodies.

    6-2: Identification of Antigen for 4B4 and 27B6 Monoclonal Antibodies

    [0159] The antigens isolated and purified from the resin coupled with the 4B4 and the 27B6 monoclonal antibody were visualized as shown in FIG. 7. The two main protein bands indicated by the arrows at about 58 kDa were analyzed in Seoul Pharma Laboratories. For identification, peptides were prepared via in-gel digestion and analyzed using LC-MS/MS, followed by processing the MS/MS spectra with PLGS (Waters) and MASCOT (Matrix Science). A series of analyses was conducted as follows.

    [0160] Gel pieces containing proteins were dehydrated using 100% CAN (acetonitrile) and completely dried in a Speed-vac. The proteins in the dried gel pieces were digested for 15 min with trypsin. The tryptic peptides were extracted with 60% CAN and 0.1% TFA. The pooled extracts were dried in a Speed-vac. The samples were dissolved in 5% CAN, 0.2% TFA (Trifluoroacetic acid) 20 l prior to LC-MS/MS analysis. Peptides were eluted from the LC column nanoACQUITY UPLC BEH C18 (1.7 m, 300 , 2.1 mm150 mm I.D.), with a gradient of a mobile phase buffer A (0.1% TFA in 100% DW) to a mobile phase buffer B (0.1% TFA in 100% ACN) in a LC-MS/MS analysis. The separated peptides were analyzed online in a positive survey scan mode on a nano-ESI-Q-TOF instrument. Subsequently, the spectral data were processed with PLGS and MASCOT.

    [0161] As a result of the above-described series of analyzes, the final identification results are obtained as shown in the following table, and they are shown in Table 8 below.

    TABLE-US-00010 TABLE 8 Antibody No. Description mW(Da) pI(pH) 4B4 1 Actin cytoplasmic 1 41739 5.15 4B4 2 Carbonic anhydrase 12 39426 6.79 4B4 3 Keratin type I cytoskeletal 9 62026 4.96 4B4 4 Serum albumin 68647 5.68 4B4 5 Trypsin 24393 6.91 4B4 6 Actin 3 41813 5.01 4B4 7 Actin 1 41648 5.24 27B6 1 Carbonic anhydrase12 39426 6.79 27B6 2 Pyruvate kinase isozymes 58470 7.96 M1/M2 27B6 3 Actin cytoskeletal 1 41814 5.24 27B6 4 Retinal dehydrogenase 1 42327 5.08 27B6 5 Hemoglobin subunit beta 1 15830 7.5 27B6 6 Synaptic vesicle membrane 42122 5.88 protein VAT-1 homolog 27B6 7 Protein disulfide isomerase 57146 5.98 27B6 8 Serum albumin 68647 5.68 27B6 9 Trypsin 24393 6.91 27B6 10 Actin gamma 41580 5.33

    [0162] As expected, carbonic anhydrase 12 of the analysis results was identified in common from the antigens purified by both the 4B4 and the 27B6 monoclonal antibody, and was found to exist on cell surfaces. The other proteins cannot be antigens for the 4B4 and the 27B6 monoclonal antibody, because they are intracellular proteins. Thus, they seemed to be impurities included due to imperfect separation and purification.

    [0163] Four peptides were separated by 27B6: QFLLTNNGHSVK (SEQ ID NO: 22), WTYFGPDGENSWSK (SEQ ID NO: 23), GQEAFVPGFNIEELLPER (SEQ ID NO: 24), and YKGQEAFVPGFNIEELLPER (SEQ ID NO: 25). Three peptides were separated by 4B4: QFLLTNNGHSVK (SEQ ID NO: 22), EMINNFR (SEQ ID NO: 26), and GVIYKPATK (SEQ ID NO: 27). Of them, the sequence QFLLTNNGHSVK was analyzed in common in both 4B4 and 27B6. FIG. 8 shows the amino acid sequence of carbonic anhydrase 12 precursor isoform 1, with the analyzed peptide sequence expressed in bold. FIG. 8 lists up the proteins identified by LC-MS/MS analysis from purified antigens. Table 9 shows the amino acid sequence of carbonic anhydrase 12 isoform 1 according to Example 6 and antigenic peptide fragment of the antigens recognized by 27B6 and 4B4 antibody, detected by LC-MS/MS. Such results show that the antigenic peptide fragment of the antigens recognized by 27B6 and 4B4 antibody is carbonic anhydrase 12 isoform 1.

    TABLE-US-00011 TABLE9 CA12 MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWT isoform1 YFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQ YDASLTPLEFQGYNLSANKQFLLTNNGHSVKLN LPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSE HTVSGQHFAAELHIVHYNSDLYPDASTASNKSE GLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQ EAFVPGFNIEELLPERTAEYYRYRGSLTTPPCN PTVLWTVFRNPVQISQEQLLALETALYCTHMDD PSPREMINNFRQVQKFDERLVYTSFSQVQVCTA AGLSLGIILSLALAGILGICIVVVVSIWLFRRK SIKKGDNKGVIYKPATKMETEAHA Peptide QFLLTNNGHSVK EMINNFR fragment GVIYKPATK ofantibody recognized by4B4 Peptide QFLLTNNGHSVK WTYFGPDGENSWSK fragment YKGQEAFVPGFNIEELLPER ofantibody GQEAFVPGFNIEELLPER recognized by27B6

    6-3: Assay of Antigen for 4B4 and 27B6 Monoclonal Antibodies (ELISA)

    [0164] To evaluate the antigen identification results obtained by LC-MS/MS, the reactivity of the 4B4 and the 27B6 monoclonal antibody to the recombinant protein carbonic anhydrase 12 (R&D Systems) were examined by ELISA and Western blotting assay.

    [0165] The recombinant protein CA12 was plated at a density of 100 ng/well into Maxisrop ELISA plates and incubated at 37 C. for 1 hr. To each of the antigen-coated wells, 200 l of a 1blocking buffer (Sigma) was added, followed by incubation at 37 C. for 1 hr for blocking. 4B4, 27B6, and an anti-CA12 monoclonal antibody (R&D Systems) were plated, together with 100 l of PBS, into the plates. After incubation for 1 hr at 37 C., the plates were washed with PBS to remove unbound antibodies. Subsequently, a dilution of goat anti-mouse IgG-HRP (Jackson) was added to the wells, reacted for 30 min, and washed with PBS. Color development was accomplished for 10 min with 50 l of TMB in each well, and stopped with 50 l of sulfuric acid. Absorbance at 450 nm was read. Although the reactivity of the 27B6 monoclonal antibody to the recombinant carbonic anhydrase 12 was low, reactivity signals of 4B4, 27B6, and anti-CA12 monoclonal antibody (R&D Systems) against the recombinant antigen are shown in FIG. 7. FIG. 7 shows the identification of carbonic anhydrase 12 as an antigen for the 4B4 and the 27B6 monoclonal antibody, as analyzed by ELISA assay.

    6-4: Assay of Antigen for 4B4 and 27B6 Monoclonal Antibodies (Western Blotting)

    [0166] The recognition of carbonic anhydrase 12 as an antigen by the 4B4 and the 27B6 monoclonal antibody, proven in the previous experiment, was confirmed by Western blotting. The recombinant carbonic anhydrase 12 was boiled for 3 min, loaded into an 8% separating sodium dodecyl sulfate-polyacrylamide gel, and run by electrophoresis. The separated proteins were transferred to a nitrocellulose membrane which was then blocked with 5% skim milk (Sigma) and treated with the 4B4, 27B6, or anti-CA12 monoclonal antibody (R&D Systems) (27B6: lanes 1 and 2, 4B4: lanes 3 and 4, anti-CA12 monoclonal antibody: lanes 5 and 6). After three rounds of washing with a wash buffer (0.1% Tween-20 in PBS), the antibody was coupled with peroxidase-conjugated goat anti-mouse IgG (Sigma, Saint Louis, USA). After the nitrocellulose membrane was washed with a wash buffer, bands were visualized using an enhanced chemiluminescence detection system (ECL, Amersham, Sweden). The results are shown in FIG. 8. FIG. 8 shows the identification of carbonic anhydrase 12 as an antigen for the 4B4 and the 27B6 monoclonal antibody, as analyzed by Western blotting assay. The recombinant CA12 was detected at 40 kDa by all of the 4B4, 27B6, and anti-CA12 monoclonal antibodies (R&D Systems).

    6-5: Assay of Antigen for 4B4 and 27B6 Monoclonal Antibodies (Sandwich ELISA)

    [0167] ELISA and WB assays demonstrated that 4B4 and 27B6 monoclonal antibodies recognize carbonic anhydrase 12 as an antigen, but the detection signal of the 27B6 monoclonal antibody was relatively low. To compensate for the relatively low signal, Sandwich ELISA was conducted as follows. The chimeric 4B4 or 27B6 monoclonal antibody was plated at a concentration of 100 ng/well into Maxisrop ELISA plates and incubated at 37 C. for 1 hr. To each of the antigen-coated wells, 200 l 1blocking buffer (Sigma) was added, followed by incubation at 37 C. for 1 hr for blocking. Two-fold serial dilutions of the recombinant carbonic anhydrase 12 staring from 100 ng/ml were added to wells, incubated at 37 C. for 1 hr, and washed with PBS to remove unbound antigens. Subsequently, the 4B4 monoclonal antibody and the 27B6 monoclonal antibody were added at a concentration of 100 ng/well to chimeric 27B6-coated wells and chimeric 4B4-coated wells, respectively. Following 1 hr of incubation at 37 C., the wells were washed with PBS to remove unbound antibodies. In addition, the bound antibodies were incubated with a dilution of goat anti-Mouse IgG-HRP (Jackson) for 30 min and washed with PBS. Color development was accomplished for 10 min with 50 l of TMB in each well and stopped with 50 l of sulfuric acid. The absorbance at 450 nm was detected. When chimeric 27B6 and 4B4 were used as a capture antibody and a detector antibody, respectively, high reaction signals were read, as shown in Table 10. Both of the 4B4 and 27B6 monoclonal antibodies were therefore proven to recognize carbonic anhydrase 12 as an antigen.

    [0168] Table 10 shows the concurrent recognition of carbonic anhydrase 12 by the 27B6 and 4B4 monoclonal antibodies, as measured by sandwich ELISA assay using the 27B6 and 4B4 monoclonal antibodies as capture/detector antibodies.

    TABLE-US-00012 TABLE 10 Capture antibody Chimeric 27B6 Chimeric 4B4 Detector antibody 4B4 mAb 27B6 mAb CA12 100 ng/ml 1.653 0.021 CA12 50 ng/ml 1.349 0.016 CA12 25 ng/ml 0.954 0.016 CA12 12.5 ng/ml 0.634 0.011 CA12 6.25 ng/ml 0.351 0.009 CA12 3.13 ng/ml 0.193 0.008 blank 0.064 0.007 blank 0.055 0.008

    EXAMPLE 7: EPITOPE MAPPING

    [0169] To analyze an epitope, as shown in FIG. 13, recombinant antigen, with or without the epitope, were constructed, and analyzed for immune reactions of mouse monoclonal antibodies of 27B6 and 4B4 in Example 1 and 3.

    7-1: Construction and Expression of CA12 Mutant Recombinant Gene

    [0170] The recombinant vector pSec-Tag-CA 12 full-hFc was digested with BamHI and HindIII to prepare CA12 mutant recombinant genes. A recombinant gene in which a full base sequence of CA12 antigen was fused to hFc was inserted into pSec-Tag which was then allowed to express a recombinant fusion protein containing the full length of CA12 plus hFc. As seen in FIG. 13, deletion mutant-hFc constructs having various lengths within a range from the N terminus to amino acid 300 were prepared.

    [0171] Respective pSec-Tag vectors carrying the CA12 full-hFc and five different deletion mutant-hFc constructs were introduced into CHO cells with the aid of ViaFect (Promega).

    [0172] Briefly, one day before transfection, CHO cells were plated and incubated. After the medium was exchanged with a fresh one, a complex of the vector and ViaFect was applied to the CHO cells and incubated for 48 hours. Two days after transfection, the culture supernatant was collected and analyzed for the expression of the gene by detecting human Fc (hFc) through sandwich ELISA.

    7-2: Assay of Epitope of Monoclonal Antibody

    [0173] In order to examine a CA12 epitope recognized by the monoclonal antibodies of the present invention, 50 ng of an anti-human Ig antibody (Jackson Laboratory) was added to each well and incubated at 37 C. for 1 hr. The antibody fixed to the well, which would serve as a capture antibody, was blocked via incubation with 200 l of a 1blocking buffer (Sigma) at 37 C. for 1 hr in each well. Each of the respective cultures containing the CA12 full-hFc and the five different deletion mutant-hFc constructs was added at a concentration of 100 l/well to the plates. Following 1 hr of incubation at 37 C., the wells were washed with PBS to remove unbound antibodies. Subsequently, a dilution of anti-mouse Ig, Fc specific-HRP (Jackson Laboratory) was added to the wells, reacted for 30 min, and washed with PBS. Color development was accomplished for 10 min with 50 l of TMB in each well, and stopped with 50 l of sulfuric acid. The absorbance at 450 nm was read. The presence of CA12 mutant-hFc proteins in the culture supernatants was examined using Capture & Detect Sandwich ELISA, with an anti-human Ig antibody serving as a control. The results are given in FIG. 9.

    [0174] As can be seen in FIG. 9, the epitopes were located in a site from a.a. 25 to a.a. 57, which is a non-catalytic domain. Hence, the antibodies of the present invention do not bind to the catalytic domain of CA-XII, so they do not inhibit the enzymatic activity of CA-XII.

    [0175] In detail, the epitope specific for the 27B6 antibody was found to have the amino acid sequence APVNGSKcustom-character of SEQ ID NO: 2 (the span from 25.sup.th amino acid to 38.sup.th amino acid on SEQ ID NO: 5), as analyzed by the deletion method. A three-dimensional crystal structure of CA12 confined the epitope into 7 consecutive amino acids WTYFGPD of SEQ ID NO: 1 (corresponding to 32 to 38 of SEQ ID NO: 5) on the amino acid sequence of SEQ ID NO: 2. Further, the epitope specific for the 4B4 antibody was found to have the amino acid sequence

    TABLE-US-00013 GENSWSKKYPSCGGLLQSPofSEQIDNO:4
    (the span from 39th to 57th amino acids in SEQ ID NO: 5) while a three-dimensional crystal structure of CA12 confined the epitope into 14 consecutive amino acid sequence GENSWSKKYPSCGG of SEQ ID NO: 3 (corresponding to 39th to 52th amino acids of SEQ ID NO: 5) on the amino acid sequence of SEQ ID NO: 4.

    EXAMPLE 8: THERAPEUTIC EFFECT OF CHIMERIC ANTIBODY ON SOLID TUMOR (CDC)

    8-1: CDC Effect in Lung Adenocarcinomic Cell Line

    [0176] The lung adenocarcinomic cell line A549 cells were plated at a density of 510.sup.3 cells/well into 96-well plates and cultured for 20-24 hours in a 37 C., CO.sub.2 incubator. After removal of the culture medium from each well, an RPMI medium, free of fetal bovine serum, was mixed with 10% human serum and the chimeric 27B6 antibody was added at a final concentration of 10 g/ml to a mixture. This solution was plated at a concentration of 100 l/well into the plates.

    [0177] The 4B4 chimeric antibody was also treated in the same manner. Following 3 hours of incubation in a 37 C. CO.sub.2 incubator, Ez-CyTox agent (DOGEN, KOREA) was added in an amount of 10 l to each well. Incubation for 3.5 hours in a 37 C., CO.sub.2 incubator was followed by measuring absorbance at 450 nm on a plate reader. The results are given in FIG. 10. FIG. 10 shows the complement-dependent cytotoxic effects of the 27B6 antibody.

    [0178] As can be seen in FIG. 10, the 27B6 and 4B4 chimeric antibodies obtained in Example 2 and 4 exhibit complement-dependent cytotoxicity.

    8-2: CDC Effect in Triple-Negative Breast Cancer

    [0179] According to the same method of <Example 8-1>, the therapeutic effect was evaluated, except that MDAMB-231 of triple-negative breast cancer cell line was used as a target cell instead of A549 cell lines, and absorbance at 450 nm was measured and shown in Table 11. Table 11 shows the results of confirming that the 4B4 chimeric antibody according to Example 8 exhibits complement dependent cytotoxicity in triple negative breast cancer.

    TABLE-US-00014 TABLE 11 Sample Cytotoxicity (%) No treat 0.0 5% HS (12.7) 5% NHS + 4B4 1 ng/ml 76.5 5% NHS + 4B4 10 ng/ml 86.3 5% NHS + 4B4 100 ng/ml 83.4 5% NHS + 4B4 1000 ng/ml 75.7 5% NHS + 4B4 10000 ng/ml 83.7 4B4 + 5% NHS + CVF 50 ug 83.9 4B4 + 5% NHS + CVF 100 ug 80.7

    [0180] As shown in Table 11, the 27B6 monoclonal antibody of the present invention exhibited complement-dependent cytotoxicity against lung adenocarcinomic tumors.

    EXAMPLE 9: THERAPEUTIC EFFECT OF CHIMERIC ANTIBODY IN SOLID TUMOR (ADCC)

    9-1: Assay for Antibody-Dependent Cell-Mediated Cytotoxicity (ADCC LDH Assay)

    [0181] In order to prepare effector cells, Ficoll was added to a human blood sample (blood:Ficoll=1:2), followed by centrifugation at 2000 rpm for 20 min to obtain PBMCs (Peripheral Blood Mononuclear Cells). The PBMCs were stored at 37 C. in a 5% PBS-supplemented RPMI medium. The antibody-dependent cell-mediated cytotoxicity assay was conducted in conjunction with an LDH assay or a Luciferase assay.

    [0182] As targets, various solid tumor cell linesHT29 (colorectal cancer), A549 (lung adenocarcinoma), NCI-H460 (lung adenocarcinoma), and MCF7 (breast cancer)were each plated at a density of 110.sup.4 cells/well into 96-well plates and cultured for 18-20 hours in a 37 C., CO.sub.2 incubator. After removal of the culture medium from each well, the 27B6 chimeric antibody was added at a concentration of 0 g/mL, 0.1 g/mL, or 3 g/mL to a culture medium supplemented with 5% FBS, and then plated at a concentration of 100 l/well into the plates, followed by incubation for 30 min in a 37 C. CO.sub.2 incubator. Thereafter, the effector cells prepared above were plated at a density of 510.sup.5 cells/well (50 times as many as the target cells), and cultured for 24 hours in a 37 C. CO.sub.2 incubator. For a positive control, a lysis buffer was added before incubation at 37 C. for 24 hours. Following 24 hours of incubation, the cell culture was centrifuged at 2500 rpm for 5 min. The supernatant thus obtained was measured for LDH (lactate dehydrogenase) activity to calculate the cell lysis (Promega assay kit). As shown in FIG. 11, the 27B6 monoclonal antibody of the present invention exhibited antibody-dependent cell-mediated cytotoxicity in various solid tumors (FIG. 11). FIG. 11 shows the antibody-dependent cell-mediated cytotoxic effects of the 27B6 antibody.

    9-2: Antibody-Dependent Cell-Mediated Cytotoxicity Assay in Triple-Negative Breast Cancer (ADCC-LDH Assay)

    [0183] Effector cells were prepared in the same manner as in Example 9-1, and tested for antibody-dependent cell-mediated cytotoxicity.

    [0184] In addition, the 27B6 antibody was found to exhibit high antibody-dependent cell-mediated cytotoxicity in triple-negative breast cancer cell lines (MDAMB-231, MDAMB-468, MDAMB-453, BT-20) for which no therapeutic agents had yet been developed (FIG. 12). FIG. 12 shows the antibody-dependent cell-mediated cytotoxic effects of the 27B6 antibody on triple-negative breast cancer cell lines.

    EXAMPLE 10: THERAPEUTIC EFFECT OF DEFUCOSYLATED ANTIBODY IN SOLID TUMOR (ADCC)

    10-1: Assay for ADCC of Defucosylated Chimeric 27B6 AntibodyColon, Lung, Breast Cancer

    [0185] In order to induce the defucosylation of antibody proteins, the 27B6 antibody cell lines of Example 2 and the 4B4 chimeric antibody cell lines of Example 4 were incubated with 100 ng/ml kifunensine which induces the defucosylation of antibody, and the defucosylated antibodies were separated and compared to corresponding fucosylated antibodies. Assay for ADCC of Kifunensine treated, ADCC-Enhanced, Chimeric 27B6 Antibody showed the ADCC effect of defucosylated antibody in Colon cancer, Lung cancer and Breast cancer.

    [0186] As can be seen in FIG. 13, the antibodies defucosylated by kifunensine were increased in antibody-dependent cell-mediated cytotoxicity against various solid tumor cell lines. FIG. 13 shows the antibody-dependent cell-mediated cytotoxicity of the defucosylated 27B6 chimeric antibody.

    10-2: Assay for ADCC of Defucosylated Chimeric 27B6 AntibodyTriple-Negative Breast Cancer

    [0187] By using a luciferase ADCC assay, antibody-dependent cell-mediated cytotoxicity against the triple-negative breast cancer cell line MDAMB231 and the HER2 receptor-positive breast cancer cell line SK-BR3 was analyzed. The antibodies after being defucosylated by treatment with kifunensine exerted higher antibody-dependent cell-mediated cytotoxicity on MDAMB231 and SK-BR-3 than corresponding fucosylated antibodies (FIG. 14).

    [0188] FIG. 14 shows the antibody-dependent cell-mediated cytotoxicity of defucosylated 4B4 and 27B6 chimeric antibodies, as measured by a luciferase assay.

    [0189] Specifically, as target cells, the breast cancer cell lines MDAMB231 and SK-BR3 were each plated at a density of 1.2510.sup.4 cells/well into 96-well plates and cultured for 20-24 hours in a 37 C. CO.sub.2 incubator. After removal of the culture medium from each well, 25 l of an RPMI medium containing 4% low IgG FBS was added to each well in which the cells were plated. 27B6 and 4B4 antibodies were 3-fold diluted in serial from 10 g/ml to 1.2 ng/ml in an RPMI medium containing 4% low IgG FBS. The serial antibody dilutions were each added in an amount of 25 l/well, and the plates were covered with respective lids and left on a clean bench. ADCC reporter cells (ADCC Reporter Bioassay, Promega) were harvested from the cell culture and suspended at a concentration of 310.sup.6 cells/ml in an RPMI medium containing 4% low IgG FPBS. To each well was added 25 l of the suspension of ADCC reporter cells, followed by 24 hours of incubation in a 37 C. CO.sub.2 incubator. Before the plates were withdrawn, a frozen luciferase substrate was thawed in a water bath. The plates were removed from the clean bench and left at room temperature for 15 min. The luciferase substrate was added at a concentration of 75 l/well to the plates and reacted for 30 min in a dark condition, followed by measuring luminescence with a luminometer. The result of antibody-dependent cytotoxicity test of defucosylated 27B6 and 4B4 chimeric antibody using Luciferase assay is shown in FIG. 14.

    [0190] As seen in FIG. 14, 27B6 and 4B4 antibodies, after being defucosylated by treatment with kifunensine, exerted greater antibody-dependent cell-mediated cytotoxicity on MDAMB231 and SK-BR-3 than did corresponding fucosylated antibodies.

    EXAMPLE 11: THERAPEUTIC EFFECT OF 27B6 AND 4B4 ANTIBODIES IN MOUSE MODELS

    11-1: Cell Line Establishment

    [0191] Animal models with human breast cancer were established using the triple-negative breast cancer cell lines MDA-MB-231 and MDA-MB-453. First, MDA-MB-231 or MDA-MB-453 was subcutaneously injected at a dose of 1.510.sup.8 cells (in RPMI: Matrigel mixture) into the right flank of mice. The injected mice were randomly classified into test and control groups.

    [0192] FIG. 15 further shows the binding of 27B6 chimeric antibody in Example 2 and 4B4 chimeric antibody in Example 4 to the surface of MDA-MB231 cells utilized in the animal experiment, and FIG. 16 shows the results of the animal experiment using the antibodies, demonstrating that the antibodies suppress the growth and size of MDA-MB231-induced tumor.

    [0193] As test materials, the 27B6 fucosylated chimeric antibody, 27B6 defucosylated chimeric antibody, 4B4 fucosylated chimeric antibody, and 4B4 defucosylated chimeric antibody were inoculated into breast cancer cells. Three days later, the cells were intraperitoneally injected at a dose of 12 mg/kg to each mouse. Injection was conducted twice a week for three weeks. Tumor sizes were measured just before injection. The inhibitory activity of the anti-CA12 antibodies against breast cancer was expressed as the tumor volume calculated according to the following formula: (ab.sup.2)/2 (a is the short diameter and b is the long diameter). The volume calculation equation is the same as the volume calculation formula of Example 20-1.


    Volume calculation equation (volume=(ab)/2, where a is the short diameter and b is the long diameter)[Equation]

    11-2: Inhibitory Activity of Anti CA12 Antibodies Against Triple-Negative Breast Cancer

    [0194] Targeting a CA12 epitope specifically expressed on triple-negative breast cancer, anti-CA12 chimeric antibody 4B4 was assayed for inhibitory activity against triple-negative breast cancer (FIG. 17).

    [0195] Breast tumors were decreased in volume by 4B4, and the defucosylated antibody was superior in inhibitory activity against tumor growth to the corresponding fucosylated antibody. The inhibitory activity of the 4B4 fucosylated antibody against the growth of breast cancer tumors was found in both MDA-MB-231 and MDA-MB-453.

    [0196] Particularly, complete remission was observed in the MDA-MB-453 model as the tumor did not grow further after day 21 (FIG. 17). FIG. 17 shows the inhibitory activity of the 4B4 antibodies against triple-negative breast cancer.

    EXAMPLE 12: EFFECT OF ANTIBODY ON CELL SURVIVALS

    [0197] The effect of the chimeric 4B4 antibody of Example 4 on cell viability was confirmed. When the antibodies were applied to CA12-positive cancer cells, the effects of the antibodies on cell growth and survival were examined. To this end, cells were plated at a density of 310.sup.4 cells/well into 96-well flat bottom plates one day before application (10% RPMI). After 24 hours, the RPMI was removed, and fresh 5% RPMI containing the antibody was added in an amount of 100 l to each well.

    [0198] After 24 hours, a CytoTox 96 Non-Radioactive Cytotoxicity Assay kit (Promega, Cat. #G1780) was plated at a concentration of 50 l/well and incubated for 30 min at room temperature. Cell viability was measured using a spectrophotometer. Twenty four hours after the antibody was applied to MDA-MB231 cells, the cell viability was measured.

    [0199] The results of the measurements are shown in FIG. 18. The administration of the antibodies neither promoted nor degraded cell viability. The antibodies did not inhibit CA12 enzymatic activity, and had no influences on tumor cell growth. Therefore, the antibodies according to the present invention were found to exhibit anti-tumor activity via ADCC and CDC through the immune system.

    [0200] Cell viability was measured 24 hours, 48 hours and 72 hours after the administration of the antibody to A549. No significant changes in cell viability were observed compared to the cells to which no antibodies were administered. FIGS. 19 and 20 show that the binding of the 4B4 antibody alone to tumor cells does not affect the growth of the tumor cells.

    [0201] The 4B4 antibody, as an anti-CA12 antibody, had no influence on cell growth only when the antibody was bound to cells. This seems to be attributable to the fact that the 4B4 antibody does not affect the enzymatic activity of CA12 because it binds to an N-terminal non-enzymatic region of the CA12 antigen.

    EXAMPLE 13: EVALUATION OF THERAPEUTIC EFFECT BY COMBINATION OF ANTIBODY THERAPY AND RADIOTHERAPY

    [0202] An examination was made to see whether or not a combination of the antibody of the present invention and radiotherapy could bring about an increased anticancer effect Briefly, the 27B6 chimeric antibody of Example 2 was used in combination with 5 g/ml cisplatin, 2 Gy radiation, or 4 Gy radiation, and A549 cells were analyzed for CA12 expression via flow cytometry. As a result, both cisplatin and radiation were found to increase the expression of CA12 on cell surfaces, with the maximum expression level induced by 4 Gy radiation. This indicates that a combination of the anti-CA12 antibody of the present invention with radiotherapy is able to affect the growth of tumor cells (upper diagram in FIG. 20).

    [0203] To assay the effect of the combined therapy on the growth of tumor cells, as shown in the lower diagram of FIG. 20, the viability of the cancer cell line A549 was measured via an MTT assay after it was treated with a combination of the 27B6 antibody and radiotherapy. In FIG. 20, the lower graph shows the effects of a combination of the 27B6 antibody and radiotherapy on cell viability. As can be seen in FIG. 20, a combination of 27B6 and radiotherapy induced cell death at higher rates, compared to the antibody alone or a combination of an isotype control antibody and radiotherapy.

    EXAMPLE 14: HUMANIZATION OF ANTI-CA-XII CHIMERIC ANTIBODY

    14-1: Construction of Humanized Variable Domains (DNP004 scFv Form Selection)

    [0204] The 4B4 chimeric antibody in the full IgG form obtained in Example 4 was transformed into the scFv form for antibody screening by using the phage display technology possessed by the D.H. lap. For this, the variable region of chimeric 4B4 antibody was changed to E. coli codon and the scFv gene was constructed by linking VL and VH with PCR. The order of VL and VH sequence and linker length were combined to construct various constructs and ligated to phagemid vector. The ligated plasmid vector was analyzed by binding assay with antigen CA XII, and VH-long linker-VL form of DNP004 scFv was selected and used as a mutagenesis template.

    14-2: Sub-Library Construction and Screening

    [0205] 11 random mutation sub-libraries or position specific mutation sub-libraries were prepared for all or part of the variable region through the know-how of D.H. Lab. The types of sub-libraries produced are as follows:

    [0206] (1) Random mutation sub-library: 1 kind of VL, 1 kind of VH, 2 kinds of VH&VL, and

    [0207] (2) Position specific mutation sub-library: three kinds of LCDR, three kinds of HCDR, and 1 kind of VH&VL.

    [0208] Bio-panning of CA XII was performed on the eleven (11) sub-libraries. From the first screening, 552 clones to have high signal in the VL region were selected. Secondary screening was performed to select 78 clones to have higher than the signal of the mother clone. A total of 32 clones with different polynucleotide sequences were selected after confirming the polynucleotide sequence.

    [0209] The selected 32 clones were reaffirmed their binding affinity to CA XII by ELISA, and 10 clones (clone ID 1, 2, 4, 5, 8, 15, 24, 25, 26, 28) with an ELISA signal greater than 1.5 times of the 4B4 chimeric antibody were selected. As a result of sequence analysis of their CDRs, it was confirmed that there were mutations in the LCDR1 and LCDR2 regions (FIG. 22).

    [0210] Then, the LCDR1 and LCDR2 portions are judged as hot-spot, and the 10 clones (clone ID: 1, 2, 4, 5, 8, 15, 24, 25, 26, 28) and additional 4 clones having mutations in LCDR2 portion (clone ID: 11, 22, 19, 30) were selected and then conversed to be full IgG (L K sun, P Curtis, Chimeric antibody with human constant regions and mouse variable regions directed against carcinoma-associated antigen 17-1A, Proc Natl Acad Sci USA. 1987 January; 84 (1): 214-8] (FIGS. 21 and 22). However, clone IDs: 4, 5, 24, and 28 among 14 clones were excluded from further material testing because of low expression. The mutation sites of the ten selected clones are summarized in Table 12 below.

    TABLE-US-00015 TABLE 12 Sub-library Clone ID random selected Mutation position #1 VL-CDR1, VL-CDR2 #2 VL-CDR2 #4 VL-FR1 #5 VL-CDR1, VL-CDR2 #8 VL-CDR2 #15 VL-CDR2 #24 VL-CDR2 #25 VL-CDR2 #26 VL-CDR1, VL-FR1 #28 VL-FR1

    14-3: Transfection of Humanized Library and Culture and Measurement of IgG

    [0211] CHO cells were inoculated into 96-well plates and transfected with mini-preparative DNA of humanized clones. The detailed experimental method is as follows.

    [0212] First, before 12 hours of transfection, CHO cell line was inoculated into a 6-well plate at a concentration of 110.sup.5 cells/ml, and 3 ml of DMEM containing 5% fetal calf serum was added and cultured at 37 C. in 5% CO.sub.2 for 12 hours. Ten kinds of Full IgG DNA were transformed into prepared CHO cells using a ViaFect reagent kit (Promega, USA). Cell culture supernatants were collected 48 hours after transfection and the reactivity of each humanized clone and control IgG antibody were confirmed by ELISA.

    [0213] 100 ng of recombinant protein CA XII per well was added to the Maxisrop ELISA plate and reacted at 37 C. for one hour to coat the antigen. Then, 1blocking solution (Sigma) was added to 200 l per well and blocked for reaction at 37 C. for one hour. 4B4, 27B6, anti-CA XII monoclonal antibody (R&D Systems) and PBS 100 ul were added to the prepared plate, incubated at 37 C. for 1 hour and washed with PBS to remove the unbound antibodies. Then, the reaction was added with diluted Goat anti-Human IgG-HRP(Jackson), incubated for 30 minutes, washed with PBS, reacted with TMB solution at an amount of 50 ul per well for 10 minutes, and the reaction was quenched with addition of 50 ul of sulfuric acid. The absorbance of product was measured at 450 nm.

    14-4: Antigen Affinity Test for Candidate Humanized Antibody Using ELISA

    [0214] The parallel test on the binding of humanized clones to antigen CA-XII was carried out by using the protocols and antigens provided in the D.H Lab. Activity (affinity) was calculated for each clone and compared to the activity of the positive control (chimeric clone 4B4) on the same plate. The antigen binding affinity of 10 variants (clone ID 1, 2, 4, 5, 8, 15, 24, 25, 26, 28) was not significantly higher than that of the mother clone (4B4 chimeric). The expected affinity of the mother clone analyzed by ELISA was about KD 10.sup.10 M, which is quite high. Thus, it is considered that the binding force of 10 candidate antibodies is not low even if the antigen binding affinities of the candidate clones do not reach the mother clone (FIGS. 23 and 24).

    EXAMPLE 15: CDR SEQUENCE/ANTIBODY SEQUENCE OF HUMANIZED ANTIBODY

    15-1: Selection of Gene Sequence of Anti-DNP004 Humanized Antibody

    [0215] The DNP004 humanized antibody gene was prepared by using a light chain variable region gene and heavy chain variable region gene of mouse monoclonal antibody 4B4 (hybridoma deposited as an accession number: KCLRF-BP-00279) specifically binding to CA-XII as a template to prepare a humanized antibody, 10 random mutation sub-libraries or position specific mutation sub-libraries were prepared for all or part of the variable region through the in silico know-how of D.H. Lab

    [0216] 552 clones were screened by phage display technique using the constructed library, and 78 clones showing higher signal than mother clone were screened. 32 different clones were screened according to the nucleotide sequence analysis. As a result of analysis for 32 clones for the binding affinity to CA XII, 10 clones were selected, when ELISA signal was more than 1.5 times as high as that of mother clone, and the mutation sites were largely in LCDR1 and LCDR2 regions. Therefore, LCDR1 and 2 were selected as hot-spot, and 4 kinds (Clone ID: 11, 22, 19, 30) with mutation in LCDR2 region were selected to perform full IgG1 conversion. Among the prepared 14 IgGs, clone IDs 4, 5, 24, and 28 were excluded for low expression, and remnant 10 clones were expressed and purified, and finally ELISA was performed to select the final 10 species.

    [0217] Finally, humanized antibody #8 candidate that was mostly similar to mouse monoclonal antibody 4B4 were selected. The humanized antibody genes for each candidate antibody were identified by sequencing. The heavy chain variable region sequences and light chain variable region sequences of the analyzed DNP004 antibody are as follows (Tables 13 and 14). As shown in Table 13 below, the CDR sequences of the heavy chain variable region may be the same or partly different, but the CDR sequences of the light chain variable region may be different. The amino acids expressed in bold in SEQ ID NOs: 15, 16, 28, and 32 to 42 below are modified.

    TABLE-US-00016 TABLE13 SEQ SEQ SEQ Clone ID ID ID IDno.. CDR1 NO CDR2 NO CDR3 NO V.sub.H-chimeric GYSYTDYN 14 IDPANGDT 15 ARPIYYGAY 16 WYFDV V.sub.H-humanized GYSYTDYN 14 IDPANGDT 15 SRPIYYGAY 28 WYFDV V.sub.L-chimeric KSLLHSNG 17 RMS 18 MQHLEYPFT 19 NTY, V.sub.L-humanized ASSX.sub.1VTY 29 X.sub.2TSX.sub.3LX.sub.4X.sub.5 30 QQWSSNPLT 31 General formula #1-V.sub.L ASSPVTY 32 ATSSLAP 34 QQWSSNPLT 31 #2-V.sub.L ASSSVTY 33 ATSSLVS 35 QQWSSNPLT 31 #8-V.sub.L ASSSVTY 33 GTSRLVS 36 QQWSSNPLT 31 #11-V.sub.L ASSSVTY 33 ATSHLVS 37 QQWSSNPLT 31 #15-V.sub.L ASSSVTY 33 GTSQLVS 38 QQWSSNPLT 31 #19-V.sub.L ASSSVTY 33 RTSDLIS 39 QQWSSNPLT 31 #22-V.sub.L ASSSVTY 33 ATSELMS 40 QQWSSNPLT 31 #25-V.sub.L ASSSVTY 33 GTSMLAS 41 QQWSSNPLT 31 #26-V.sub.L ASSPVTY 32 ATSSLAS 42 QQWSSNPLT 31 #30-V.sub.L ASSSVTY 33 ATSSLVS 35 QQWSSNPLT 31

    TABLE-US-00017 TABLE14 Framework#1ofV.sub.H-humanized EVQLVESGGGLVQPGG 43 SLRLSCAAS Framework#2ofV.sub.H-humanized IYWVRQAPGKGLEWVG 44 Y Framework#3OfV.sub.H-humanized TYNQKFKGRATISVDK 45 SKNTAYLQMNSLRAED TAVYYC Framework#4ofV.sub.H-humanized WGQGTLVTVSS 46 Framework#1ofV.sub.L-humanized DIQMTQSPSSLSASVG 47 DRVTITCR Framework#3ofV.sub.L-humanized GVPSRFSGSGSGTDFT 51 LTISSLQPEDFATYYC Framework#4ofV.sub.L-humanized FGQGTKVEIK 52 Framework#2 General MHWYX.sub.6QKPGKAPX.sub.7PWIY 48 ofV.sub.L-humanized formula (X6= QorH; H7= RorK) #26-V.sub.L MHWYQQKPGKAPRPWIY 49 #30-V.sub.L MHWYHQKPGKAPKPWIY 50

    [0218] In Table 15 below, the heavy chain variable region sequence and light chain variable region sequence of the selected clones are shown, all the heavy chain variable regions are identical (SEQ ID NO: 53), but the light chain variable regions are different (SEQ ID NOS: 54 to 63). The underlined part of sequence corresponds to the CDR sequence.

    TABLE-US-00018 TABLE15 Clone SEQ IDno. Aminoacidsequence IDNO V.sub.H EVQLVESGGGLVQPGGSLRLSCAASGY 53 SYTDYNIYWVRQAPGKGLEWVGYIDPA NGDTTYNQKFKGRATISVDKSKNTAYL QMNSLRAEDTAVYYCSRPIYYGAYWYF DVWGQGTLVTVSS #1-V.sub.L DIQMTQSPSSLSASVGDRVTITCRASS 54 PVTYMHWYQQKPGKAPKPWIYATSSLA PGVPSRFSGSGSGTDFTLTISSLQPED FATYYCQQWSSNPLTFGQGTKVEIK #2-V.sub.L DIQMTQSPSSLSASVGDRVTITCRASS 55 SVTYMHWYQQKPGKAPKPWIYATSSLV SGVPSRFSGSGSGTDFTLTISSLQPED FATYYCQQWSSNPLTFGQGTKVEIK #8-V.sub.L DIQMTQSPSSLSASVGDRVTITCRASS 56 SVTYMHWYQQKPGKAPKPWIYGTSRLV SGVPSRFSGSGSGTDFTLTISSLQPED FATYYCQQWSSNPLTFGQGTKVEIK #11-V.sub.L DIQMTQSPSSLSASVGDRVTITCRASS 57 SVTYMHWYQQKPGKAPKPWIYATSHLV SGVPSRFSGSGSGTDFTLTISSLQPED FATYYCQQWSSNPLTFGQGTKVEIK #15-V.sub.L DIQMTQSPSSLSASVGDRVTITCRASS 58 SVTYMHWYQQKPGKAPKPWIYGTSQLV SGVPSRFSGSGSGTDFTLTISSLQPED FATYYCQQWSSNPLTFGQGTKVEIK #19-V.sub.L DIQMTQSPSSLSASVGDRVTITCRASS 59 SVTYMHWYQQKPGKAPKPWIYRTSDLI SGVPSRFSGSGSGTDFTLTISSLQPED FATYYCQQWSSNPLTFGQGTKVEIK #22-V.sub.L DIQMTQSPSSLSASVGDRVTITCRASS 60 SVTYMHWYQQKPGKAPKPWIYATSELM SGVPSRFSGSGSGTDFTLTISSLQPED FATYYCQQWSSNPLTFGQGTKVEIK #25-V.sub.L DIQMTQSPSSLSASVGDRVTITCRASS 61 SVTYMHWYQQKPGKAPKPWIYGTSMLA SGVPSRFSGSGSGTDFTLTISSLQPED FATYYCQQWSSNPLTFGQGTKVEIK #26-V.sub.L DIQMTQSPSSLSASVGDRVTITCRASS 62 PVTYMHWYQQKPGKAPRPWIYATSSLA SGVPSRFSGSGSGTDFTLTISSLQPED FATYYCQQWSSNPLTFGQGTKVEIK #30-V.sub.L DIQMTQSPSSLSASVGDRVTITCRASS 63 SVTYMHWYHQKPGKAPKPWIYATSSLV SGVPSRFSGSGSGTDFTLTISSLQPED FATYYCQQWSSNPLTFGQGTKVEIK

    15-2: Preparation of Humanized Antibody

    [0219] Based on the amino acid sequence of the prepared anti-CA-XII humanized antibody DNP004, a humanized antibody was prepared.

    [0220] For the expression of anti-CA-XII humanized antibodies, a plasmid for expression of heavy chain and a plasmid for light chain expression were respectively prepared. PcDNA3.4 (Invitrogen) vector was used as the heavy chain expression plasmid, and pOptiVEC (Invitrogen) vector was used as the light chain expression plasmid.

    [0221] In order to express the variable region coding cDNA and the constant region coding cDNA of each antibody as a continuous amino acid sequence without inserting additional amino acid, the coding sequence of the cloned variable region and the known human IgG1 constant region (heavy chain) and the kappa constant region (light chain) coding sequences were synthesized (Bioneer). The synthesized heavy chain genes and light chain genes were digested with restriction enzymes Xho I and Sal I, and the heavy chain gene fragment was ligated to the pcDNA3.4 vector and the light chain gene fragment was ligated to the pOptiVec vector to construct a complete antibody expression plasmid (pcDNA3.4-4B4 heavy chain expression plasmid and pOptiVEC-4B4 light chain expression plasmid).

    [0222] The prepared pcDNA3.4-4B4 heavy chain expression plasmid and the pOptiVEC-4B4 light chain expression plasmid were transfected into CHO cell-derived DG44 cells (Invitrogen) to perform transformation.

    [0223] Three days prior to transfection, DG44 cells in suspension were adapted to MEMa medium containing 5% FBS to convert them into adherent cells and to improve transfection efficiency. Transfection was performed on a 6-well plate using the ViaFect transfection regent (Promega, Cat. #: E4981). On the day before the transfection, DG44 cells adapted to the adhered state were prepared by sub-culturing at a concentration of 110.sup.5 cells/well. The amount of DNA used for transfection was determined by using 3 g of the pOptiVEC-4B4 light chain expression plasmid and 1 g of the pcDNA3.4-4B4 heavy chain expression plasmid at 3:1 mixing ratio. Transfection was carried out for 48 hours. Flow cytometry was used to analyze the transfected cell population.

    [0224] FIG. 25 shows the binding of the humanized antibody DNP004 in the CA-XII positive triple negative breast cancer cell line MDAMB-231.

    EXAMPLE 16: EVALUATION OF PHYSICAL PROPERTIES OF ANTIBODY CANDIDATE GROUP

    [0225] SDS-PAGE analysis, Size exclusion chromatography, Melting temperature, ANS reactivity, etc. were evaluated and compared in order to compare the expression and physical properties of humanized antibody variants.

    16-1: Antibody Candidate GroupAnalysis of Expression Level

    [0226] In order to confirm the expression level and the occurrence of precipitation by protein A purification, transient transfection was induced by introducing a combination vector of 8 mutants into HEK293F.

    [0227] 300 mL of each culture was injected into protein A (GE Healthcare, Cat. No. 11-0034-93) and purified using elution buffer (20 mM citric buffer, pH 3.0). The obtained antibody was dialyzed with phosphate buffered saline and quantified before and after dialysis to confirm the loss. The expression levels were very different in the range of 1.010.0 g/mL, and high expression rates were observed in variant number of 25 and 26 (Table 16).

    TABLE-US-00019 TABLE 16 The expression amount before dialysis (mg) The expression [expression amount amount after Clone Number per unit volume] dialysis (mg) Humanized antibody variant #1 0.6 [2.0 g/mL] 0.6 Humanized antibody variant #2 2.5 [8.33 g/mL] 2.5 Humanized antibody variant #8 1.5 [5.0 g/mL] 1.2 Humanized antibody variant #11 1.5 [5.0 g/mL] 1.3 Humanized antibody variant #15 0.3 [1.0 g/mL] 0.3 Humanized antibody variant #19 1.2 [4.0 g/mL] 1.0 Humanized antibody variant #22 0.5 [1.67 g/mL] 0.5 Humanized antibody variant #25 2.7 [9.0 g/mL] 2.7 Humanized antibody variant #26 3.0 [10.0 g/mL] 3.0 Humanized antibody variant #30 1.5 [5.0 g/mL] 1.5

    16-2: SDS-PAGE Analysis of Antibody Candidates

    [0228] SDS-PAGE analysis was performed to evaluate the completeness of heavy/light chain binding of the humanized antibody variants, unity of the heavy chain and light chain.

    [0229] In the non-reducing assay, 5 ng of the antibody was reduced, 10 ng of the antibody was mixed in 2Laemmli sample buffer (Bioread, Cat. No. 161-0737), boiled at 100 C. for 5 minutes and ini-PROTEAN TGX gel Bio-Rad, Cat No. 456-1083). Electrophoresis was carried out at 150 V for 1 hour and stained with SimplyBlue Safestain (Invitrogen, Cat No: LC6060) for 2 hours and desalted with distilled water. Among the eight humanized antibody variants, light chain staining was unclear for the clone #15 variants, but none of the other 7 variants were found to be abnormal (FIG. 26).

    [0230] FIG. 26 is a photograph showing the result of analyzing the physical properties of the candidate antibody group using SDS-PAGE. Among 15 variants of the humanized antibody variants, light chain staining was unclear for the clone #15 variants, but none in the other 7 variants (FIG. 26).

    16-3: SE-HPLC Analysis of Antibody Candidates

    [0231] Size exclusion-chromatography analysis was performed for purity evaluation.

    [0232] Each antibody was diluted with phosphate-buffered saline to prepare 1.0 mg/mL and injected 20 L into TSKgel G3000SWXL (TOSOH) equilibrated with equilibrium buffer (0.1 M sodium phosphate, 0.1 M sodium chloride pH 7.0). The equilibrium buffer was flowed at a flow rate of 0.5 mL/min for 40 minutes, and the eluted protein was detected at a wavelength of 280 nm. The detected peaks were integrated by automatic analysis to calculate the area for each peak, and the area ratio of the main peak was described as a percentage.

    [0233] The major peak area ratio of most variants was 95% or more than of purity, but variants #11 and #26 were 94.3% and 94.1%, respectively, which are somewhat lower (Table 17).

    TABLE-US-00020 TABLE 17 Retention Main peak Clone number time(min) Area ratio (%) The chimeric antibody (4B4) 15.99 98.3402 Humanized antibody variant # 1 16.366 95.325 Humanized antibody variant # 2 16.326 95.0894 Humanized antibody variant # 8 16.332 95.1814 Humanized antibody variant # 11 16.409 94.3005 Humanized antibody variant # 15 16.307 96.8589 Humanized antibody variant # 19 16.263 97.4621 Humanized antibody variant # 22 16.158 96.7872 Humanized antibody variant # 25 16.329 95.3279 Humanized antibody variant # 26 16.361 94.1417 Humanized antibody variant # 30 16.326 95.735

    16-4: Antibody Candidate GroupMelting Temperature (Tm) Analysis

    [0234] For comparative evaluation of the robustness, the Melting temperature of humanized antibody variants was measured.

    [0235] Protein thermal shift dye and buffer (Invitrogen, Cat. No. 4462263) were added to 0.44 g of antibody variant according to the manufacturer's manual to prepare 20 L of the mixed solution, which was injected into Real time PCR equipped with Protein Thermal Shift Software v1.0. Fluorescence values detected by binding between the protein thermal shift dye and the antibody were detected while increasing the temperature continuously from 25 C. to 95 C. at a rate of 0.05 C./sec. After completion of the test, the Boltzmann fitting was implemented with ViiA 7 Software and the melting temperature (Tm) for each antibody was calculated. For mutant 8, Tm was the most robust antibody at 71.41 C. In order to confirm the correlation between Tm and purity, each mutant was allowed to stand at 62 C. for 3 hours at high temperature and then subjected to size exclusion chromatography analysis to calculate the area ratio of the main peak.

    [0236] The variant 8 showed the highest peak-to-peak ratio at the high temperature of 62 C. and was the most robust variant with the same Tm analysis (Table 18).

    TABLE-US-00021 TABLE 18 Melting Main peak temperature Area ratio Clone number ( C.) (%) Humanized antibody variant # 2 69.96 89.534 Humanized antibody variant # 8 71.41 94.684 Humanized antibody variant # 19 66.93 83.662 Humanized antibody variant # 22 68.59 NA Humanized antibody variant # 30 70.01 88.852

    16-5: Evaluation of the Binding Strength of CA XII Positive Cell Line

    [0237] MDAMB231 breast cancer cell line expressing CA XII antigen was cultured in RPMI 1640 (GIBCO, Invitrogen) supplemented with 10% heat inactivated FBS, desorbed with trypsine-EDTA (Invitrogen), washed with phosphate buffered saline, and poured to tube at an amount of 210.sup.6 cells/tube.

    [0238] Humanized antibody variants were added to each tube to a concentration of 1.0 g/mL and reacted for 30 min at refrigeration. FITC-labeled secondary antibody Goat anti-Mouse IgG (HL)-FITC (DINONA INC, Korea) was added and the cells were reacted for 20 minutes in the refrigerator. The cells were centrifuged once more with phosphate-buffered saline, the cells were suspended in phosphate-buffered saline containing 1% formaldehyde, and the fluorescence was analyzed with a flow cytometer (Stratedigm, S1000EXi).

    [0239] The binding strength of the mutants based on the Mean Fluorescence Intensity (MFI) of the 4B4 chimeric antibody bound to the MDAMB231 cell line is shown in FIG. 28 as a percentage. All variants showed a relative binding strength of 90% or more, and variants 8, 11, 15, and 26 showed 99% of relative binding strength, which there is no little difference from the chimeric antibody (HG. 27).

    EXAMPLE 17 ANALYSIS OF HUMANIZED ANTIBODY EXPRESSION IN VARIOUS CELL LINES

    17-1: Antibody Expression in Various Cell Lines

    [0240] The binding of humanized antibody (DNP004) in various cancer cell lines obtained from KCLB (Korean Cell Line Bank) and SNU (Seoul National University) was confirmed by flow cytometry. LNCap, MCF-7, Huh? and Hs-578T were cultured in Dulbecco's MEM (GIBCO, Invitrogen) supplemented with 10% heat-inactivated fetal bovine serum (FBS; GIBCO, Invitrogen) and A549, NCI-H460, DLD-1, HT-29, LS174T, PC-3, SNU638, SNU719, MKN45, NCI-H87, SK-BR3, MDA-MB231, MDA-MB453 were cultured in RPMI 1640 (GIBCO, Invitrogen) medium supplemented with 10% heat-inactivated FBS at 37 C. in a 5% CO2 incubator. In addition, Hep3B.1-7 and PLC/PRF/5 were cultured in Eagle's MEM (GIBCO, Invitrogen) medium supplemented with 10% heat inactivated fetal bovine serum (FBS; GIBCO, Invitrogen) and KATO III was were cultured in IMDM (GIBCO, Invitrogen) medium supplemented with 20% heat inactivated fetal bovine serum (GIBCO, Invitrogen) at 37 C. in a 5% CO2 incubator.

    [0241] After incubation with DNP004 at 4 C. for 30 minutes, the cancer cells were washed with PBS, and FITC-conjugated goat anti-Hama IgG (DINONA INC, Korea) was added to the cultured cancer cells. Min. After washing with PBS, the cells were analyzed with FACS caliber (Becton Dickinson, USA) and the results are shown below (Table 19). Table 19 below shows the expression patterns of the carbonic anhydrase 12 antigen in various solid cancer cell lines. In Table 19, the percentage of DNP004-positive cells was analyzed by FACS analysis. The number of cells that bind to DNP004 antibody among the 5000 cells to be tested was calculated as %; refers to less than 10% of the number of positive cells, + refers to 10 to 30% of the number of positive cells, ++ refers to 30 to 70% of the number of positive cells, and +++ refers to 70 to 100% of the number of positive cell.

    TABLE-US-00022 TABLE 19 Origin Cell line 4B4 chimeric DNP004 Lung A549 TA +++ +++ NCl-H460 ++ ++ Colon DLD-1 + HT-29 + +++ LS174T +++ +++ Stomach SNU 638 + SNU719 ++ ++ KATO III +++ MKN 45 +++ +++ Liver Huh-7 ++ +++ Hep3B.1-7 + + PLC/PRF/5 +++ +++ Prostate LNCap + Kidney 786-O +++ +++ Breast MCF-7 + ++ SK-BR3 +++ ++ MDAMB231 +++ +++ MDAMB453 ++ +++ Hs-578T ++ PBMC Lymphocyte Monocyte Granulocyte

    [0242] As shown in Table 19, even though the cells having the same origin have different tissue sources used in the cell line construction, the degree of positive reaction may vary depending on the type of the cells. However, the humanized antibody DNP004 of the present invention showed the positive reaction to a variety of types of adenocarcinoma of the lung, colon cancer, stomach cancer, liver cancer, and breast cancer cell line, even though the degree of positive reaction is somewhat different, but showed negative reaction in prostate cancer. On the other hand, peripheral blood lymphocytes, mononuclear cells and granulocytes were found to be negative. These results indicate that the humanized antibody DNP004 of the present invention can be used as a therapeutic agent for indications of solid tumors exhibiting a positive reaction.

    17-2: Expression Patterns in Various Types of Breast Cancer Cells

    [0243] DNP004 antibody is positive in both ER and PR as well as in HER2 ER2 positive breast cancer cells. Thus, the antibody of present invention can be used for the triple negative breast cancer, as well as various types of breast cancer treatment. The binding of DNP004 humanized antibodies in three different phenotypic breast cancer cell lines was confirmed by flow cytometry and the differences in the degree of binding with chimeric 4B4 were compared.

    [0244] Specifically, MDAMB-231 and MDAMB453, MCF-7 and SK-BR-3 cell lines were cultured in the same manner as in Example 5-2. DNP004 humanized antibody was added to each cultured cancer cell lines. The cells were incubated at 4 C. for 30 minutes, washed with PBS, and incubated at 4 C. for 15 minutes with FITC-conjugated goat anti-Human IgG (DINONA INC, Korea). The cells were washed again with PBS and analyzed with FACS caliber (Becton Dickinson, USA), and the results are shown in FIGS. 28 and 29.

    [0245] FIGS. 28 and 29 show the results of binding tests of DNP004 humanized antibodies against the carbonic anhydrase 12 antigen in various types of breast cancer cells. Therefore, the DNP004 humanized antibody according to the present invention can be used not only for triple negative breast cancer but also for various types of breast cancers, since it is positive in both ER and PR as well as HER2-positive breast cancer cells.

    EXAMPLE 18: THERAPEUTIC EFFECT (ADCC) OF HUMANIZED ANTIBODIES AGAINST VARIOUS SOLID TUMORS

    [0246] Antibody-dependent cytotoxicity (ADCC) was evaluated by Luciferase assay in various solid tumors. MDAMB-231 and MDAMB-453, MCF7, SK-BR3, lung cancer cell line A549, liver cancer cell line Huh7 and HEP3B, and gastric cancer cell lines KATO III, SNU719 and MKN-45 were inoculated at 1.2510.sup.4 cells/well, and incubated at 37 C. in a CO2 incubator for 20-24 hours. After removing the culture medium from each well, 25 l of RPMI containing 4% low IgG FBS are added to the plated wells. DNP004 humanized antibody of Example 15 was diluted with RPMI containing 4% low IgG FBS, at 3-fold to range from a maximum concentration of 10 g/ml to 1.2 ng/ml. Each prepared antibody sample was added to the corresponding wells at the respective concentrations, and the lid of the plate was closed and kept in a clean bench. The cultured ADCC reporter cell (ADCC Reporter Bi 5 assay, Promega) was harvested and suspended in RPMI containing 4% of low IgG FBS at 310.sup.6 cells/ml. 25 l of ADCC reporter cell suspension was added to each well and cultured in at 37 C. in CO.sub.2 incubator for 24 hours.

    [0247] The luciferase substrate, which has been frozen in advance, was prepared by melting it in a hot water bath. The plate was left for 15 minutes at room temperature. After adding 75 l of luciferase substrate to each well, the reaction was occurred for 30 minutes in a dark room and the luminous intensity was measured using a luminometer.

    [0248] FIG. 30 shows the result of antibody-dependent cytotoxic effect of DNP004 humanized antibody in breast cancer cell line, FIG. 31 shows the result of antibody-dependent cytotoxic effect of DNP004 humanized antibody in lung cancer cell line A549, FIG. 32 shows DNP004 humanized antibody-dependent cytotoxic effect in Huh7 and HEP3B, and FIG. 33 shows the results of confirming antibody-dependent cytotoxic effect of DNP004 humanized antibody in gastric cancer cell lines KATO III, SNU719 and MKN-45.

    [0249] Thus, the DNP004 humanized antibody of the present invention was proven to have a cell apoptotic mechanism by antibody-dependent cytotoxic effect in various types of solid cancer cells expressing antigen of DNP004 (CA XII, Carbonic anhydrase XII).

    EXAMPLE 19 EVALUATION OF THERAPEUTIC EFFECT OF HUMANIZED ANTIBODY USING MOUSE EXPERIMENTAL MODEL

    19-1: Breast Cancer Animal Model/Antibody-Administered Group with Single Concentration

    [0250] Human breast cancer animal models were established with the MDA-MB-453 cell line of a triple negative breast cancer cell line. First, 1.510.sup.7 cells of MDA-MB-453 were subcutaneously inoculated into the right flank of the mouse, tumor formation and growth were observed, and the tumor size was calculated by the following equation.


    (Volume=(ab)/2, a is a short diameter, and b is a long diameter)

    [0251] When the tumor size reached 100 mm.sup.320, mice were randomly divided into a control group (5 rats) and a treatment group (5 rats), and a DNP004 humanized antibody was administered to mouse tail vein at a dose of 10 mg/kg. Then, the tumors were measured twice a week at intervals of 3-4 days during the experiment period, and tumor growth curves were taken from the start of antibody administration to the end of the experiment, and the average values of the results are shown in FIG. 34a. Thus, the group treated with humanized antibody showed the inhibitory effect on the most of tumor growth (FIG. 34).

    19-2: Breast Cancer Animal Model/Antibody-Administered Group with Multiple Concentrations

    [0252] Experiments were conducted to administer DNP004 humanized antibody at various concentrations using the same breast cancer animal model as in Example 19-1.

    [0253] Specifically, the mice were divided into four groups (4 mg/kg, 8 mg/kg, 16 mg/kg and 32 mg/kg) in which 5 mice were allocated to each group. The antibody-treated group with 16 mg/kg dose showed partial tumor suppression and did not show any tumor suppression effect in a dose-depending manner, but the result of the complete remission, in which tumor growth was completely inhibited, had a tendency to increase, as the concentrations were increases (FIG. 35, Table 20).

    TABLE-US-00023 TABLE 20 MDAMB453(Triple negative breast cancer) Xenograft model Dose groups of administered DNP004 mouse# Mass size(mm.sup.3) 1 (Control) 191 333 211 429 190 91 197 211 198 143 2 (4 mg/kg of DNP004) 236 161 210 155 227 53 192 0 (complete remission) 215 0 3 (8 mg/kg of DNP004) 201 213 214 182 189 0 (complete remission) 196 0 (complete remission) 228 0 (complete remission) 4 (16 mg/kg DNP004) 224 333 217 486 195 0 (complete remission) 206 135 205 0 (complete remission) 5 (32 mg/kg of DNP004) 222 0 (complete remission) 234 175 209 0 (complete remission) 200 0 (complete remission) 188 0 (complete remission)

    19-3: Kidney Cancer Animal Model/Antibody-Administered Group with Single Concentration

    [0254] 786-O cells which are renal cell cancer cell line highly expressing the target antigen (CA-XII) of the humanized antibody (DNP004), were used to confirm mouse animal models and antitumor effects (FIG. 36).

    [0255] Specifically, nude mice were subcutaneously injected with a 786-O cell line of 1.510.sup.7 cells. However, tumor formation was very late in this experimental set, unlike in the breast cancer cell line, and tumor formation was confirmed after about 70 days. DNP004 humanized antibody was administered in a mouse tail vein at a dose of 32 mg/kg to the treatment groups in which the tumor formation was confirmed. The tumors were measured twice a week at 3-4 day intervals during the experiment. The tumor growth curves were obtained from the beginning of the antibody administration to the end of the experiment, and the average tumor growth curve of 8 mice in DNP004 humanized antibody-administered group, compared to 3 mice of control group was obtained and shown in FIG. 36.

    [0256] Therefore, the anti-cancer effect of DNP004 humanized antibody was confirmed in not only breast cancer but also kidney cancer.