Peptide substrates recognizable by type E botulinum neurotoxin

10408837 ยท 2019-09-10

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to peptide substrates selectively recognized by botulinum toxin type A, BoNT/E, and their uses, in particular for carrying out methods for detecting, identifying and/or diagnosing botulinum toxin type E.

Claims

1. A peptide substrate selectively recognized by BoNT/E comprising the sequence TABLE-US-00017 (SEQIDNO:3) X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5LX.sub.6GX.sub.7EIDTX.sub.8NRQX.sub.9DX.sub.10IX.sub.11X.sub.12KAX.sub.13X.sub.14X.sub.15 X.sub.16X.sub.17, wherein: X.sub.1, X.sub.2 or X.sub.3: W, 1-Nal (1-Naphthylalanine), 2-Nal, F, Y, I, L, Nle (norleucine), A, or any other hydrophobic amino acid residue; X.sub.4: A or G; X.sub.5: N, K, A, or G; X.sub.6: No residue, or RHMALDM; X.sub.7: N or Q; X.sub.8: Q, R, K or any other positively charged residue; X.sub.9: I, F, K, or R; X.sub.10: R, homoArg, Cit (citrulline) or Orn (ornithine); X.sub.11: M or Nle; X.sub.12: A, F, G, I; X.sub.13: D, K, R or any other positively charged residue; X.sub.14: S, K, R or any other positively charged residue; X.sub.15: N, K, R or any other positively charged residue; X.sub.16: K, R or any other positively charged residue; and X.sub.17: R, TR; native or amidated C-terminus.

2. The peptide substrate of claim 1, wherein RHMALDM corresponds to residues 161-167 of SNAP-25 (SEQ ID NO: 1).

3. A peptide substrate selectively recognized by BoNT/E comprising the sequence TABLE-US-00018 (X.sub.0)m-(SEQIDNO:3)-(X.sub.18)n, (SEQIDNO:4) wherein, m: 0 or 1; n: 0 or 1; X.sub.0: ARENEMDENLEQVS; and X.sub.18: IDEANQRATKMLGSG.

4. The peptide substrate of claim 3, wherein ARENEMDENLEQVS corresponds to residues 141-154 of SEQ ID NO: 1.

5. The peptide substrate of claim 3, wherein IDEANQRATKMLGSG corresponds to residues 192-206 of SEQ ID NO: 1.

6. A peptide substrate selectively recognized by BoNT/E comprising IIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKT (SEQ ID NO:2), wherein SEQ ID NO:2 comprises one or more of the following alterations: one or more deletions; one or more mutations; or a combination thereof, wherein at least one of: amino acid 35 of SEQ ID NO: 2 is R or RT, amino acid 28 of SEQ ID NO: 2 is A, G, F, or I, the deletion comprises the deletion of seven internal residues (RHMALDM), or a combination thereof.

7. A method for detecting the presence of clostridial botulinum neurotoxin serotype E (BoNT/E) in a sample, the method comprising: a) mixing the sample that may comprise serotype E of clostridial neurotoxins with magnetic beads where specific antibodies against BoNT/E are immobilized to capture toxins; b) washing toxin-captured beads; c) transferring toxin-captured beads into a reaction solution that contains the peptide substrate of claim 1 that is selectively recognized by BoNT/E; such that at least a portion of the amount of the substrate is proteolytically cleaved to produce a mixture comprising uncleaved substrate and peptide cleavage products; d)) analyzing the mixture on a mass spectrometer to produce a signal corresponding to the mass of at least one peptide cleavage product; e) using the signal corresponding to the peptide cleavage products to identify the presence of clostridial neurotoxin serotype E; and f) quantitating the amount of proteolytic cleavage of the peptide substrate for the clostridial neurotoxin serotype by mass spectrometry using a stable isotope labeled internal standard that has identical sequence to a cleavage product; wherein the amount of active toxin ofBoNT/E in the sample is about 0.05-0.1 pg or more.

8. The method of claim 7, further comprising a control sample.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 shows the sequence of the native protein substrate of BoNT/E, SNAP-25 (top; SEQ ID NO: 1) and the scheme of Endopep-MS assay for the detection of BoNTs using a peptide substrate (bottom).

(2) FIG. 2 is a table (Table 4) that shows the effect of single amino acid mutations on the detection of cleavage product of mutated peptide-32 by BoNT/E. X represents norleucine.

(3) FIG. 3 shows cleavage of the peptides with N-terminal hydrophobic residues. O.sub.1: 1-Nal

(4) FIG. 4 shows detection of various amount of BoNT/E spiked in 0.5 mL of serum or stool matrices.

(5) FIG. 5 shows detection of the cleavage product of the Peptide#62 cleaved by BoNT/E complex spiked in stool matrix (0.5 mL) at a broad range of toxin concentrations.

DETAILED DESCRIPTION OF THE INVENTION

(6) The present invention relates to peptide substrates selectively recognized by botulinum toxin type E, BoNT/E, and their uses, in particular for carrying out methods for detecting, identifying and/or dosing botulinum toxin type E.

(7) Definitions

(8) The following definitions will be useful in understanding the instant invention.

(9) As used herein, the term comprising is intended to mean that the compositions and methods include the recited elements, but do not exclude other elements. Consisting essentially of, when used to define compositions and methods, shall mean excluding other elements of any essential significance to the combination. Thus, a composition consisting essentially of the elements as defined herein would not exclude trace contaminants from the isolation and purification method and pharmaceutically acceptable carriers, such as phosphate buffered saline, preservatives, and the like. Consisting of shall mean excluding more than trace elements of other ingredients and substantial method steps for administering the compositions of this invention. Embodiments defined by each of these transition terms are within the scope of this invention.

(10) As used in the specification and claims, the singular form a, an and the include plural references unless the context clearly dictates otherwise.

(11) Ranges provided herein are understood to be shorthand for all of the values within the range. For example, a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, and 50.

(12) Unless specifically stated or obvious from context, as used herein, the term or is understood to be inclusive.

(13) The recitation of a listing of chemical groups in any definition of a variable herein includes definitions of that variable as any single group or combination of listed groups. The recitation of an embodiment for a variable or aspect herein includes that embodiment as any single embodiment or in combination with any other embodiments or portions thereof.

(14) Any compositions or methods provided herein can be combined with one or more of any of the other compositions and methods provided herein.

(15) As used herein, the term administering is meant to refer to a means of providing the composition to the subject in a manner that results in the composition being inside the subject's body. Such an administration can be by any route including, without limitation, subcutaneous, intradermal, intravenous, intra-arterial, intraperitoneal, and intramuscular.

(16) As used herein, botulinum toxin serotype E is synonymous with BoNT/E, type E, or similar terminology referring unambiguously to Clostridium botulinum neurotoxin type E. BoNT/E is meant to refer to any of a number of polypeptide neurotoxins, and derivatives thereof, which can be purified from Clostridium botulinum serotype E strains. Exemplary strains of BoNT/E include, but are not limited to, the following, referenced by NCBI Accession number:

(17) TABLE-US-00002 BoNT/E Accession subtypes Number E1 JX424539 E2 JX424535 E3 GQ294552 E4 X62088 E5 AB037711 E6 AM695765 E7 JX424537 E8 JN695730 E9 JX424534

(18) As used herein, a composition refers to an active agent (e.g., peptides of the invention). The composition additionally can comprise a pharmaceutically acceptable carrier or excipient and/or one or more therapeutic agents for use in vitro or in vivo.

(19) As used herein, a control sample means a defined negative BoNT/E sample or a defined positive BoNT/E sample. As used herein, the term sample means any biological matter that contains or potentially contains an active BoNT/E.

(20) As used herein, the term Fluorescence Resonance Energy Transfer (FRET) pair is meant to refer to a donor and acceptor molecule that are in close proximity to one another (typically 10-100 ). The absorption or excitation spectrum of the acceptor must overlap the fluorescence emission spectrum of the donor.

(21) As used herein, kits are understood to contain at least the non-standard laboratory reagents of the invention and one or more non-standard laboratory reagents for use in the methods of the invention.

(22) As used herein, the term pharmaceutically acceptable carrier encompasses any of the standard pharmaceutical carriers, such as a phosphate buffered saline solution, water, and emulsions, such as an oil/water or water/oil emulsion, and various types of wetting agents. The compositions also can include stabilizers and preservatives. For examples of carriers, stabilizers and adjuvants, see Martin Remington's Pharm. Sci., 15th Ed. (Mack Publ. Co., Easton (1975)).

(23) A polypeptide or peptide as used herein is understood as two or more independently selected natural or non-natural amino acids joined by a covalent bond (e.g., a peptide bond). A peptide can include 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more natural or non-natural amino acids joined by peptide bonds. Polypeptides as described herein include full length proteins (e.g., fully processed proteins) as well as shorter amino acids sequences (e.g., fragments of naturally occurring proteins or synthetic polypeptide fragments).

(24) As used herein, the term synthetic peptide is meant to refer to any peptide generate by chemical synthesis.

(25) As used herein, the term subject is intended to include organism needing detection or treatment. Examples of subjects include mammals, e.g., humans, dogs, cows, horses, pigs, sheep, goats, cats, mice, rabbits, rats, and transgenic non-human animals. In certain embodiments, the subject is a human.

(26) Ranges provided herein are understood to be shorthand for all of the values within the range. For example, a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50.

(27) Unless specifically stated or obvious from context, as used herein, the term or is understood to be inclusive.

(28) Unless specifically stated or obvious from context, as used herein, the term about is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value.

(29) Any compositions or methods provided herein can be combined with one or more of any of the other compositions and methods provided herein.

(30) Other definitions appear in context throughout the disclosure.

(31) Compositions

(32) Described herein are peptide substrates, including synthetic peptide substrates, that can be used for the specific detection of BoNT/E. The native peptide substrate of BoNT/E is synaptosomal-associated protein 25 (SNAP-25). SNAP-25 is a t-SNARE protein that is encoded by the SNAP25 gene in humans. SNAP-25 is a component of the trans-SNARE complex. SNAP25 corresponds to RefSeq (mRNA) NM_003081 (human) and NM_011428 (mouse) and RefSeq (protein) NP_003072 (human) and NP_035558 (mouse).

(33) The sequence of SNAP-25 is represented by SEQ ID NO: 1, shown below. The BoNT/E cleavage site is highlighted in bold and underlined.

(34) TABLE-US-00003 SEQIDNO:1 1112131 MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESK 41516171 DAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTD 8191101111 LGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARV 121131141151 VDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNL 161171181191 RHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRAT 201 KMLGSG

(35) The novel compositions of the present invention optimize the current peptide substrate (SEQ ID NO:2) for the detection of BoNT/E. SEQ ID NO:2 corresponds to SNAP-25 positions 156-190 (S. R. Kalb et al. International Journal of Mass Spectrometry (2008), 278, 101-108; b) S. R. Kalb et al. The Botulinum J. (2012), 2(2), 119-134). The BoNT/E cleavage site is highlighted in bold.

(36) TABLE-US-00004 SEQIDNO:2 IIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKT

(37) Accordingly, the present invention features peptide substrates that are selectively recognized by BoNT/E. In exemplary embodiments, the peptide substrate is represented by SEQ ID NO:3, shown below. The bold and underlined residues are the cleavage site of BoNT/E substrates.

(38) TABLE-US-00005 SEQIDNO:3 X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5LX.sub.6GX.sub.7EIDTX.sub.8NRQX.sub.9DX10IX.sub.11X.sub.12KAX.sub.13X.sub.14X.sub.15 X.sub.16X.sub.17,
wherein:

(39) X.sub.1, X.sub.2 or X.sub.3: W, 1-Nal (1-Naphthylalanine), 2-Nal, F, Y, I, L, Nle (norleucine), A, or any other hydrophobic residue;

(40) X.sub.4: A or G;

(41) X.sub.5: N, K, A, or G;

(42) X.sub.6: No residue, or RHMALDM;

(43) X.sub.7: N or Q;

(44) X.sub.8: Q, R, K or any other positively charged residue;

(45) X.sub.9: I, F, K, or R;

(46) X.sub.10: R, homoArg, Cit (citrulline) or Orn (ornithine);

(47) X.sub.11: M or Nle;

(48) X.sub.12: A, F, G, I;

(49) X.sub.13: D, K, R or any other positively charged residue;

(50) X.sub.14: S, K, R or any other positively charged residue;

(51) X.sub.15: N, K, R or any other positively charged residue;

(52) X.sub.16: K, R or any other positively charged residue; and

(53) X.sub.17: R, TR; native or amidated C-terminus.

(54) RHMALDM corresponds to residues 161-167 of SEQ ID NO:1 (SNAP-25).

(55) In other exemplary embodiments, the peptide substrate is represented by SEQ ID NO: 4, shown below.

(56) TABLE-US-00006 SEQIDNO:4 (X.sub.0).sub.m-(SEQIDNO:3)-(X.sub.18).sub.n,
wherein,
m: 0 or 1;
n: 0 or 1;
X.sub.0: ARENEMDENLEQVS; and
X.sub.18: IDEANQRATKMLGSG.

(57) ARENEMDENLEQVS corresponds to residues 141-154 of SEQ ID NO:1.

(58) IDEANQRATKMLGSG corresponds to residues 192-206 of SEQ ID NO:1.

(59) SEQ ID NO:4 is derived based on extensive experiments that show cleavage efficiency of peptides with the native sequence of SNAP-25 (141-206), SNAP-25 (156-206), SNAP-25 (156-190) (see examples section below).

(60) The present invention also contemplates any of the peptides described herein with any FRET pair on the termini or within the sequences of SEQ ID NO:3 and SEQ ID NO: 4. For example, one common pair fluorophores for biological use is a cyan fluorescent protein (CFP)yellow fluorescent protein (YFP) pair. In the absence of BoNT/E, the reporter is intact and the CFP and YFP moieties are in close proximity. Excitation of CFP results in energy transfer to YFP due to FRET. As a consequence, CFP emission is quenched while YFP emits fluorescence due to FRET. In the presence of BoNT, the reporter is cleaved by the proteolytic activity of BoNT/E. The CFP and YFP moieties are physically separated and FRET can no longer occur. CFP emission is restored and YFP emission is reduced. Adding FRET tags into the novel peptides disclosed herein should generate higher detection than the FRET substrates that are commercially available (e.g. BOTEST A/E or SNAP ETIDE).

(61) The peptide substrates of the present invention advantageously have a low limit of detection of BoNT/E, as low as 0.05-0.1 mouse LD.sub.50/ml.

(62) In another non-limiting embodiment, the present invention features a peptide substrate selectively recognized by BoNT/E comprising IIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKT (SEQ ID NO:2), wherein SEQ ID NO:2 comprises one or more alterations. The one or more alterations can be truncation of the N- or C-terminal sequence; extension of the N- or C-terminal sequence; one or more deletions; and one or more mutations.

(63) In one embodiment, the peptides of the invention comprise a truncation of the N-terminal sequence. In another embodiment, the peptides of the invention comprise a truncation of the C-terminal sequence. By truncation is meant a deletion in one or more amino acids of the N- or C-terminal sequence, for example 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more.

(64) In one embodiment, the peptides of the invention comprise an extension of the N-terminal sequence. In another embodiment, the peptides of the invention comprise an extension of the C-terminal sequence. By extension is meant an addition of one or more amino acids in the N- or C-terminal sequence, for example 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more. In exemplary embodiment, the extension comprises the addition one or more amino acids selected from the group consisting of: isoleucine (Ile) and arginine (Arg).

(65) In another embodiment, the peptides of the invention comprise one or more deletions. In an exemplary embodiment, the deletion comprises the deletion of seven internal residues (RHMALDM). In another exemplary embodiment, the deletion comprises the deletion of three N-terminal residues (NTK).

(66) Preferably, the peptides of the invention are synthetic peptides generated by chemical synthesis.

(67) In another further embodiment, the peptides of the invention comprise one or more mutations. A mutation can be, e.g. a substitution, a deletion or an addition.

(68) Mutations can be introduced by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis. Preferably, conservative amino acid substitutions are made at one or more predicted non-essential amino acid residues. A conservative amino acid substitution is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), non-polar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Alternatively, mutations can be introduced randomly along all or part of the coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for biological activity to identify mutants that retain activity. Following mutagenesis, the encoded protein can be expressed recombinantly and the activity of the protein can be determined.

(69) To determine the percent identity of two amino acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second amino or nucleic acid sequence). The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences (i.e., % identity=# of identical positions/total # of positions (e.g., overlapping positions)100). In one embodiment, the two sequences are the same length.

(70) The determination of percent identity between two sequences can be accomplished using a mathematical algorithm. A preferred, non-limiting example of a mathematical algorithm utilized for the comparison of two sequences is the algorithm of Karlin and Altschul (1990) Proc. Natl. Acad. Sci. USA 87:2264-2268, modified as in Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5877. Such an algorithm is incorporated into the BLASTN and BLASTX programs of Altschul, et al. (1990) J. Mol. Biol. 215:403-410. BLAST nucleotide searches can be performed with the BLASTN program, score=100, wordlength=12 to obtain nucleotide sequences homologous to a nucleic acid molecules of the invention. BLAST protein searches can be performed with the BLASTP program, score=50, wordlength=3 to obtain amino acid sequences homologous to a protein molecules of the invention. To obtain gapped alignments for comparison purposes, a newer version of the BLAST algorithm called Gapped BLAST can be utilized as described in Altschul et al. (1997) Nucleic Acids Res. 25:3389-3402, which is able to perform gapped local alignments for the programs BLASTN, BLASTP and BLASTX. Alternatively, PSI-Blast can be used to perform an iterated search which detects distant relationships between molecules. When utilizing BLAST, Gapped BLAST, and PSI-Blast programs, the default parameters of the respective programs (e.g., BLASTX and BLASTN) can be used. Another preferred, non-limiting example of a mathematical algorithm utilized for the comparison of sequences is the algorithm of Myers and Miller, (1988) CABIOS 4:11-17. Such an algorithm is incorporated into the ALIGN program (version 2.0) which is part of the GCG sequence alignment software package. When utilizing the ALIGN program for comparing amino acid sequences, a PAM120 weight residue table, a gap length penalty of 12, and a gap penalty of 4 can be used. Yet another useful algorithm for identifying regions of local sequence similarity and alignment is the FASTA algorithm as described in Pearson and Lipman (1988) Proc. Natl. Acad. Sci. USA 85:2444-2448. When using the FASTA algorithm for comparing nucleotide or amino acid sequences, a PAM120 weight residue table can, for example, be used with a k-tuple value of 2.

(71) The present invention also pertains to variants of the peptide substrates selectively recognized by BoNT/E. Such variants have an altered amino acid sequence which can function as either agonists (mimetics) or as antagonists. Variants can be generated by mutagenesis, e.g., discrete point mutation or truncation. An agonist can retain substantially the same, or a subset, of the biological activities of the naturally occurring form of the protein. An antagonist of a protein can inhibit one or more of the activities of the naturally occurring form of the protein by, for example, competitively binding to a downstream or upstream member of a cellular signaling cascade which includes the protein of interest. Thus, specific biological effects can be elicited by treatment with a variant of limited function. Treatment of a subject with a variant having a subset of the biological activities of the naturally occurring form of the protein can have fewer side effects in a subject relative to treatment with the naturally occurring form of the protein.

(72) Variants of a peptide substrate selectively recognized by BoNT/E which function as either agonists (mimetics) or as antagonists can be identified by screening combinatorial libraries of mutants, e.g., truncation mutants, of the protein of the invention for agonist or antagonist activity. In one embodiment, a variegated library of variants is generated by combinatorial mutagenesis at the nucleic acid level and is encoded by a variegated gene library. A variegated library of variants can be produced by, for example, enzymatically ligating a mixture of synthetic oligonucleotides into gene sequences such that a degenerate set of potential protein sequences is expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display). There are a variety of methods which can be used to produce libraries of potential variants of the marker proteins from a degenerate oligonucleotide sequence. Methods for synthesizing degenerate oligonucleotides are known in the art (see, e.g., Narang, 1983, Tetrahedron 39:3; Itakura et al., 1984, Annu. Rev. Biochem. 53:323; Itakura et al., 1984, Science 198:1056; Ike et al., 1983 Nucleic Acid Res. 11:477).

(73) In addition, libraries of segments of a peptide substrate selectively recognized by BoNT/E can be used to generate a variegated population of polypeptides for screening and subsequent selection of variant marker proteins or segments thereof. For example, a library of coding sequence fragments can be generated by treating a double stranded PCR fragment of the coding sequence of interest with a nuclease under conditions wherein nicking occurs only about once per molecule, denaturing the double stranded DNA, renaturing the DNA to form double stranded DNA which can include sense/antisense pairs from different nicked products, removing single stranded portions from reformed duplexes by treatment with S 1 nuclease, and ligating the resulting fragment library into an expression vector. By this method, an expression library can be derived which encodes amino terminal and internal fragments of various sizes of the protein of interest.

(74) Several techniques are known in the art for screening gene products of combinatorial libraries made by point mutations or truncation, and for screening cDNA libraries for gene products having a selected property. The most widely used techniques, which are amenable to high through-put analysis, for screening large gene libraries typically include cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates isolation of the vector encoding the gene whose product was detected. Recursive ensemble mutagenesis (REM), a technique which enhances the frequency of functional mutants in the libraries, can be used in combination with the screening assays to identify variants of a peptide substrate selectively recognized by BoNT/E of the invention (Arkin and Yourvan, 1992, Proc. Natl. Acad. Sci. USA 89:7811-7815; Delgrave et al., 1993, Protein Engineering 6(3):327-331).

(75) Methods

(76) A method for the detection and differentiation of BoNTs has been described in U.S. Pat. No. 7,611,856 (incorporated by reference in its entirety herein), which utilizes the high specificity of the enzymatic toxin with the high specificity of mass spectroscopy (MS). This MS-based method allows the detection of enzymatic activity of all the BoNT serotypes. The present invention is based, at least in part, on the discovery of novel peptide substrates selectively recognized by type E botulinum neurotoxin (BoNT/E), and their uses, in particular for carrying out methods for detecting, identifying and/or dosing botulinum toxin type E. The peptide substrates of the present invention provide a considerable improvement when compared to the established substrate for BoNT/E detection.

(77) Accordingly, the methods of the invention encompass methods for detecting the presence of clostridial botulinum neurotoxin serotype E (BoNT/E) in a sample and methods of diagnosing infection by clostridial botulinum neurotoxin serotype E (BoNT/E) in a sample.

(78) A sample is meant to refer to any biological matter that contains or potentially contains an active BoNT/E. Exemplary samples include bacterial, baculoviral and yeast lysates; raw, cooked, partially cooked or processed foods; beverages; animal feed; soil samples; water samples; pond sediments; lotions; cosmetics; and clinical formulations. It is understood that the term sample encompasses tissue samples, including, without limitation, mammalian tissue samples; livestock tissue samples such as sheep, cow and pig tissue samples; primate tissue samples; and human tissue samples. Such samples encompass, without limitation, intestinal samples such as infant intestinal samples, tissue samples obtained from a wound. In certain embodiments, the sample is from a human subject. In further embodiments, the human subject is an infant. Other such samples include mammalian tissue, mammalian saliva, mammalian excretions and mammalian feces. For example, as a non-limiting example, a method of the invention can be useful for detecting the presence or activity of a BoNT/E in a food or beverage sample; to assay a sample from a human or animal, for example, exposed to a BoNT/E or having one or more symptoms of a BoNT/E exposure; to follow activity during production and purification of BoNT/E; or to assay formulated BoNT/E products such as pharmaceuticals or cosmetics.

(79) In certain embodiments, the sample is selected from the group consisting of milk, yogurt, cheese, beef, sausage, serum, and stool.

(80) There is no limit to the size of the sample. In certain cases, there may be a need to perform the claimed methods with clinical samples in larger volumes (100 L to 1 mL).

(81) In other non-limiting examples, methods for detecting the presence of clostridial botulinum neurotoxin serotype E (BoNT/E) in a sample comprise the steps of a) mixing a sample that may comprise serotype E of clostridial neurotoxins with magnetic beads where specific antibodies against BoNT/E are immobinized to capture toxins; b) washing toxin-captured beads; c) transferring toxin-captured beads into a reaction solution that contains a peptide substrate selectively recognized by BoNT/E, such that at least a portion of the amount of the substrate is proteolytically cleaved to produce a mixture comprising uncleaved substrate and peptide cleavage products; d) analyzing the mixture on a mass spectrometer to produce a signal corresponding to the mass of at least one peptide cleavage product; e) using the signal corresponding to the peptide cleavage products to identify the presence of clostridial neurotoxin serotype E; and f) quantitating the amount of proteolytic cleavage of the peptide substrate for the clostridial neurotoxin serotype by mass spectrometry using a stable isotope labeled internal standard that has identical sequence to a cleavage product, wherein the amount of active toxin of BoNT/E in the sample is about 0.05-0.1 pg or more. In certain embodiments, the amount of active toxin of BoNT/E in the sample is about 0.05, 0.06, 0.07, 0.08, 0.09, 0.1, 0.11, 0.12, 0.13, 0.14, 0.15, 0.16, 0.17, 0.18, 0.19 pg or more.

(82) The invention also features in other non-limiting examples methods for diagnosing infection by clostridial botulinum neurotoxin serotype E (BoNT/E) in a sample comprising the steps of a) mixing a sample that may comprise serotype E of clostridial neurotoxins with a peptide substrate selectively recognized by BoNT/E, such that at least a portion of the amount of the substrate is proteolytically cleaved to produce a mixture comprising uncleaved substrate and peptide cleavage products; b) analyzing the mixture on a mass spectrometer to produce a signal corresponding to the mass of at least one peptide cleavage product; c) using the signal corresponding to the peptide cleavage products to identify the presence of clostridial neurotoxin serotype E; and d) quantitating the amount of proteolytic cleavage of the peptide substrate for the clostridial neurotoxin serotype by mass spectrometry, wherein the amount of active toxin of BoNT/E in the sample is about 0.05-0.1 pg or more. In certain embodiments, the amount of active toxin of BoNT/E in the sample is about 0.05, 0.06, 0.07, 0.08, 0.09, 0.1, 0.11, 0.12, 0.13, 0.14, 0.15, 0.16, 0.17, 0.18, 0.19 pg or more.

(83) Suitable mass spectrometry techniques can include matrix-assisted laser desorption-ionization time of flight mass spectrometry (MALDI-TOF-MS) and high performance liquid chromatography-electrospray ionization-tandem mass spectrometry (LC-ESI-MS/MS). Other mass spectroscopy techniques may also be employed for analysis of the BoNT/E product peptides. MS-based techniques such as MALDI-TOF-MS can allow screening of hundreds of samples per hour for BoNT/E enzymatic activity. While LC-ESI-MS/MS is much slower than MALDI-TOF-MS, it still offers high specificity and sensitivity and allows accurate quantitative measurements of the levels of BoNT. The MALDI-TOF-MS screening method has been used to detect specific fragments of peptides cleaved by BoNT/E in a pure reaction buffer or within various environmental and clinical type matrices such as milk, sausage, serum and stool spiked with BoNT/E complex. The MALDI-TOF-MS and LC-ESI-MS/MS screening methods can be used to detect specific fragments of peptides cleaved by E in a pure reaction buffer or within various environmental and clinical type matrices, as described herein.

(84) In the methods of the present invention, a target sample can be mixed with the peptide serving as a substrate for proteolytic activity of a botulinum neurotoxin, in particular BoNT/E. After a digestion period of from a few minutes to a few hours, preferably from about 30 minutes to about 2 hours, the product peptides (both an N-terminated fragment and a C-terminated fragment) can be recovered from any matrix using affinity tags on the substrate peptide and therefore unequivocally identified and quantified by mass spectroscopy.

(85) The methods of the present invention are fast, sensitive and specific and can be used as a high-throughput assay for the detection and quantification of BoNT/E activity in a variety of sample types.

(86) Affinity tags such as biotin may be attached on both sides of the cleavage site on the substrate such that after cleavage the products from the cleavage can be collected and separated from any matrix and sample contaminants, as well as, from the toxins. The recovery of both unreacted substrate and cleavage products can be used for calibration and control experiment purposes.

(87) The mass spectroscopy approach to analysis of the products allows a quantification of the amount of neurotoxin since the ratio of the products to the internal standard can be determined, the length of time of digestion will be known and the amount of internal standard will be known so that a calibration curve may be calculated and allow the quantification of the amount of neurotoxin.

(88) The methods of the present invention are useful for detecting small amounts of BoNT/E in a rapid, animal-free assay. The methods of the present invention are contemplated to be performed with reaction volumes from 10-20 L, preferably 20 L for example, consisting of BoNTE, reaction buffer, and peptide substrate, with detection of the cleavage of the peptide substrate through mass spectrometry. However, there may be a need to perform this assay with clinical samples in larger volumes (100 L to 1 mL) and such an additional step may be preferred in those instances. When working with clinical or food samples, there are abundant proteases which cleave either the peptide substrate or other proteases, producing a large number of uninteresting peptides. Therefore, it becomes necessary to pursue a method to capture and concentrate BoNT from a larger volume (100 L to 1 mL) of a clinical or other type of sample. Because mass spectrometers detect peptides based on their ionization efficiencies, it is critical to analyze a sample which preferentially contains an enriched sample of the peptides of interest in order for those peptides to ionize at their optimum level. Therefore, an affinity method of selecting for the peptides generated from the cleavage of the peptide substrate by BoNT/E may be used for ultimate detection in complex biological samples. Biotinylated peptides may be used in conjunction with avidin affinity chromatography to purify the peptides prior to the mass spectrometric analysis. It should be noted that other tagging platforms could be used here as well such as, e.g., fluorescent tagged peptides (see, e.g., U.S. Pat. No. 6,803,475); however, the avidin-biotin bond is one of the strongest bonds in biology.

(89) The methods of the invention are highly sensitive. For BoNT/E, as little as 0.05-0.1 mouse LD.sub.50/ml of BoNT/E in a sample can yield sufficient quantities of product peptides to be clearly detected by MALDI-TOF-MS. This is 100 times lower than can be detected by the mouse bioassay. Additionally, this small amount of toxin can be detected and the toxin type differentiated in a single measurement.

(90) The quantification of the amount of active BoNT/E in a sample is important. MALDI-TOF-MS is very rapid and is appropriate for relative quantification, but has limited capability for absolute quantification since the spectra tend to show larger variations than other mass spectral techniques. Thus, a LC-ESI/MS/MS technique that can quantitatively detect BoNT/E activities has been developed. This method is highly specific, since correct identification of the BoNT product peptides depends on both a retention time match with respect to standards, and on a chemical-specific fragmentation (a precursor to product ion multiple reaction monitoring (MRM) transition) monitored by tandem MS. To further enhance specificity, two separate MRM transitions are monitored for each peptide. In addition, the LC-ESI/MS/MS technique can be very sensitive, because it uses a triple quadrupole-based instrument. Absolute quantification of the BoNT/E product peptides is achieved using a stable isotope labeled cleavage product peptide (any other stable peptide which is neither a substrate nor an cleavage product may be used) as an internal standard to correct for any instrumental variations. Typical LC-ESI/MS/MS chromatograms were obtained during the quantification of the activity of BoNT E along with a standard curve for one of the product peptides. Based on obtained data, it is estimated that it should be possible to achieve absolute quantification to within less than 10-20% of the true BoNT/E activity level. Identical LC-ESI/MS/MS strategies can be used to quantify each of the BoNT serotypes. The amount of product peptides produced in a BoNT/E reaction may be correlated to the amount of active toxin in the sample.

(91) The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the present invention, and are not intended to limit the scope of what the inventors regard as their invention.

EXAMPLES

(92) The SEQ ID NOS for each of the peptides of the examples are as follows:

(93) SEQ ID NO: 10 is Pep-1

(94) SEQ ID NO: 11 is Pep-2

(95) SEQ ID NO: 12 is Pep-3

(96) SEQ ID NO: 13 is Pep-4

(97) SEQ ID NO: 14 is Pep-5

(98) SEQ ID NO: 15 is Pep-6

(99) SEQ ID NO: 16 is Pep-7

(100) SEQ ID NO: 2 is Pep-8

(101) SEQ ID NO: 17 is Pep-9

(102) SEQ ID NO: 5 is Pep-10

(103) SEQ ID NO: 18 is Pep-11

(104) SEQ ID NO: 19 is Pep-12

(105) SEQ ID NO: 20 is Pep-13

(106) SEQ ID NO: 21 is Pep-14

(107) SEQ ID NO: 22 is Pep-15

(108) SEQ ID NO: 23 is Pep-16

(109) SEQ ID NO: 24 is Pep-17

(110) SEQ ID NO: 25 is Pep-18

(111) SEQ ID NO: 26 is Pep-19

(112) SEQ ID NO: 6 is Pep-20

(113) SEQ ID NO: 27 is Pep-21

(114) SEQ ID NO: 28 is Pep-22

(115) SEQ ID NO: 29 is Pep-23

(116) SEQ ID NO: 30 is Pep-24

(117) SEQ ID NO: 31 is Pep-25

(118) SEQ ID NO: 32 is Pep-26

(119) SEQ ID NO: 33 is Pep-27

(120) SEQ ID NO: 34 is Pep-28

(121) SEQ ID NO: 35 is Pep-29

(122) SEQ ID NO: 36 is Pep-30

(123) SEQ ID NO: 37 is Pep-31

(124) SEQ ID NO: 38 is Pep-32

(125) SEQ ID NO: 39 is Pep-33

(126) SEQ ID NO: 40 is Pep-34

(127) SEQ ID NO: 41 is Pep-44

(128) SEQ ID NO: 42 is Pep-45

(129) SEQ ID NO: 43 is Pep-46

(130) SEQ ID NO: 44 is Pep-47

(131) SEQ ID NO: 45 is Pep-48

(132) SEQ ID NO: 46 is Pep-49

(133) SEQ ID NO: 47 is Pep-50

(134) SEQ ID NO: 48 is Pep-51

(135) SEQ ID NO: 49 is Pep-52

(136) SEQ ID NO: 50 is Pep-53

(137) SEQ ID NO: 51 is Pep-54

(138) SEQ ID NO: 52 is Pep-55

(139) SEQ ID NO: 53 is Pep-56

(140) SEQ ID NO: 54 is Pep-57

(141) SEQ ID NO: 55 is Pep-58

(142) SEQ ID NO: 56 is Pep-59

(143) SEQ ID NO: 57 is Pep-60

(144) SEQ ID NO: 58 is Pep-61

(145) SEQ ID NO: 59 is Pep-62

(146) SEQ ID NO: 60 is Pep-63

(147) SEQ ID NO: 61 is Pep-64

(148) SEQ ID NO: 62 is Pep-65

(149) Optimization of Peptide Substrates for the Sensitive Detection of Type E Botulinum Neurotoxin by the Endopep-MS Assay

(150) The purpose of the experiments described herein are to optimize a peptide substrate used in the mass spectrometry-based Endopep-MS assay, for the sensitive detection of type E botulinum neurotoxin (BoNT/E). FIG. 1 shows the sequence of the native protein substrate of BoNT/E, SNAP-25 (top; SEQ ID NO:1) and the scheme of Endopep-MS assay for the detection of BoNTs using a peptide substrate (bottom).

(151) The results described herein demonstrate that the newly developed peptide substrates were considerably improved when compared to the established substrate for BoNT/E detection.

(152) A fast and sensitive mass spectrometry method, Endopep-MS (FIG. 1), has been developed in our laboratory. Based on the proteolytic activity, BoNT serotypes can be determined by MS, detecting the specific cleavage products of peptide substrates representing or mimicking the sequence of the BoNT in vivo targets, SNAP-25 (FIG. 1) or other SNARE proteins. The sequence of SNAP-25 is represented by SEQ ID NO: 1, as shown supra.

(153) As discussed above, the present invention features peptide substrates that are selectively recognized by BoNT/E. In exemplary embodiments, the peptide substrate is represented by SEQ ID NO:3, shown below. The bold and underlined residues are the cleavage site of BoNT/E substrates.

(154) TABLE-US-00007 SEQIDNO:3 X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5LX.sub.6GX.sub.7EIDTX.sub.8NRQX.sub.9DX10IX.sub.11X.sub.12KAX.sub.13X.sub.14X.sub.15 X.sub.16X.sub.17,
wherein:

(155) X.sub.1, X.sub.2 or X.sub.3: W, 1-Nal (1-Naphthylalanine), 2-Nal, F, Y, I, L, Nle (norleucine), A, or any other hydrophobic residue;

(156) X.sub.4: A or G;

(157) X.sub.5: N, K, A, or G;

(158) X.sub.6: No residue, or RHMALDM;

(159) X.sub.7: N or Q;

(160) X.sub.8: Q, R, K or any other positively charged residue;

(161) X.sub.9: I, F, K, or R;

(162) X.sub.10: R, homoArg, Cit (citrulline) or Orn (ornithine);

(163) X.sub.11: M or Nle;

(164) X.sub.12: A, F, G, I;

(165) X.sub.13: D, K, R or any other positively charged residue;

(166) X.sub.14: S, K, R or any other positively charged residue;

(167) X.sub.15: N, K, R or any other positively charged residue;

(168) X.sub.16: K, R or any other positively charged residue; and

(169) X.sub.17: R, TR; native or amidated C-terminus.

(170) RHMALDM corresponds to residues 161-167 of SEQ ID NO:1 (SNAP-25).

(171) In other exemplary embodiments, the peptide substrate is represented by SEQ ID NO: 4, shown below.

(172) TABLE-US-00008 SEQIDNO:4 (X.sub.0).sub.m-(SEQIDNO:3)-(X.sub.18).sub.n,
wherein,
m: 0 or 1;
n: 0 or 1;
X.sub.0: ARENEMDENLEQVS; and
X.sub.18: IDEANQRATKMLGSG.

(173) ARENEMDENLEQVS corresponds to residues 141-154 of SEQ ID NO:1.

(174) IDEANQRATKMLGSG corresponds to residues 192-206 of SEQ ID NO:1.

(175) SEQ ID NO:4 is derived based on extensive experiments that show cleavage efficiency of peptides with the native sequence of SNAP-25 (141-206), SNAP-25 (156-206), SNAP-25 (156-190) (see examples section below).

(176) In another set of experiments, the quantitation of the hydrolysis of Peptide#62, shown above, cleaved by BoNT/E spiked in stool and serum matrices was examined. The results are shown in FIG. 5. FIG. 5 shows detection of the cleavage product of the Peptide#62 cleaved by BoNT/E complex spiked in stool matrix (0.5 mL) at various concentrations. Cleavage reaction: 20 uL reaction solution, 37 C. for 30 min. LOD: 0.1 mLD50/mL (e.q. 1 pg/mL) BoNT/E complex (not activated by trypsinization before assay) in serum or stool samples. (Peptide#62, 37 C. for 4 hr).

(177) To further improve the sensitivity of the Endopep-MS assay, experiments were carried out to optimize the current peptide substrate (Pep8, shown below as SEQ ID NO:2) for the detection of BoNT/E. SEQ ID NO:2 corresponds to SNAP-25 positions 156-190 (S. R. Kalb et al. International Journal of Mass Spectrometry (2008), 278, 101-108; b) S. R. Kalb et al. The Botulinum J. (2012), 2(2), 119-134). The BonNT/E cleavage site is highlighted in bold and underlined.

(178) TABLE-US-00009 SEQIDNO:2 IIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKT

(179) Pep10, shown in Table 4, and below as SEQ ID NO:5, corresponds to SNAP25 positions 156-186, and has previously been used in the Endopep-MS assay (see U.S. Pat. No. 7,611,856 B2; S. R. Kalb et al. Anal Biochem (2006), 351, 84-92). The BonNT/E cleavage site is highlighted in bold.

(180) TABLE-US-00010 SEQIDNO:5 IIGNLRHMALDMGNEIDTQNRQIDRIMEKAD

(181) Investigation of peptide truncation, deletion, single and multiple mutations; resulted in optimal peptides that considerably improve the MS detection sensitivity of the BoNT/E cleavage products.

(182) Peptides were synthesized by a solid phase peptide synthesis method using Fmoc chemistry. Endopep-MS assays were carried out in a 20 mL reaction volume containing peptide substrate, BoNT/E toxins of various concentrations, and other reaction components. For samples in matrix, the toxin was spiked into serum or stool extract, and purified by BoNT specific antibody immobilized on streptavidin beads, followed by an activity assay. MS response of the cleavage products was characterized by MS analysis on an Applied Biosystems 5800 MALDI-TOF/TOF instrument.

(183) Optimal Peptide Substrate of BoNT/E Determined by Truncation, Deletion and Mutation

(184) As shown in Table 1 below, extending or truncating either the N- or C-terminal sequence of the current peptide (Pep-8; SEQ ID NO:2) did not generate improved substrates. Table 1 shows relative production of the cleavage product from the hydrolysis of N- and C-terminal truncated peptide substrates by BoNT/E toxins.

(185) TABLE-US-00011 TABLE1 SNAP- CT- NT- 25 pro- pro- Pep- posi- duct duct tide tion Sequence (%) (%) Pep- 141- AREMEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG 100 1 205 Pep- 151- EQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG 75 2 206 Pep- 156- IIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG 89 3 206 Pep- 161- RHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG 28 4 206 Pep- 166- DMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG 19 5 206 Pep- 171- IDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG 0 6 205 Pep- 156- IIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG 100 7 205 Pep- 156- IIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKT 100 8* 190 Pep- 156- IIGNLRHMALDMGNEIDTQNRQIDRIMEKADSN 81 9 188 Pep- 156- IIGNLRHMALDMGNEIDTQNRQIDRIMEKAD 68 10 186 Pep- 156- IIGNLRHMALDMGNEIDTQNRQIDRIMEKA 77 11 185 Pep- 156- IIGNLRHMALDMGNEIDTQNRQIDRIMEK 58 12 184 Pep- 156- IIGNLRHMALDMGNEIDTQNRQIDRIME 15 13 183 Pep- 156- IIGNLRHMALDMGNEIDTQNRQIDRIM 10 14 182 *Pep-8 is the BoNT/E substrate currently used in Endopep-MS assay. RI: BoNT/E cleavage site.

(186) Addition of ile at the N-terminal of SEQ ID NO: 2 (Pep-8) slightly increased its hydrolysis rate. C-terminal extension with R or RI improved the detection of CT-product by 20 fold. This is presumably due to elevated ionization efficiency of the cleavage product during mass spectrometry analysis, associated with the incorporation of a positively charged Arg residue. Table 5 below illustrates these results. Table 2 shows relative production of the N- or C-terminal product cleaved from truncated or modified peptide substrates by BoNT/E toxin. The bold and italicized red letter indicates the residue not present in the original SNAP-25 sequence.

(187) TABLE-US-00012 TABLE2 CT-product NT-product Peptide Sequence (%) (%) Pep-15 GNLRHMALDMGNEIDTQNRQIDRIMEKADSNKT 60 Pep-16 IGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKT 73 Pep-8 IIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKT 100 Pep-17 GIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKT 81 Pep-18 IIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKT 123 Pep-19 IIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRI 2460 100 Pep-20 IIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTR 2678 117 Pep-18 IIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKT 123 130 Pep-21 IIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSN 24 52 Italic and bold letter: the residue not present in the original SNAP-25 sequence, or substituted/mutated residue.

(188) Deletion studies revealed that seven internal residues (RHMALDM) within Pep-20 (SEQ ID NO:6) can be removed without significant negative impact on substrate cleavage. It was also found that three N-terminal residues (NKT) can be omitted as long as the Arg residue is retained on the N-terminus. Moreover, shortened peptides will reduce difficulty and cost in preparation.

(189) TABLE-US-00013 SEQIDNO:6 IIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTR

(190) Table 3, shown below, shows relative production of the N- or C-terminal product cleaved from internally deleted peptides by BoNT/E toxin. The underscore represents the amino acid residues are deleted from the peptide 20 (SEQ ID NO:6).

(191) TABLE-US-00014 TABLE3 RelativeproductionoftheN-orC-terminalproductcleavedfrom internallydeletedpeptidesbyBoNT/Etoxin. CT-product NT-product Peptide Sequence (%) (%) Pep-20 IIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTR 100 Pep-22 IIIGNLRHMALDMGNE_____RQIDRIMEKADSNKTR 6 Pep-23 IIIGNLRHMAL_____IDTQNRQIDRIMEKADSNKTR 17 Pep-24 IIIGNL_____DMGNEIDTQNRQIDRIMEKADSNKTR 90 Pep-25 IIIGN______DMGNEIDTQNRQIDRIMEKADSNKTR 19 Pep-26 IIIG_______DMGNEIDTQNRQIDRIMEKADSNKTR 43 Pep-27 III________DMGNEIDTQNRQIDRIMEKADSNKTR 30 Pep-28 IIIGNL________NEIDTQNRQIDRIMEKADSNKTR 2 Pep-29 IIIGNL_______GNEIDTQNRQIDRIMEKADSNKTR 88 Pep-30 IIIGNL______MGNEIDTQNRQIDRIMEKADSNKTR 33 Pep-31 IIIGNL____LDMGNEIDTQNRQIDRIMEKADSNKTR 53 Pep-29 IIIGNL_______GNEIDTQNRQIDRIMEKADSNKTR 100 100 Pep-32 IIIGNL_______GNEIDTQNRQIDRIMEKADSNKR 133 136 Pep-33 IIIGNL_______GNEIDTQNRQIDRIMEKADSNR 104 84 Pep-34 IIIGNL_______GNEIDTQNRQIDRIMEKADSR 20 36 Underscore: the amino acid residudues are deleted from the peptide-20.
Further Improvement was Accomplished by Single or Multiple Substitutions/Mutations

(192) Next, the effect of single or multiple substitutions/mutations was examined. FIG. 2 is a table (Table 4) that shows the effect of single amino acid mutations on the detection of cleavage product of mutated peptide-32 by BoNT/E. X represents norleucine. FIG. 2 shows cleavage of the peptides with N-terminal hydrophobic residues. O.sub.1: 1-Nal.

(193) New peptides were developed as considerably improved substrates for BoNT/E detection using multiple amino acid mutations, introduction of N-terminal hydrophobic cluster and incorporation of unnatural amino acid residues. Table 5, below, shows the effect of multiple mutations. In Table 5, hR: homoarginine; O.sub.1: 1-Nal; O.sub.2: 2-Nal.

(194) TABLE-US-00015 TABLE5 CT- Pep- product tide Sequence (%) Pep-44 IIIGNLGNEIDTQNRQIDRIMEKAKSNKR 100 Pep-45 IIIAKLGNEIDTRNRQIDRIMEKADSNKR 101 Pep-46 IIIGKLGNEIDTRNRQIDRIMEKADSNKR 103 Pep-47 IIIAKLGQEIDTRNRQKDRIMEKADSNKR 152 Pep-48 IIIAKLGNEIDTQNRQKDRIMAKADSNKR 122 Pep-49 IIIAKLGNEIDTRNRQKDRIMAKADSNKR 137 Pep-50 IIIAKLGNEIDTRNRQKDRIMEKAKSKKR 44 Pep-51 IIIGNLGNEIDTQNRQIDRIKAKAKSKKR 131 Pep-52 IIIGNLGNEIDTQNRQIDRIMAKAKSKKR 192 Pep-53 IIIGNLGNEIDTQNRQIDRIMEKARRKKR 128 Pep-54 IIIGNLGNEIDTQNRQIDRIMEKAKRKKR 132 Pep-55 IIIGNLGNEIDTQNRQIDRIMEKAKKKKR 134 Pep-56 IIIGNLGNEIDTQNRQIDRIMEKAKSKKR 123 Pep-57 IIIGNLGNEIDTQNRQIDhRIMAKAKSKKR 172 Pep-58 IIIGNLGNEIDTQNRQIDhRIMAKAKSKKR 146 Pep-59 IIIGNLGNEIDTQNRQIDhRIMAKAKSKKRRR 49 Pep-60 IIIGNLGNEIDTQNRQIDhRIMAKAKSKKR- 165 NH.sub.2 Pep-61 WWWGNLGNEIDTQNRQIDhRIMAKAKSKKR- 156 NH.sub.2 Pep-62 WWWAKLGQEIDTRNRQKDhRIMAKADSNKR- 314 NH.sub.2 Pep-63 O.sub.1O.sub.1O.sub.1AKLGQEIDTRNRQKDhRIMAKADSNKR- 302 NH.sub.2 Pep-64 O.sub.2O.sub.2O.sub.2AKLGQEIDTRNRQKDhRIMAKADSNKR- 288 NH.sub.2 Pep-65 O.sub.2O.sub.2O.sub.2AKLGQEIDTRNRQKDhRIMAhRADSNKR- 302 NH.sub.2 X: norleucine; hR: homoarginine; O.sub.1: 1-Nal; O.sub.2: 2-Nal
Comparison of the Newly Optimized Substrate with the Old Peptide

(195) Table 6, below, shows a comparison of the cleavage of currently used and newly developed peptide substrates by BoNT/E as described herein.

(196) TABLE-US-00016 TABLE 6 Toxin Amount CT-product Relative Peptide Type (mLD.sub.50) (Peak ratio) product Pep-8 unactivated 100 0.40 1 Pep-52 unactivated 1 2.35 581 Pep-8 activated 0.15 1.07 1 Pep-52 activated 0.0016 5.48 511 CT-product was determined by the peak ratio of the cleavage product versus an internal standard in a mass spectrometry spectrum.

(197) An optimal peptide displayed around a 300-500 fold improvement in the detection of both regular and trypsin activated BoNT/E, for example a 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490 or more improvement. Preferably, an optimal peptide displayed around 500-fold improvement on the detection of both regular and trypsin activated BoNT/E toxins. FIG. 4 shows detection of various amounts of BoNT/E spiked in 0.5 mL of serum or stool matrices. An LOD of 0.1 mLD50/mL (1 pg/mL or 5.5 attomole/mL) was achieved by using a new peptide substrate of BoNT/E in biological matrices.

(198) Taken together, the experiments described herein demonstrate optimization of the peptide substrate used in the Endopep-MS assay for the BoNT/E detection by mutation, truncation and deletion studies. New peptide(s) show significant improvement over the currently used substrate. The limit of detection for the toxins in serum, stool and food samples using the new substrate is 0.1 mouseLD.sub.50/mL, 10-fold lower than that measured by traditional mouse assay.

EQUIVALENTS

(199) Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.

INCORPORATION BY REFERENCE

(200) Each of the applications and patents cited in this text, as well as each document or reference cited in each of the applications and patents (including during the prosecution of each issued patent; application cited documents), and each of the PCT and foreign applications or patents corresponding to and/or claiming priority from any of these applications and patents, and each of the documents cited or referenced in each of the application cited documents, are hereby expressly incorporated herein by reference. More generally, documents or references are cited in this text, either in a Reference List before the claims, or in the text itself; and, each of these documents or references (herein-cited references), as well as each document or reference cited in each of the herein-cited references (including any manufacturer's specifications, instructions, etc.), is hereby expressly incorporated herein by reference.