ENDOTOXIN FREE ASPARAGINASE

20190275121 ยท 2019-09-12

    Inventors

    Cpc classification

    International classification

    Abstract

    Disclosed herein is an endotoxin-free asparaginase enzyme. Also disclosed are methods of using the disclosed enzyme to treat subjects with a disease treatable by depletion of asparagine. For example, the disclosed endotoxin-free asparaginase enzyme is useful in the treatment or the manufacture of a medicament for use in the treatment of acute lymphoblastic leukemia (ALL) in both adults and children, as well as other conditions where asparagine depletion is expected to have a useful effect.

    Claims

    1. A method for treating a subject with a disease treatable by L-asparagine depletion, comprising administering to the subject a composition comprising an endotoxin-free asparaginase comprising: (a) a heteropolymer of a polypeptide having an amino acid sequence with at least 80% sequence identity to SEQ ID NO:2 and a polypeptide having an amino acid sequence with at least 80% sequence identity to SEQ ID NO:4; (b) a heteropolymer of a polypeptide having an amino acid sequence with at least 80% sequence identity to SEQ ID NO:6 and a polypeptide having an amino acid sequence with at least 80% sequence identity to SEQ ID NO:8; (c) a polypeptide having an amino acid sequence with at least 80% sequence identity to SEQ ID NO:10; or (d) any combination of (a), (b), or (c).

    2. The method of claim 1, wherein the asparaginase is a recombinant asparaginase.

    3. The method of claim 1, wherein the asparaginase comprises a heteropolymer of the polypeptide having the amino acid sequence SEQ ID NO:2 and the polypeptide having the amino acid sequence SEQ ID NO:4.

    4. The method of claim 1, wherein the asparaginase comprises a heteropolymer of the polypeptide having the amino acid sequence SEQ ID NO:6 and the polypeptide having the amino acid sequence SEQ ID NO:8.

    5. The method of claim 1, wherein the asparaginase comprises a polypeptide having the amino acid sequence SEQ ID NO:10.

    6. The method of claim 1, wherein the asparaginase is isolated from Rhodococcus rhodochrous DAP 96253 cells.

    7. The method of claim 6, wherein the cells have been induced to produce the asparaginase using an inducing agent selected from the group consisting of urea, methyl carbamate, methacrylamide, acetamide, cobalt, asparagine or asparagine derivative, and combinations thereof.

    8. The method of claim 1, wherein the asparaginase is conjugated to a polyethylene glycol (PEG).

    9. The method of claim 1, wherein the disease treatable by L-asparagine depletion is a cancer.

    10. The method of claim 9, wherein the disease is selected from the group consisting of Acute Lymphoblastic Leukemia (ALL), non-Hodgkin's lymphoma, NK lymphoma, and pancreatic cancer.

    11. The method of claim 10, wherein the disease is juvenile or adult ALL.

    12. The method of claim 10, wherein the subject has had a previous hypersensitivity to an E. coli L-aspariginase or Erwinia L-asparaginase.

    13. The method of claim 1, wherein the endotoxin-free asparaginase is administered in a dose that depletes L-asparagine in the subject to undetectable levels for a period of at least 3 days to 10 days.

    14. A method for catalyzing the hydrolysis of asparagine in a sample, comprising contacting the sample with a composition comprising an endotoxin-free asparaginase comprising: (a) a heteropolymer of a polypeptide having an amino acid sequence with at least 80% sequence identity to SEQ ID NO:2 and a polypeptide having an amino acid sequence with at least 80% sequence identity to SEQ ID NO:4; (b) a heteropolymer of a polypeptide having an amino acid sequence with at least 80% sequence identity to SEQ ID NO:6 and a polypeptide having an amino acid sequence with at least 80% sequence identity to SEQ ID NO:8; (c) a polypeptide having an amino acid sequence with at least 80% sequence identity to SEQ ID NO:10; or (d) any combination of (a), (b), or (c).

    15. The method of claim 14, wherein the asparaginase is a recombinant asparaginase.

    16. The method of claim 14, wherein the asparaginase comprises a heterodimer the polypeptide having the amino acid sequence SEQ ID NO:2 and the polypeptide having the amino acid sequence SEQ ID NO:4.

    17. The method of claim 14, wherein the asparaginase comprises a heterodimer the polypeptide having the amino acid sequence SEQ ID NO:6 and the polypeptide having the amino acid sequence SEQ ID NO:8.

    18. The method of claim 14, wherein the asparaginase comprises a polypeptide having the amino acid sequence SEQ ID NO:10.

    19. The method of claim 14, wherein the asparaginase is isolated from Rhodococcus rhodochrous DAP 96253 cells.

    20. The method of claim 19, wherein the cells have been induced to produce the asparaginase using an inducing agent selected from the group consisting of urea, methyl carbamate, methacrylamide, acetamide, cobalt, asparagine or asparagine derivative, and combinations thereof,

    21. The method of claim 14, wherein the asparaginase is conjugated to a polyethylene glycol (PEG).

    Description

    DESCRIPTION OF DRAWINGS

    [0019] FIG. 1 is a sequence alignment of 1) cobalt-containing low-mass nitrile hydratase subunit-alpha and -beta from R. rhodochrous DAP 96253 (SEQ ID NO:13), 2) cobalt-containing high-mass nitrile hydratase subunit-alpha and -beta from R. rhodochrous DAP 96253 (SEQ ID NO:14), 3) Elspar asparaginase (SEQ ID NO:15), 4) asparaginase aminohydralase E. chrysanthemi (SEQ ID NO:16), and 5) classic L-asparaginase from R. rhodochrous DAP 96253 (SEQ ID NO:17). Also shown is a consensus sequence (SEQ ID NO:18).

    [0020] FIG. 2 is a table comparing 1) cobalt-containing low-mass nitrile hydratase subunit alpha and beta from R. rhodochrous DAP 96253, 2) cobalt-containing high-mass nitrile hydratase subunit alpha and beta from R. rhodochrous DAP 96253, 3) Elspar asparaginase, 4) asparaginase aminohydralase E. chrysanthemi, and 5) classic L-asparaginase from R. rhodochrous DAP 96253. Upper comparison is the percentage of identical residues in alignment positions to overlapping alignment positions between the two sequences. Lower comparison is the number of alignment positions where one sequence is different from the other. This includes gap differences as in the Gaps comparison.

    [0021] FIG. 3 is a sequence alignment of 1) R. rhodochrous J1 nitrile hydratase alpha (SEQ ID NO:19) and 2) cobalt-containing nitrile hydratase subunit alpha from R. rhodochrous DAP 96253 (SEQ ID NO:20). Also shown is a consensus sequence (SEQ ID NO:21).

    [0022] FIG. 4 is a sequence alignment of 1) R. rhodochrous J1 nitrile hydratase beta (SEQ ID NO:22) and 2) cobalt-containing nitrile hydratase subunit beta from R. rhodochrous DAP 96253 (SEQ ID NO:23). Also shown is a consensus sequence (SEQ ID NO:24).

    [0023] FIG. 5 is a graph showing dose/time response (1, 2, 4, or 8) of JURKAT (leukemia cells) to purified asparaginase from R. rhodochrous DAP 96253 (% JURKAT cells surviving).

    DETAILED DESCRIPTION

    [0024] As used herein, the singular forms a, an, the, include plural referents unless the context clearly dictates otherwise.

    [0025] Throughout the specification the word comprising, or grammatical variations thereof, will be understood to imply the inclusion of a stated element, integer or step, or group of elements, integers or steps, but not the exclusion of any other element, integer or step, or group of elements, integers or steps.

    [0026] The disclosed compositions, apparatuses, and methods arise from the discovery that induced cells of Rhodococcus rhodochrous DAP 96253 have significant levels of an asparaginase enzyme (NHase-Asparaginase) that is substantially different from enteric asparaginase, and contains no endotoxin.

    [0027] Asparaginase is well documented in Gram-negative bacteria, and especially in Escherichia coli and in Erwinia spp. Sequencing of the - and -subunits of the disclosed endotoxin-free asparaginase enzymes show that the sequence of these subunits are unlike the sequence(s) seen in asparaginase obtained from other bacteria (including both Gram-negative, Gram-positive). Thus the primary structures of the disclosed endotoxin-free asparaginase enzymes are unique.

    [0028] In both E. coli and in Erwinia, active asparaginase is a homo-dimer (where two intimate homo-dimers become intimately associated). In contrast, the high-mass NHase-asparaginase can be composed of at least 8 -subunits and at least 8 -subunits (i.e., at least a 16 mer). In the high-mass NHase-asparaginase, the - and -subunits are essentially in parity (i.e., 1:1 ratio). Furthermore this enzyme contains non-corrin-Cobalt at the active site. Thus, the secondary, tertiary and quaternary structure of the classic asparaginase seen in Gram-negative bacteria are very much different than the disclosed high-mass NHase-asparaginase.

    [0029] During induction of R. rhodochrous DAP 96253 during fermentation, the high levels of NHase (>150 units/mg-cell dry weight, typically 200-600 units) also show higher levels of asparaginase (20-30 units/mg-cell dry weight) than the levels of asparaginase activity reported in E. coli or Erwinia. When it is considered that it is possible to obtain greater than 50 grams of cells per liter, which is considerably higher than that seen in E. coli or Erwinia, the amount of asparaginase activity produced per liter is order of magnitudes higher for the disclosed endotoxin-free asparaginase enyzmes.

    [0030] The disclosed endotoxin-free asparaginase enzymes can be used in any indication for which prior asparaginase enzymes were being used. For example, asparaginase from Gram-negative sources has been suggested for use in reducing acrylamide in food preparations. As asparaginase obtained from Gram-negative bacteria will contain endotoxin, the use of these asparaginase enzymes in food is problematic. The disclosed endotoxin-free asparaginase enzymes do not contain endotoxin and therefore can be used safely to reduce acrylamide in prepared foods.

    [0031] Asparaginase Sources

    [0032] In some embodiments, the disclosed endotoxin-free asparaginase enzymes are isolated from a Rhodococcus spp. bacteria, such as, for example, Rhodococcus rhodochrous DAP 96253 strain, Rhodococcus rhodochrous DAP 96622 strain, or combinations thereof.

    [0033] In certain embodiments, the bacteria is induced to express the disclosed endotoxin-free asparaginase enzymes by exposure or treatment with a suitable inducing agent. Inducing agents include, but are not limited to urea, methyl carbamate, cobalt, asparagine, glutamine, and combinations thereof. Optionally, the one or more bacteria are exposed to or treated with urea, methyl carbamate, methacrylamide, or acetamide.

    [0034] The inducing agent, when used, can be added at any time during cultivation of the desired cells. For example, with respect to bacteria, the culture medium can be supplemented with an inducing agent prior to beginning cultivation of the bacteria. Alternately, the bacteria could be cultivated on a medium for a predetermined amount of time to grow the bacteria and the inducing agent could be added at one or more predetermined times to induce endotoxin-free asparaginase enzymes in the bacteria. Moreover, the inducing agent could be added to the growth medium (or to a separate mixture including the previously grown bacteria) to induce endotoxin-free asparaginase enzymes in the bacteria after the growth of the bacteria is completed or during a second growth or maintenance phase.

    [0035] The methods of inducing an enzymatic activity can be accomplished without the requirement of introducing hazardous nitriles, such as acrylonitrile, into the environment. Previously, it was believed that induction of specific enzyme activity in certain microorganisms required the addition of chemical inducers. For example, in the induction of nitrile hydratase activity in Rhodococcus rhodochrous and Pseudomonas chloroaphis, it was generally believed to be necessary to supplement with hazardous chemicals, such as acetonitrile, acrylonitrile, acrylamide, and the like. However, enzymatic activity in nitrile hydratase producing microorganisms can be induced with the use of non-hazardous media additives, such as amide containing amino acids and derivates thereof, and optionally stabilized with trehalose. Optionally, asparagine, glutamine, or combinations thereof, can be used as inducers. Methods of inducing and stabilizing enzymatic activity in microorganisms are described in U.S. Pat. Nos. 7,531,343 and 7,531,344, which are incorporated herein by reference.

    [0036] The disclosed methods of inducing enzymatic activity provide for the production and stability of endotoxin-free asparaginase enzymes using modified media, immobilization, and stabilization techniques, as described herein. For example, enzymatic activity can be induced and stabilized through use of media comprising amide-containing amino acids, or derivatives thereof, and, optionally stabilized by, trehalose. In some embodiments, the methods of induction and stabilization comprise culturing a nitrile hydratase producing microorganism in a medium comprising one or more amide containing amino acids or derivatives thereof, and, optionally, trehalose. Optionally, disclosed are methods for inducing nitrile-hydratase using a medium supplemented with amide containing amino acids or derivatives thereof, which preferably include asparagine, glutamine or a combination thereof. Optionally, disclosed are methods for inducing nitrile-hydratase using a nutritionally complete medium supplemented with only asparagine. Optionally, disclosed are methods for inducing nitrile-hydratase using a nutritionally complete medium supplemented with only glutamine. Optionally, disclosed are methods for stabilizing endotoxin-free asparaginase enzymes using a nutritionally complete medium supplemented with only trehalose. More particularly, the methods of induction and stabilization comprise culturing the microorganism in the medium and optionally collecting the cultured microorganisms or enzymes produced by the microorganisms.

    [0037] Induction and stabilization of enzymes can be achieved without the use of hazardous nitriles. However, while the induction methods eliminate the need for hazardous chemicals for enzyme activity induction, the use of such further inducers is not excluded. For example, one or more nitriles could be used to assist in specific activity development. Media supplemented with succinonitrile and cobalt can be useful for induction of endotoxin-free asparaginase enzymes. However, the use of nitriles is not necessary for induction of enzyme activity. While the use of nitriles and other hazardous chemicals is certainly not preferred, optionally, such use is possible.

    [0038] In some embodiments, the endotoxin-free asparaginase enzyme is a recombinant protein. Optionally, host cells that have been genetically engineered to express an endotoxin-free asparaginase enzymes can be produced. Specifically, a polynucleotide that encodes endotoxin-free asparaginase enzymes may be introduced by standard molecular biology techniques into a host cell to produce a transgenic cell that expresses the endotoxin-free asparaginase enzymes. The use of the terms polynucleotide, polynucleotide construct, nucleotide, or nucleotide construct is not intended to limit to polynucleotides or nucleotides comprising DNA. Those of ordinary skill in the art will recognize that polynucleotides and nucleotides can comprise ribonucleotides and combinations of ribonucleotides and deoxyribonucleotides. Such deoxyribonucleotides and ribonucleotides include both naturally occurring molecules and synthetic analogues. The polynucleotides described herein encompass all forms of sequences including, but not limited to, single-stranded forms, double-stranded forms, and the like.

    [0039] Low Mass NHase genes and are located in one cassette together and are directly next to each other.

    [0040] DNA Sequence of Cobalt Containing Low Mass, Nitrile Hydratase Subunit Alpha (EC 4.2.1.84) [Gene nhlA] in R. rhodochrous DAP 96253.

    TABLE-US-00001 (SEQIDNO:1) ATGACCGCCCATAATCCCGTCCAGGGCACGTTGCCACGATCGAACGAG GAGATCGCCGCACGCGTGAAGGCCATGGAGGCCATCCTCGTCGACAAGGG CCTGATCTCCACCGACGCCATCGACCACATGTCCTCGGTCTACGAGAACG AGGTCGGTCCTCAACTCGGCGCCAAGATCGTCGCCCGCGCCTGGGTCGAT CCCGAGTTCAAGCAGCGCCTGCTCACCGACGCCACCGGCGCCTGCCGTGA AATGGGCGTCGGCGGCATGCAGGGCGAAGAAATGGTCGTGCTGGAAAACA CCGACACGGTCCACAACATGGTCGTATGTACCTTGTGCTCGTGCTATCCG TGGCCGGTTCTCGGCCTGCCACCCAACTGGTACAAGTACCCCGCCTACCG CGCCCGCGCTGTCCGCGACCCCCGAGGTGTGCTGGCCGAATTCGGATATA CCCCCGACCCTGACGTCGAGATCCGGATATGGGACTCGAGTGCCGAACTT CGCTACTGGGTCCTGCCGCAACGCCCAACCGGCACCGAGAACTTCACCGA AGAACAACTCGCCGACCTCGTCACCCGCGACTCGCTCATCGGCGTATCCG TCCCCACCACACCTAGCAAGGCCTGA.

    [0041] Amino Acid Sequence of Cobalt Containing Low Mass, Nitrile Hydratase Subunit Alpha (EC 4.2.1.84) [Encoded by Gene nhlA] in R. rhodochrous DAP 96253.

    TABLE-US-00002 (SEQIDNO:2) MTAHNPVQGTLPRSNEEIAARVKAMEAILVDKGLISTDAIDHMSSVYENE VGPQLGAKIVARAWVDPEFKQRLLTDATGACREMGVGGMQGEEMVVLENT DTVHNMVVCTLCSCYPWPVLGLPPNWYKYPAYRARAVRDPRGVLAEFGYT PDPDVEIRIWDSSAELRYWVLPQRPTGTENFTEEQLADLVTRDSLIGVSV PTTPSKA.

    [0042] DNA Sequence of Cobalt Containing Low Mass, Nitrile Hydratase Subunit Beta (EC 4.2.1.84) [Gene nhlB] in R. rhodochrous DAP 96253.

    TABLE-US-00003 (SEQIDNO:3) ATGGATGGAATCCACGACCTCGGTGGCCGCGCCGGCCTGGGTCCGATC AAGCCCGAATCCGATGAACCTGTTTTCCATTCCGATTGGGAGCGGTCGGT TTTGACGATGTTCCCGGCGATGGCCCTGGCCGGCGCGTTCAATCTCGACC AGTTCCGGGGCGCGATGGAGCAGATCCCCCCGCACGACTACCTGACCTCG CAATACTACGAGCACTGGATGCACGCGATGATCCACCACGGCATCGAGGC GGGCATCTTCGATTCCGACGAACTCGACCGCCGCACCCAGTACTACATGG ACCATCCGGACGAAACGACCCCCACGCGGCAGGATCCGCAACTGGTGGAG ACGATCTCGCAACTGATCACCCACGGAGCCGATTACCGACGCCCGACCGA CACCGAGGCCGCATTCGCCGTAGGCGACAAAGTCATCGTGCGGTCGGACG CCTCACCGAACACCCACACCCGCCGCGCCGGGTACGTCCGCGGTCGTGTC GGCGAAGTCGTGGCGACCCACGGCGCGTATGTCTTTCCGGACACCAACGC ACTCGGCGCCGGCGAAAGCCCCGAACACCTGTACACCGTGCGGTTCTCGG CGACCGAGTTGTGGGGTGAACCTGCCGCCCCGAACGTCGTCAATCACATC GACGTGTTCGAACCGTATCTGCTACCGGCCTGA.

    [0043] Amino Sequence of Cobalt Containing Low Mass, Nitrile Hydratase Subunit Beta (EC 4.2.1.84) [Encoded by Gene nhlB] in R. rhodochrous DAP 96253.

    TABLE-US-00004 (SEQIDNO:4) MDCIHDLGGRAGLGPIKPESDEPVFHSDWERSVLTMFPAMALAGAFNLDQ FRGAMEQIPPHDYLTSQYYEHWMHAMIHHGIEAGIFDSDELDRRTQYYMD HPDETTPTRQDPQLVETISQLITHGADYRRPTDTEAAFAVGDKVIVRSDA SPNTHTRRAGYVRGRVGEVVATHGAYVFPDTNALGAGESPEHLYTVRFSA TELWGEPAAPNVVNHIDVFEPYLLPA.

    [0044] High Mass NHase genes and are located in a cassette together directly next to each other. That the location of these two NHases are contiguous (i.e., beta and alpha subunits are nest to each other).

    [0045] DNA Sequence of Cobalt Containing High-Mass, Nitrile Hydratase Subunit Alpha (EC 4.2.1.84) [Gene nhhA] in R. rhodochrous DAP 96253.

    TABLE-US-00005 (SEQIDNO:5) GTGAGCGAGCACGTCAATAAGTACACGGAGTACGAGGCACGTACCAAG GCAATCGAAACCTTGCTGTACGAGCGAGGGCTCATCACGCCCGCCGCGGT CGACCGAGTCGTTTCGTACTACGAGAACGAGATCGGCCCGATGGGCGGTG CCAAGGTCGTGGCCAAGTCCTGGGTGGACCCTGAGTACCGCAAGTGGCTC GAAGAAGACGCGACGGCCGCGATGGCGTCATTGGGCTATGCCGGCGAGCA GGCACACCAGATCTCGGCCGTCTTCAACGACTCCCAAACACATCACGTAG TGGTGTGCACTCTGTGTTCGTGCTATCCGTGGCCGGTGCTTGGCCTCCCG CCCGCCTGGTACAAGAGCATGGAGTACCGGTCCCGAGTGGTAGCAGACCC TCGTGGAGTACTCAAGCGCGATTTCGGGTTCGACATCCCCGATGAGGTGG AGGTCAGGGTTTGGGACAGCAGCTCCGAAATCCGCTACATCGTCATCCCG GAACGGCCGGCCGGCACCGACGGTTGGTCCGAGGACGAGCTGGCGAAGCT GGTGAGTCGGGACTCGATGATCGGTGTCAGTAATGCGCTCACACCGCAGG AAGTGATCGTATGA.

    [0046] Amino Acid Sequence of Cobalt Containing High-Mass, Nitrile Hydratase Subunit Alpha (EC 4.2.1.84) [Encoded by Gene nhhA] in R. rhodochrous DAP 96253.

    TABLE-US-00006 (SEQIDNO:6) VSEHVWVVWDPEYRKWLEEDATAAMASLGYAGEQAHQISAVFNDSQTHHV VVCTLCSCYPWPVLGLPPAWYKSMEYRSRVVADPRGVLKRDFGFDIPDEV EVRVWDSSSEIRYIVIPERPAGTDGWSEDELAKLVSRDSMIGVSNALTPQ EVIV.

    [0047] DNA Sequence of Cobalt Containing High-Mass, Nitrile Hydratase Subunit Beta (EC 4.2.1.84) [Gene nhhB] in R. rhodochrous DAP 96253.

    TABLE-US-00007 (SEQIDNO:7) ATGGATGGTATCCACGACACAGGCGGCATGACCGGATACGGACCGGTC CCCTATCAGAAGGACGAGCCCTTCTTCCACTACGAGTGGGAGGGTCGAAC CCTGTCGATTCTGACCTGGATGCATCTCAAGGGCATGTCGTGGTGGGACA AGTCGCGGTTCTTCCGGGAGTCGATGGGGAACGAAAACTACGTCAACGAG ATTCGCAACTCGTACTACACCCACTGGCTGAGTGCGGCGGAACGTATCCT CGTCGCCGACAAGATCATCACCGAAGAAGAGCGAAAGCACCGCGTGCAGG AGATCCTCGAGGGTCGGTACACGGACAGGAACCCGTCGCGGAAGTTCGAT CCGGCCGAGATCGAGAAGGCGATCGAGAGGCTTCACGAGCCCCACTCCCT AGTGCTTCCAGGAGCGGAGCCGAGTTTCTCCCTCGGTGACAAGGTCAAAG TGAAGAACATGAACCCGCTGGGACACACACGGTGCCCGAAGTATGTGCGG AACAGAATCGGGGAAATCGTCACCTCCCACGGGTGCCAGATCTATCCCGA GAGCAGCTCCGCCGGCCTCGGCGACGATCCCCGCCCGCTCTACACGGTCG CGTTTTCCGCCCAGGAACTGTGGGGCGACGACGGAAACGGGAAAGACGTA GTGTGCGTCGATCTCTGGGAACCGTACCTGATCTCTGCGTGA.

    [0048] Amino Acid Sequence of Cobalt containing High-Mass, Nitrile Hydratase subunit beta (EC 4.2.1.84) [encoded by gene nhhB] in R. rhodochrous DAP 96253.

    TABLE-US-00008 (SEQIDNO:8) MDGIHDTGGMTGYGPVPYQKDEPFFHYEWEGRTLSILTWMHLKGMSWWD KSRFFRESMGNENYVNEIRNSYYTHWLSAAERILVADKIITEEERKHRVQ EILEGRYTDRNPSRKFDPAEIEKAIERLHEPHSLVLPGAEPSFSLGDKVK VKNMNPLGHTRCPKYVRNRIGEIVTSHGCQIYPESSSAGLGDDPRPLYTV AFSAQELWGDDGNGKDVVCVDLWEPYLISA.

    [0049] DNA Sequence of a L-Asparaginase Type-2 Enzyme in R. rhodochrous DAP 96253.

    TABLE-US-00009 (SEQIDNO:9) TTGAGCGTCGAACTCGTGGAAGTGGTGCGATCGGGGTTCCGCGAATGC GTGCACCGCGGCTCGCTCGTCGTACTCGACCCGGCCGGCGACGTGCGGCT CGCACTGGGCGAGATCCGCACGCCGATCTATCCGCGGTCGTCGAACAAGC CGCTGCAGGCGGTGGCGCTGCTGCGGCAGGGCTTCGTGCCCCGCTCGACG GAGGAACTCGCGATCGCGACGGCCTCGCACGAGGGCGAGGCCGGGCACGT CCGGCTGGTGGAGGCGCTGCTCGCCGGGCACGGATTCACCGAGGACGACC TGCAGTGCCCGCCGGATCTGCCGGGCAACGAACCGGCCCGGGCGACGATC GTCGCCGCCGGTCACCCCCGGCGGACGGTGTACATGAACTGCTCCGGCAA GCACGCCGCGATGCTCGCGACGTGCGCCGCGAACGGCTGGCCCGTCCGCG CCGGCGCGGACGAGCCGGGCTACCTCGACTCCGCCCATCCGCTGCAGCAG GCCGTGGTCGAGACGGTCCTCGACCTCGCGGGCGACGTCGAGGACACCGA TCTCGGCATCGACGGGTGCGGCCTGCCGATCGTGCCGCTGCCCCTGGTCA ATCTCGCCCGGGCCTATTCGCGGCTGGCGACGGCCGGGCCCGGGACGCCG GAACGGGCCGTGGCCGACGCGATCCGGAGTCATCCGCACCTCGTCTCGGG CACCGGCAAGGACGACGCCCGGTTGATGCCCGCGGTGCCGGGACTGCTGT GCAAGGCCGGGGCGGACGGCGTGCACGCGGGTGCCCTGCCGGACGGCACC GCGTTCGCACTGAAGATCGACGACGGCCACGAGCGGGCCCGCCTTCCCCT CACTGCCGCCCTGCTGCACCACCTCGGAGTGACGTGGTCCGAGGAGCACG CGGAGCTCGCGTCGCAGCCGGTGCTCGGCGGTGGGATCCGGGTCGGCACG GTCCGGGCGATCCCCGGAGTGCTCTGA.

    [0050] Amino Acid Sequence of a L-Asparaginase Type-2 Enzyme in R. rhodochrous DAP 96253.

    TABLE-US-00010 (SEQIDNO:10) LSVELVEVVRSGFRECVHRGSLVVLDPAGDVRLALGEIRTPIYPRSSNKP LQAVALLRQGFVPRSTEELAIATASHEGEAGHVRLVEALLAGHGFTEDDL QCPPDLPGNEPARATIVAAGHPRRTVYMNCSGKHAAMLATCAANGWPVRA GADEPGYLDSAHPLQQAVVETVLDLAGDVEDTDLGIDGCGLPIVPLPLVN LARAYSRLATAGPGTPERAVADAIRSHPHLVSGTGKDDARLMPAVPGLLC KAGADGVHAGALPDGTAFALKIDDGHERARLPLTAALLHHLGVTWSEEHA ELASQPVLGGGIRVGTVRAIPGVL.

    [0051] DNA Sequence of an Amidase which is Clustered with an UREA ABC Transporter and Nitrile Hydratase in R. rhodochrous DAP 96253.

    TABLE-US-00011 (SEQIDNO:11) ATGTCTTCGTTGACTCCCCCCAATTCCAACCAAATGTCGGCCCTGAACAA CCACTTCCGATTCGGACTGACGACGCCGGAACTCGAAGAGTTCGCACCGG CCCTCGAAGCGACGCTCGCGTCCTCCGAAACCGTCGAACGCCTCTACGAG CGCACCGCGCCCGAGCCGCCTCAGCGGTCATGGACCTCACCCACGGCGGA CGAGAACCCGCTGAGCGCCTGGTACGTCACCACCTCGATCAGCGAAACCG ACGAAGGCCCCCTCGCCGGGCGAACGGTCGCCGTGAAAGACAACGTCGCA GTCGCCGGCGTGCCGATGATGAACGGCTCCCGAACCGTCGAGGGCTTCAC CCCCCGCTACGACGCCACCGTCGTACGCCGACTGCTCGACGCCGGCGCAA CCATCACCGGCAAAGCGGTGTGCGAAGATCTCTGCTTCTCCGGCGCCAGC TTCACTTCCCACCCCCAGCCGGTCCGCAACCCCTGGGACGAAAGCCGCAT CACCGGCGGCTCGTCCAGCGGCAGCGGCGCCCTGGTCGCCAGCGGCCAGG TGGATATGGCAGTCGGCGGCGACCAGGGCGGTTCGATCCGCATCCCCGCC GCGTTCTGCGGCATCGTCGGACACAAACCCACCCACGGACTGGTCCCCTA TACGGGAGCATTTCCCATCGAACGAACCATCGACCACCTCGGTCCGATGA CGCGCACGGTCAGCGACGCCGCCGCAATGCTCACCGTCCTCGCCGGCACC GACGGCCTCGATCCCCGACAGACCCACCGGATCGAACCGGTGGACTACCT CGCGGCGCTGGCCGAACCCGCATCGGGTCTGCGCGTGGGTGTGGTCACCG AAGGCTTCGACACCCCTGTCTCCGACGCTGCCGTCGACAATGCCGTGCGC ACCGCCATCGGCGTACTGCGCTCGGCCGGACTTACCGTCGAAGAGGTCTC GATCCCCTGGCACCTCGATGCGATGGCCGTCTGGAACGTGATCGCCACCG AGGGAGCGGCCTACCAGATGCTCGACGGCAATGCCTACGGCATGAACACT GATGGCTTCTACGATCCCGAACTGATCGCCCACTTCTCCCGTCAACGACT CGAGCACGGTCACCAACTGTCGAAGACGGTCAAACTCGTCGGGATGTCCG GGCGCTACACATTGGAGGTAGGCGGCGGCAAGTACTACGCCATGGCCCGC CAACTCGTCCCCGAAGTCCGCGCCGCCTACGACGCCGCCTTGGCTCGGTA CGACGTGCTGGTGATGCCCACCCTCCCCTACACCGCCACCAAGATCCCGA CCACGGACATTCCGTTGGCCGACTATCTGGACACCGCACTGTCGATGATC ATCAACACCGCACCATTCGACGTCACCGGTCACCCCGCCTGCAGTGTCCC CGCTGACCTGGTCCACGGGCTTCCCACCGGAATGATGATCATCGGCAAGC ATTTCGACGACGCGACAGTGCTGCGCGTCGCCCAGCTCTACGAACATGCA GTGGGCAACTATCCTGTCCCGCCGGCTGCAGCCGGCACCCTGACATAA.

    [0052] Amino Acid Sequence of an Amidase which is Clustered with an UREA ABC Transporter and Nitrile Hydratase in R. rhodochrous DAP 96253.

    TABLE-US-00012 (SEQIDNO:12) MSSLTPPNSNQMSALNNHFRFGLTTPELEEFAPALEATLASSETVERLYE RTAPEPPQRSWTSPTADENPLSAWYVTTSISETDEGPLAGRTVAVKDNVA VAGVPMMNGSRTVEGFTPRYDATVVRRLLDAGATITGKAVCEDLCFSGAS FTSHPQPVRNPWDESRITGGSSSGSGALVASGQVDMAVGGDQGGSIRIPA AFCGIVGHKPTHGLVPYTGAFPIERTIDHLGPMTRTVSDAAAMLTVLAGT DGLDPRQTHRIEPVDYLAALAEPASGLRVGVVTEGFDTPVSDAAVDNAVR TAIGVLRSAGLTVEEVSIPWHLDAMAVWNVIATEGAAYQMeDGNAYGMNT DGFYDPELIAHFSRQRLEHGHQLSKTVKLVGMSGRYTLEVGGGKYYAMAR QLVPEVRAAYDAALARYDVLVMPTLPYTATKIPTTDIPLADYLDTALSMI INTAPFDVTGHPACSVPADLVHGLPTGMMIIGKHFDDATVLRVAQLYEHA VGNYPVPPAAAGTLT.

    [0053] Variants and fragments of polynucleotides that encode polypeptides that retain the desired asparaginase activity may also be used herein. By fragment is intended a portion of the polynucleotide and hence also encodes a portion of the corresponding protein. Polynucleotides that are fragments of an enzyme nucleotide sequence generally comprise at least 10, 15, 20, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 800, 900, 1,000, 1,100, 1,200, 1,300, or 1,400 contiguous nucleotides, or up to the number of nucleotides present in a full-length enzyme polynucleotide sequence. A polynucleotide fragment will encode a polypeptide with a desired enzymatic activity and will generally encode at least 15, 25, 30, 50, 100, 150, 200, or 250 contiguous amino acids, or up to the total number of amino acids present in a full-length enzyme amino acid sequence. Variant is intended to mean substantially similar sequences. Generally, variants of a particular enzyme sequence will have at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to the reference enzyme sequence, as determined by standard sequence alignment programs. Variant polynucleotides described herein will encode polypeptides with the desired enzyme activity. By way of example, the relatedness between two polynucleotides or two polypeptides can be described as identity. The identity between two sequences can be determined using the Needleman-Wunsch algorithm (Needleman and Wunsch, 1970, J. Mol. Biol. 48:443-453) as implemented in the Needle program of the EMBOSS package (EMBOSS: The European Molecular Biology Open Software Suite, Rice et al., 2000, Trends Genet. 16:276-7). The output of Needle labeled longest identity is used as the percent identity and is calculated as (Identical Residues (i.e., nucleotides or peptides)100)/(Length of AlignmentTotal Number of Gaps in Alignment).

    [0054] As used in the context of production of transgenic cells, the term introducing is intended to mean presenting to a host cell, such as Escherichia coli, with a polynucleotide that encodes an endotoxin-free asparaginase enzyme.

    [0055] Optionally, the polynucleotide will be presented in such a manner that the sequence gains access to the interior of a host cell, including its potential insertion into the genome of the host cell. The disclosed methods do not depend on a particular protocol for introducing a sequence into a host cell, only that the polynucleotide gains access to the interior of at least one host cell. Methods for introducing polynucleotides into host cells are well known, including, but not limited to, stable transfection methods, transient transfection methods, and virus-mediated methods. Stable transfection is intended to mean that the polynucleotide construct introduced into a host cell integrates into the genome of the host and is capable of being inherited by the progeny thereof. Transient transfection or transient expression is intended to mean that a polynucleotide is introduced into the host cell but does not integrate into the host's genome.

    [0056] Furthermore, the endotoxin-free asparaginase enzyme sequence may be contained in, for example, a plasmid for introduction into the host cell. Typical plasmids of interest include vectors having defined cloning sites, origins of replication, and selectable markers. The plasmid may further include transcription and translation initiation sequences and transcription and translation terminators. Plasmids can also include generic expression cassettes containing at least one independent terminator sequence, sequences permitting replication of the cassette in eukaryotes, or prokaryotes, or both, (e.g., shuttle vectors) and selection markers for both prokaryotic and eukaryotic systems. Vectors are suitable for replication and integration in prokaryotes, eukaryotes, or optimally both. For general descriptions of cloning, packaging, and expression systems and methods, see Giliman and Smith, Gene 8:81-97 (1979); Roberts et al., Nature 328:731-734 (1987); Berger and Kimmel, Guide to Molecular Cloning Techniques, Methods in Enzymology, Vol. 152 (Academic Press, Inc., San Diego, Calif.) (1989); Sambrook et al., Molecular Cloning: A Laboratory Manual, Vols. 1-3 (2d ed; Cold Spring Harbor Laboratory Press, Plainview, N.Y.) (1989); and Ausubel et al., Current Protocols in Molecular Biology, Current Protocols (Greene Publishing Associates, Inc., and John Wiley & Sons, Inc., New York; 1994 Supplement) (1994). Transgenic host cells that express endotoxin-free asparaginase enzyme may be used in the disclosed methods as whole cells or as a biological source from which one or more enzymes can be isolated.

    [0057] In some embodiments, the disclosed endotoxin-free asparaginase enzyme is a heteropolymer containing at least one polypeptide having an amino acid sequence with at least 65%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:2, 4, 6, 8, or 10. A person skilled in the art will understand how to select and design variant proteins retaining substantially their L-asparaginase activity. Typically, a Nessler assay is used for the determination of L-asparaginase activity according to a method described by Mashburn and Wriston (Mashburn, L., and Wriston, J. (1963) Tumor Inhibitory Effect of L-Asparaginase, Biochem Biophys Res Commun 12, 50, incorporated herein by reference in its entirety).

    [0058] Endotoxin-free asparaginase enzyme may be produced constitutively in a cell or, alternatively, a cell may produce the endotoxin-free asparaginase enzyme only following induction with a suitable inducing agent. Constitutively is intended to mean that at least one enzyme disclosed herein is continually produced or expressed in a particular cell type. Other cell types, however, may need to be induced, as described above, to express endotoxin-free asparaginase enzyme at a sufficient quantity or enzymatic activity level to cell growth. That is, endotoxin-free asparaginase enzyme may only be produced (or produced at sufficient levels) following exposure to or treatment with a suitable inducing agent. Such inducing agents are known and outlined above. For example, the one or more bacteria are treated with an inducing agent such as urea, methyl carbamate, cobalt, asparagine, glutamine, or any mixture thereof, more particularly urea or methyl carbamate optionally in combination with asparagine or cobalt. Furthermore, as disclosed in U.S. Pat. Nos. 7,531,343 and 7,531,344, which are incorporated by reference in their entireties, asparaginase activity can be induced in Rhodococcus rhodochrous DAP 96622 (Gram-positive) or Rhodococcus rhodochrous DAP 96253 (Gram-positive), in medium supplemented with amide containing amino acids or derivatives thereof. Other strains of Rhodococcus can also preferentially be induced to exhibit asparaginase enzymatic activity utilizing amide containing amino acids or derivatives thereof.

    [0059] Polymers to Stabilize Asparaginase

    [0060] The disclosed endotoxin-free asparaginase enzymes may be stored under conditions suitable to preserve enzymatic activity. In some embodiments, the disclosed endotoxin-free asparaginase enzyme is conjugated to a polymer in order to increase its stability. Suitable polymers can be selected from the group of non-toxic water soluble polymers such as polysaccharides, e.g. hydroxyethyl starch, poly amino acids, e.g. poly lysine, polyester, e.g., polylactic acid, and poly alkylene oxides, e.g., polyethylene glycol (PEG).

    [0061] Polyethylene glycol (PEG) or mono-methoxy-polyethyleneglycol (mPEG) is well known in the art and comprises linear and branched polymers. Examples of some polymers, particularly PEG, are provided in the following, each of which is herein incorporated by reference in its entirety: U.S. Pat. Nos. 5,672,662; 4,179,337; 5,252,714; US Pat. Appl. Publ. No. 2003/0114647; U.S. Pat. Nos. 6,113,906; 7,419,600; and PCT Publ. No. WO2004/083258.

    [0062] The quality of such polymers is characterized by the polydispersity index (PDI). The PDI reflects the distribution of molecular weights in a given polymer sample and is calculated from the weight average molecular weight divided by the number average molecular weight. It indicates the distribution of individual molecular weights in a batch of polymers. The PDI has a value always greater than 1, but as the polymer chains approach the ideal Gauss distribution monodispersity), the PDI approaches 1.

    [0063] The polyethylene glycol has advantageously a molecular weight comprised within the range of about 500 Da to about 9,000 Da. More specifically, the polyethylene glycol (e.g, mPEG) has a molecular weight selected from the group consisting of polyethylene glycols of 2000 Da, 2500 Da, 3000 Da, 3500 Da, 4000 Da, 4500 Da, and 5000 Da. In a particular embodiment, the polyethylene glycol (e.g., mPEG) has a molecular weight of 5000 Da.

    [0064] The number of PEG moieties which can be coupled to the enzyme will be subject to the number of free amino groups and, even more so, to which amino groups are accessible for a PEGylation reaction. In a particular embodiment, the degree of PEGylation (i.e., the number of PEG moieties coupled to amino groups on the NHase-asparaginase) is within a range from about 10% to about 100% of free and/or accessible amino groups (e.g., about 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100%). 100% PEGylation of accessible amino groups (e.g., lysine residues and/or the N-terminus of the protein) is also referred to herein as maximally PEGylated. One method to determine the modified amino groups in mPEG-r-crisantaspase conjugates (degree of PEGylation) is a method described by Habeeb (A.F.S.A. Habeeb, Determination of free amino groups in proteins by trinitrobenzensulfonic acid, Anal. Biochem. 14 (1966), p. 328, incorporated herein by reference in its entirety).

    [0065] In one embodiment, the PEG moieties are coupled to one or more amino groups (wherein amino groups include lysine residues and/or the N-terminus) of the NHase-asparaginase. In a particular embodiment, the degree of PEGylation is within a range of from about 10% to about 100% of total or accessible amino groups (e.g., lysine residues and/or the N-terminus), e.g., about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 100%. In a specific embodiment, about 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% of the total amino groups (e.g., lysine residues and/or the N-terminus) are coupled to a PEG moiety. In another specific embodiment, about 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% of the accessible amino groups (e.g., lysine residues and/or the N-terminus) are coupled to a PEG moiety. In a specific embodiment, 40-55% or 100% of the accessible amino groups (e.g., lysine residues and/or the N-terminus) are coupled to a PEG moiety. In some embodiments, the PEG moieties are coupled to the NHase-asparaginase by a covalent linkage.

    [0066] Treating Diseases Treatable by L-Asparagine Depletion

    [0067] The disclosed endotoxin-free asparaginase enzyme can be used in the treatment of a disease treatable by depletion of asparagine. For example, the disclosed endotoxin-free asparaginase enzyme is useful in the treatment or the manufacture of a medicament for use in the treatment of acute lymphoblastic leukemia (ALL) in both adults and children, as well as other conditions where asparagine depletion is expected to have a useful effect. Such conditions include, but are not limited to the following: malignancies, or cancers, including but not limited to hematalogic malignancies, non-Hodgkin's lymphoma, NK lymphoma, pancreatic cancer, Hodgkin's disease, acute myelocytic leukemia, acute myelomonocytic leukemia, chronic lymphocytic leukemia, lymphosarcoma, reticulosarcoma, and melanosarcoma. Representative non-malignant hematologic diseases which respond to asparagine depletion include immune system-mediated blood diseases, e.g., infectious diseases such as those caused by HIV infection (i.e., AIDS). Non-hematologic diseases associated with asparagine dependence include autoimmune diseases, for example rheumatoid arthritis, SLE, autoimmune, collagen vascular diseases, AIDS, etc. Other autoimmune diseases include osteo-arthritis, Issac's syndrome, psoriasis, insulin dependent diabetes mellitus, multiple sclerosis, sclerosing panencephalitis, systemic lupus erythematosus, rheumatic fever, inflammatory bowel disease (e.g., ulcerative colitis and Crohn's disease), primary billiary cirrhosis, chronic active hepatitis, glomerulonephritis, myasthenia gravis, pemphigus vulgaris, and Graves' disease. Cells suspected of causing disease can be tested for asparagine dependence in any suitable in vitro or in vivo assay, e.g., an in vitro assay wherein the growth medium lacks asparagine.=

    [0068] In some embodiments, endotoxin-free asparaginase enzyme is administered as a first line therapy. In another embodiment, endotoxin-free asparaginase enzyme is administered as a second line therapy in patients, particularly patients with ALL, where objective signs of hypersensitivity have developed to other asparaginase preparations. Non-limiting examples of objective signs of hypersensitivity include testing antibody positive for an asparaginase enzyme

    [0069] In some embodiments, the disclosed method involves administering to a patient in need of the treatment a therapeutically effective amount of a disclosed endotoxin-free asparaginase enzyme. In a specific embodiment, treatment will be administered as part of a combination of chemotherapy drugs, including, but not limited to glucocorticoids, corticosteroids, anticancer compounds or other agents, including, but not limited to methotrexate, dexamethasone, prednisone, prednisolone, vincristine, cyclophosphamide, and anthracycline. In some embodiments, patients with ALL will be administered the endotoxin-free asparaginase enzyme as a component of multi-agent chemotherapy during three chemotherapy phases including induction, consolidation or intensification, and maintenance. The endotoxin-free asparaginase enzyme can be administered before, after, or simultaneously with other compounds as part of a multi-agent chemotherapy regimen.

    [0070] In some embodiments, the method comprises administering endotoxin-free asparaginase enzyme at an amount of about 1 U/kg to about 25 U/kg (e.g., about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 U/kg) or an equivalent amount thereof (e.g., on a protein content basis). In some embodiments, the endotoxin-free asparaginase enzyme is administered at a dose that depletes L-asparagine to undetectable levels using methods and apparatus known in the art for a period of about 3 days to about 10 days (e.g., 3, 4, 5, 6, 7, 8, 9, or 10 days) for a single dose.

    [0071] The incidence of relapse in ALL patients following treatment with existing L-asparaginase remains high, with approximately 10-25% of pediatric ALL patients having early relapse (e.g., some during maintenance phase at 30-36 months post-induction). If a patient treated with E. coli-derived L-asparaginase has a relapse, subsequent treatment with E. coli preparations could lead to a vaccination effect, whereby the E. coli preparation has increased immunogenicity during the subsequent administrations. In one embodiment, the disclosed endotoxin-free asparaginase enzyme may be used in a method of treating patients with relapsed ALL who were previously treated with other asparaginase preparations, in particular those who were previously treated with E. coli-derived asparaginases.

    [0072] Compositions, Formulations, and Routes of Administration

    [0073] Also disclosed is a pharmaceutical composition comprising a disclosed endotoxin-free asparaginase enzyme in a pharmaceutically acceptable carrier.

    [0074] Pharmaceutical compositions containing the disclosed endotoxin-free asparaginase enzyme can be administered to a patient using standard techniques. Techniques and formulations generally may be found in Remington's Pharmaceutical Sciences, 18th ed., Mack Publishing Co., Easton, Pa., 1990 (herein incorporated by reference).

    [0075] Suitable dosage forms, in part, depend upon the use or the route of entry, for example, oral, transdermal, transmucosal, or by injection (parenteral). Such dosage forms should allow the therapeutic agent to reach a target cell or otherwise have the desired therapeutic effect. For example, pharmaceutical compositions injected into the blood stream preferably are soluble.

    [0076] The disclosed conjugates and/or pharmaceutical compositions can be formulated as pharmaceutically acceptable salts and complexes thereof. Pharmaceutically acceptable salts are non-toxic salts present in the amounts and concentrations at which they are administered. The preparation of such salts can facilitate pharmaceutical use by altering the physical characteristics of the compound without preventing it from exerting its physiological effect. Useful alterations in physical properties include lowering the melting point to facilitate transmucosal administration and increasing solubility to facilitate administering higher concentrations of the drug. The pharmaceutically acceptable salt of an asparaginase may be present as a complex, as those in the art will appreciate.

    [0077] Pharmaceutically acceptable salts include acid addition salts such as those containing sulfate, hydrochloride, fumarate, maleate, phosphate, sulfamate, acetate, citrate, lactate, tartrate, methanesulfonate, ethanesulfonate, benzenesulfonate, p-toluenesulfonate, cyclohexylsulfamate, and quinate. Pharmaceutically acceptable salts can be obtained from acids, including hydrochloric acid, maleic acid, sulfuric acid, phosphoric acid, sulfamic acid, acetic acid, citric acid, lactic acid, tartaric acid, malonic acid, methanesulfonic acid, ethanesulfonic acid, benzenesulfonic acid, p-toluenesulfonic acid, cyclohexylsulfamic acid, fumaric acid, and quinic acid.

    [0078] Pharmaceutically acceptable salts also include basic addition salts such as those containing benzathine, chloroprocaine, choline, diethanolamine, ethylenediamine, meglumine, procaine, aluminum, calcium, lithium, magnesium, potassium, sodium, ammonium, alkylamine, and zinc, when acidic functional groups, such as carboxylic acid or phenol are present. For example, see Remington's Pharmaceutical Sciences, supra. Such salts can be prepared using the appropriate corresponding bases.

    [0079] Pharmaceutically acceptable carriers and/or excipients can also be incorporated into a pharmaceutical composition according to the invention to facilitate administration of the particular asparaginase. Examples of carriers suitable for use in the practice of the invention include calcium carbonate, calcium phosphate, various sugars such as lactose, glucose, or sucrose, or types of starch, cellulose derivatives, gelatin, vegetable oils, polyethylene glycols, and physiologically compatible solvents. Examples of physiologically compatible solvents include sterile solutions of water for injection (WFI), saline solution and dextrose.

    [0080] Pharmaceutical compositions can be administered by different routes, including intravenous, intraperitoneal, subcutaneous, intramuscular, oral, topical (transdermal), or transmucosal administration. For oral administration, for example, the compounds can be formulated into conventional oral dosage forms such as capsules, tablets, and liquid preparations such as syrups, elixirs, and concentrated drops. For injection, pharmaceutical compositions are formulated in liquid solutions, preferably in physiologically compatible buffers or solutions, such as saline solution, Hank's solution, or Ringer's solution.

    [0081] In addition, the compounds may be formulated in solid form and redissolved or suspended immediately prior to use. For example, lyophilized forms of the conjugate can be produced. In a specific embodiment, the conjugate is administered intramuscularly. In another specific embodiment, the conjugate is administered intravenously. In some embodiments the pharmaceutical composition is contained in a vial as a lyophilized powder to be reconstituted with a solvent.

    [0082] Systemic administration can also be accomplished by transmucosal or transdermal means. For transmucosal or transdermal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are well known in the art, and include, for example, for transmucosal administration, bile salts, and fusidic acid derivatives. In addition, detergents may be used to facilitate permeation. Transmucosal administration, for example, may be through nasal sprays, inhalers (for pulmonary delivery), rectal suppositories, or vaginal suppositories. For topical administration, compounds can be formulated into ointments, salves, gels, or creams, as is well known in the art.

    [0083] The amounts of the composition to be delivered will depend on many factors, for example, the IC.sub.50, EC.sub.50, the biological half-life of the compound, the age, size, weight, and physical condition of the patient, and the disease or disorder to be treated. The importance of these and other factors to be considered are well known to those of ordinary skill in the art. Generally, the amount of the composition to be administered will range from about 10 International Units per square meter of the surface area of the patient's body (IU/m2) to 50,000 IU/m2, with a dosage range of about 1,000 IU/m2 to about 15,000 IU/m2 being preferred, and a range of about 6,000 IU/m2 to about 15,000 IU/m2 being more preferred, and a range of about 10,000 to about 15,000 IU/m2 (about 20-30 mg protein/m) being particularly preferred to treat a malignant hematologic disease, e.g., leukemia. Typically, these dosages are administered via intramuscular or intravenous injection at an interval of about 3 times weekly to about once per month, typically once per week or once every other week during the course of therapy. Of course, other dosages and/or treatment regimens may be employed, as determined by the attending physician.

    [0084] A number of embodiments of the invention have been described. Nevertheless, it will be understood that various modifications may be made without departing from the spirit and scope of the invention. Accordingly, other embodiments are within the scope of the following claims.

    EXAMPLES

    Example 1: Comparative Analysis of the Sequence Data

    [0085] The Asparaginase currently used in the treatment of juvenile ALL is a homo-dimer (where twohomo-dimers are in intimate association) and its origin is either from E. coli or Erwinia. Some of the current preparations are recombinant. Like all sub-unit proteins, when introduced into the human body, this protein will break down and be cleared in the urine. Asparagine preparations from Erwinia typically clear within 48 hours of administration. The asparagine used is either as is or linked to PEG (polyethylene glycol) [referred to as PEGylated Asparaginase]. PEG-asparaginase takes much longer to clear than Erwinia asparaginase. Also note that recombinant proteins produced in Gram-negative hosts typically show enhanced levels of endotoxin when the cells are over-induced or when high-cell density fermentation is attempted.

    [0086] As disclosed herein, NHase from induced cells of R. rhodochrous DAP 96253, has asparaginase activity. The presence of asparaginase activity and the enzyme asparaginase is well documented in Gram-negative bacteria, and especially in Escherichia coli and in Erwinia spp. In both E. coli and in Erwinia, active asparaginase is a homo-dimer (actually the association is to form two intimate homo-dimers). In induced cells of R. rhodochrous DAP 96253, the isolated and purified active NHase (which exhibits asparaginase activity in addition to NHase activity) is composed of >8 -subunits and >8 -subunits (>16 merup to 20 mer). In this NHase, the - and -subunits are essentially in parity (i.e., 1:1 ratio). Furthermore this enzyme contains non-corrin-Cobalt at the active site. Thus the secondary, tertiary and quaternary structure of the classic asparaginase seen in Gram-negative bacteria the NHase-asparaginase in induced cells of R. rhodochrous DAP 96253 are very different.

    [0087] Sequencing of the - and -subunits of the isolated and highly purified NHase from induced cells of R. rhodochrous DAP 96253 show that the sequence of these subunits is unlike the sequence(s) seen in asparaginases obtained from other bacteria (i.e. Gram-negative or Gram-positive). Thus the primary structure (amino acid sequence) of R. rhodochrous DAP 96253 NHase, exhibiting asparaginase activity is unique as well.

    [0088] Recent literature shows the presence of asparaginase enzymes in selected members of the Mycolata (Norcardia, Mycobacterium, and Rhodococcus). However, while analysis of these asparaginase enzymes from the Mycolata show some commonality with the asparaginase enzymes seen in Gram-negative bacteria, these asparaginase enzymes from the Mycolata (and from Rhodococcus spp. are not similar to the purified NHase of induced cells of R. rhodochrous DAP 96253 which exhibits asparaginase activity.

    [0089] During induction of R. rhodochrous DAP 96253 during fermentation, the high levels of NHase>150 units/mg-cell dry weight (typically 200-600 units of NHase), also show higher levels of asparaginase 20-30 units/mg-cell dry weight than the levels of asparaginase seen in E. coli or Erwinia. When it is considered, that >50 grams of cells per liter is obtained, which is considerably higher than that seen in E. coli or Erwinia, the amount of asparaginase activity produced per liter is order of magnitudes higher in R. rhodochrous DAP 96253. Also the NHase-Asparaginase from R. rhodochrous DAP 96253 when purified contains no endotoxin, whereas all preparations of asparaginase from E. coli and Erwinia contain endotoxin.

    [0090] Classic asparaginase enzymes are homo-dimers arranged as 2-intimate homodimersand that NHase is a hetero-polymer (heterotetramer [low mass] up to hetero20mer [high mass]. It also is important to note that R. rhodochrous DAP 96253 has two cobalt containing NHase enzymes, typically defined as low mass (a heterotetramer) [L-CoNHase], and high-mass (>16-heteromer) [H-CoNHase].

    [0091] In the past, it has been shown that when induced cells of R. rhodochrous DAP 96253 are immobilized in polyacrylamide, the concentration of residual monomer (typically >600 ppm) is rapidly reduced to ppb levels.

    [0092] E. coli asparaginase (Elspar) is currently used in veterinary medicine for the treatment of certain leukemias (and related cancers) in animals. In FIG. 2, the amino acid sequences for the subunits of the two NHase-Asparaginase enzymes are compared with each other and also with the classic asparaginase of R. rhodochrous DAP 96253, and in addition with the known sequence for the asparaginase pharmaceutical product Elsvar and with the published asparaginase sequence of Erwinia chrysanthemi.

    [0093] FIG. 2 summarizes the comparative analyses showing percent identity and number of differences. It is clear from the comparative analysis that at best the -subunit and -subunit of NHase-Asparaginase share a 14% similarity with E. chrysanthemi asparaginase and 10.7% similarity with the Elsvar asparaginase (E. coli derived.) The DNA and protein sequences of the NHase of R. rhodochrous DAP 96253 are totally unlike either E. coli or Erwinia chrysanthemi asparaginase. Thus DNA-sequence/protein sequence of E. coli and/or Erwinia chrysanthemi asparaginase could not be indicative or predictive of the R. rhodochrous DAP 96253 NHase which exhibits asparaginase activity.

    [0094] A comparison of the NHase subunits show that there is significant homology between the High-Mass NHase sub-units of R. rhodochrous DAP 96253 and R. rhodochrous J1. In essence, the homology is about 98% and the sub-units vary by several amino acids.

    [0095] On an organizational level, the high-mass NHase operon of strain DAP 96253 contains no IS (insertion sequence), whereas strain J1 contains the gene nnhF which is an Insertion sequence (IS 1164). In addition, preliminary genomic information suggests that the organization of Low-Mass NHase in strain DAP 96253 is dissimilar from Low-Mass NHase organization in strain J1. In J1, both the amidase gene and the Cobalt transporter gene are associated with the Low-Mass NHase operon.

    Example 2: Enzyme Preparations Obtained from Cells of Rhodococcus rhodochrous DAP 96253 that Possess Different Levels of Asparaginase and/or Glutaminase Amidase Activities

    [0096] Cells of R. rhodochrous DAP 96253 are capable of producing nitrile hydratase. When fully-induced (when for example when grown on YEMEA supplemented with cobalt and urea), the cells of R. rhodochrous DAP 96253 are capable of producing a high-mass, cobalt containing NHase that exhibits activity against nitriles such as acrylonitrile and acetonitrile. Furthermore, under such conditions the induced Nitrile Hydratase can comprise in excess of 50% of the total soluble protein. The high mass NHase can when purified also be stabilized such that the high-mass NHase activity can be retained for longer periods of time. NHase activity can also be stabilized in whole cells. The overall NHase activity is thus influenced by the amount of NHase produced by the cell and by the ability to stabilize the NHase made by the cells.

    [0097] When induced for NHase, R. rhodochrous DAP 96253 (and also R. rhodochrous DAP 96622) also are induced for amidase activity. Furthermore, it was determined that the purified NHase (from induced cells) also exhibited amidase activity (specifically activity against asparagine and glutamine.)

    [0098] Asparaginase adversely affects cells that are not capable of producing their own asparagine by converting free asparagine to aspartic acid thus stressing those cells incapable of making their own asparagine. Under certain situations of asparagine depletion, it is possible to obtain asparagine by the conversion of glutamine (by for example glutamine synthase or via transamination). The presence of glutaminase, however, will convert glutamine to glutamic acid making the conversion of glutamine to asparagine not possible. The presence of glutaminase along with asparaginase will heighten/intensify the depletion of asparagine.

    [0099] Asparaginase, obtained from E. coli, has been used since the late 1960s, and subsequently from Erwinia, in the treatment of juvenile ALL (Acute Lymphoblastic Leukemia). The goal of these asparaginase preparations was to have essentially only asparaginase activity and no glutaminase activity. It was thought that the presence of glutaminase activity affected patient sensitivity and resulted in antibody formation. Patients receiving E. coli asparaginase did become sensitized and did develop anti-E. coli asparaginase antibodies limiting effective treatment. Erwinia asparaginase while similar to E. coli asparaginase is not identical, and as such patients who became sensitized to E. coli asparaginase could receive Erwinia asparaginase.

    [0100] However, both E. coli and Erwinia are Gram-negative bacteria, and therefore produce and contain Endotoxin, and all proteins isolated and purified must be specifically, and rigorously treated to remove Endotoxin. Recently, research has shown that any level of Endotoxin is immunogenic.

    [0101] In addition, the asparaginase preparation obtained from E. coli or Erwinia are extremely labile, once reconstituted, and must be used within 8 hours of reconstitution. Pegylation was developed so that more stable asparaginase formulations could be made. While PEGylated asparaginase (PEG-ASNase) is considerably more stable than ASNase, it noted that patients who had previously been administered ASNase, quickly responded to the PEG-ASNase, with the PEG-ASNase becoming inactivated by the anti-ASNase antibodies.

    [0102] NHase purified from induced cells of R. rhodochrous DAP 96253 possesses both asparaginase and glutaminase activity. Recent research suggests that resistance to Asparaginase treatment can be effected by the induction of glutaminase synthase activity by cancer cells, which results in the conversion of glutamine to asparagine, and in not achieving asparagine depletion. The presence of glutaminase with asparaginase provides for a product which will effectively reduce asparagine in Leukemia cells, and also in resistant Leukemia cells capable of producing glutamine synthase.

    [0103] R. rhodochrous DAP 96253 is a Gram-positive actinomycete, and as such produces no endotoxin. The sequence for R. rhodochrous NHase and amidases are different from the amidases/asparaginases of either E. coli and/or Erwinia.

    [0104] FIG. 5 shows the potent activity of the R. rhodochrous purified NHase/amidase [asparaginase/glutaminase) against Jurkat (Leukemia) cells. The procedure used to prepare the Asparaginase/Glutaminase to purity was the same purification scheme employed to prepare and purify high-mass NHase.

    [0105] In addition, immobilization by calcium alginate, acrylamide/polyacrylamide, calcium alginate Polyethylenimide PEI), and glutaraldehyde-PEI results in very to significant improvements in NHase stability and half-life. Reduced temperature, or increased temperature (with or without acidic conditions) modulate amidase activity resulting in preparations with significant differences in amidase activity and stability.

    [0106] The preparations prepared from R. rhodochrous DAP 96253 address all of the current concerns with asparaginase products from E. coli and/or Erwinia: 1) it is totally Endotoxin free; 2) it has a unique sequence that will be unreactive with either anti-E. coli ASNase antibodies, or anti-Erwinia ASNase antibodies (PEGylated or non-PEGylated); 3) it addresses ASNase resistance by having glutaminase activity; and 4) it achieves desired asparagine depletion.

    [0107] The R. rhodochrous DAP 96253 product(s) also has potential for treating other ALLs (Adolescent Young Adult [AYA] and adult), and, also for other cancers (e.g. cervical) where asparagine depletion would be advantageous.

    [0108] Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of skill in the art to which the disclosed invention belongs. Publications cited herein and the materials for which they are cited are specifically incorporated by reference.

    [0109] Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.