Fully human antibodies and fragments recognizing human c-Met

10407503 ยท 2019-09-10

Assignee

Inventors

Cpc classification

International classification

Abstract

Human antibody fragments against c-Met have been identified through phage display technology. The high affinity and low immunogenicity make them very useful for both in vivo and in vitro applications. These novel human antibodies can greatly help the study of drug resistance in EGFR targeted therapies, and improve the diagnosis and treatment of cancer patients.

Claims

1. An isolated human anti-c-Met antibody comprising a human heavy chain variable domain and a human light chain variable domain, wherein the anti-c-Met antibody is selected from a group consisting of: an anti-c-Met antibody comprising a human heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1 and a human light chain variable domain comprising the amino acid sequence of SEQ ID NO:9; an anti-c-Met antibody comprising a human heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:2 and a human light chain variable domain comprising the amino acid sequence of SEQ ID NO:10; an anti-c-Met antibody comprising a human heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:3 and a human light chain variable domain comprising the amino acid sequence of SEQ ID NO:11; an anti-c-Met antibody comprising a human heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:4 and a human light chain variable domain comprising the amino acid sequence of SEQ ID NO:12; an anti-c-Met antibody comprising a human heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:5 and a human light chain variable domain comprising the amino acid sequence of SEQ ID NO:13; an anti-c-Met antibody comprising a human heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:6 and a human light chain variable domain comprising the amino acid sequence of SEQ ID NO:14; an anti-c-Met antibody comprising a human heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:7 and a human light chain variable domain comprising the amino acid sequence of SEQ ID NO:15; and an anti-c-Met antibody comprising a human heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:8 and a human light chain variable domain comprising the amino acid sequence of SEQ ID NO:16.

2. The isolated human anti-c-Met antibody of claim 1, wherein the antibody or antigen binding fragment thereof is a diabody.

3. The isolated human anti-c-Met antibody of claim 2, wherein the diabody is a cys-diabody.

4. The isolated human anti-c-Met antibody of claim 3, wherein the cys-diabody comprises the amino acid sequence SEQ ID NOS:17, 18, 19, 20, 21, 22, 23, or 24.

5. The isolated human anti-c-Met antibody of claim 1, wherein the antibody is a single-chain variable fragment (ScFv).

6. The isolated human anti-c-Met antibody of claim 5, wherein the ScFv comprises the amino acid sequence SEQ ID NOS:25, 26, 27, 28, 29, 30, 31, or 32.

7. The isolated human anti-c-Met antibody of claim 1, wherein the antibody or antigen binding fragment thereof is a minibody or a triabody.

8. The isolated human anti-c-Met antibody of claim 1, wherein the antibody or antigen binding fragment thereof is a fully human antibody.

9. The isolated human anti-c-Met antibody of claim 1, wherein the antibody or antigen binding fragment thereof is chimeric.

10. The isolated human anti-c-Met antibody of claim 1, wherein the antibody or antigen binding fragment thereof is conjugated to a cytotoxic agent.

11. The isolated human anti-c-Met antibody of claim 10, wherein the cytotoxic agent is a chemotherapeutic agent.

12. The isolated human anti-c-Met antibody of claim 11, wherein the chemotherapeutic agent is selected from the group consisting of gemcitabine, carboplatin, taxol, and paclitaxel.

13. The isolated human anti-c-Met antibody of claim 1, wherein the antibody or antigen binding fragment thereof is conjugated to a fluorescent molecule.

14. The isolated human anti-c-Met antibody of claim 1, wherein the antibody or antigen binding fragment thereof is radiolabeled.

15. The isolated human anti-c-Met antibody of claim 14, wherein the radiolabel is an iodine radiolabel.

16. The isolated human anti-c-Met antibody of claim 1, wherein the antibody or antigen binding fragment thereof has an affinity between 0.3 nM and 9 nM to c-Met.

17. A pharmaceutical composition comprising the antibody isolated human anti-c-Met antibody of claim 1 and a physiologically acceptable carrier.

18. The pharmaceutical composition of claim 17, wherein the composition is administered by parenteral, subcutaneous, intraperitoneal, intrapulmonary, or intranasal administration.

19. The pharmaceutical composition of claim 18, wherein the parenteral administration comprises intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration.

20. The pharmaceutical composition of claim 17, wherein the composition is co-administered with a cytotoxic agent.

21. A method of diagnosing a c-Met expressing cancer in a subject comprising administering an antibody conjugate to the subject and detecting an overexpression of c-Met in the subject, wherein the antibody conjugate comprises the antibody of claim 1 and a detectable label, wherein overexpression of c-Met in the subject is indicative of the presence of the cancer .

22. A method of treating a c-Met expressing patient for cancer, the method comprising administering to the patient an effective amount of the anti-c-Met antibody of claim 1.

23. The method of claim 22, further comprising administering to the patient an effective amount of at least one additional anti-cancer agent.

24. The method of claim 22, wherein the at least one additional anti-cancer agent is selected from the group consisting of platinum-based chemotherapy drugs, taxanes, tyrosine kinase inhibitors, anti-EGFR antibodies, anti-ErbB2 antibodies, and combinations thereof.

25. The method of claim 22, wherein the patient is human or mammal.

26. The isolated antibody of claim 1, wherein the anti-cMet antibody has a 6-histidine tag.

27. The isolated antibody of claim 26, wherein the 6-histidine tag is enzymatically cleaved off after purification of the antibody.

28. The isolated antibody of claim 1, wherein the anti-cMet antibody has a Myc tag.

29. The isolated antibody of claim 28, wherein the Myc tag is enzymatically cleaved off after purification of the antibody.

30. The isolated antibody of claim 1, wherein the anti-cMet antibody has a Myc tag and a 6-Histidine tag.

31. The isolated antibody of claim 30, wherein the Myc tag and 6-Histidine tag is enzymatically cleaved off after purification of the antibody.

32. The isolated antibody of claim 30, wherein the anti-cMet antibody has a linker, a Myc tag, and a 6-Histidine tag, wherein the sequence of the linker, the Myc tag, and the 6-Histidine tag comprises SEQ ID NO: 81.

33. The anti-c-Met diabody of claim 2 wherein the heavy chain variable domain sequence and light chain variable domain sequence are linked by a linker comprising SEQ ID NO: 82.

34. The anti-c-Met scFv antibody of claim 5 wherein the heavy chain variable domain sequence and light chain variable domain sequence are linked by a linker comprising SEQ ID NO: 81.

35. The isolated antibody of claim 1, wherein the anti-cMet antibody has one or more terminal cysteines.

36. The isolated antibody of claim 35, wherein one or more terminal cysteines is labeled with a detectable molecule comprising a fluorophore, a radio label, a luminescent label, a chemoluminescent label, or a spin label.

37. The method of claim 21, wherein the cancer is lung cancer.

38. The method of claim 37 wherein the lung cancer is non-small cell lung cancer.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 depicts SEQ ID NOS:1-8. SEQ ID NOS:1-8 are the heavy chain variable domain sequences of the c-Met antibodies or antigen binding fragments thereof. Exemplary HCDRs and LCDRs of this invention are underlined.

(2) FIG. 2 depicts SEQ ID NOS:9-16. SEQ ID NOS:9-16 are the light chain variable domain sequences of the c-Met antibodies or antigen binding fragments thereof. Exemplary HCDRs and LCDRs of this invention are underlined.

(3) FIG. 3 depicts SEQ ID NOS:17-24. SEQ ID NOS:17-24 are the diabody sequences of the c-Met antibodies or antigen binding fragments thereof. Exemplary HCDRs and LCDRs of this invention are underlined.

(4) FIG. 4 depicts SEQ ID NOS:24-32. SEQ ID NOS:25-32 are the scFv sequences of the c-Met antibodies or antigen binding fragments thereof. Exemplary HCDRs and LCDRs of this invention are underlined.

(5) FIG. 5A-FIG. 5C depicts the phage flow cytometry experiments of A12, C2, E9, F1, F11, G1, H2, H5 show they can bind to cell surface MET.

(6) FIG. 6A-FIG. 6C depicts the binding curves of C2, H2 and H5 cys-diabodies on Hcc827-GR6 cells.

(7) FIG. 7A-FIG. 7D depicts MTS assays show different effects of C2, H2 and H5 cys-diabodies on the growth of the sensitive Hcc827 cells and the resistant Hcc827-GR6 cells, with or without 1 M of gefitinib.

(8) FIG. 8A-FIG. 8D depicts the use of cys-diabodies for use in treatment and detection of disease and the use of antibody fragments for nano-applications. FIG. 8A depicts the acquired drug resistance of cancer cells. FIG. 8B depicts the structure of a scFv, diabody, minibody, scFV-Fc, and intact antibody and their relative tumor uptakes and activity in blood compared to their injected dose. FIG. 8C depicts a nanoparticle containing an antibody, a magneto nano-sensor that can be used in in vitro detecting assays, and in vivo diagnostic imaging with an antibody. FIG. 8D depicts an oxidized and reduced cys-diabody.

(9) FIG. 9 depicts the scheme of phage display technology and detection of novel antibodies from a phage display library.

(10) FIG. 10 depicts MET staining by flow cytometry.

(11) FIG. 11 depicts the amount of MET protein captured by the anti-c-Met cys-diabody.

(12) FIG. 12A-FIG. 12C depicts anti-c-Met cys-diabody binding curves.

(13) FIG. 13 depicts in vivo imaging using a anti-c-Met cys-diabody scanned at 4 hours post injection. The image was processed with 2 mm Gaussian filter.

(14) FIG. 14A-FIG. 14C depicts the normalized total activities of anti-c-Met cys-diabodies.

(15) FIG. 15 depicts ELISA results of the C2, H2, and H5 cys-diabodies to human mouse MET proteins.

(16) FIG. 16A-FIG. 16B depicts PET scans and ex vivo biodistribution studies that show significant difference between the Hcc827-GR6 and the Hcc827 parental tumors.

DETAILED DESCRIPTION OF THE INVENTION

(17) Overview

(18) EGFR targeted therapies, such as gefitinib or erlotinib treatment, have shown great potential in some non-small cell lung cancer patients. But such targeted therapies are only effective in small subsets of patients, and many patients that do respond to the treatment will eventually develop drug resistance. Better prediction and evaluation of drug resistance is needed for better treatment. Some biomarkers, such as MET, have been found to be correlated with the response to the targeted therapies (FIG. 8). Many different technologies can be employed to study and utilize these biomarkers to benefit cancer patients, such as antibody labeled nanoparticles and magneto nanosensors, and antibody based PET imaging (FIG. 8).

(19) These technologies all require good antibodies in the right formats. Different antibody fragments have very different size, affinity and pharmacokinetics. While antibodies with Fc domains may be good for in vitro detection purposes, small fragments such as diabodies may be better for in vivo imaging because of shorter clearance times. FIG. 8 shows a summary of typical pharmacokinetic properties of 4 different antibody fragments and the intact antibody. We also engineered a special diabody called cys-diabody, which has a extra cysteine at the C-terminal of each polypeptide chain. These cysteines usually form a disulfide bond in the dimer, but are easily reduced after mild reduction for site specific labeling (FIG. 8).

(20) Furthermore, while EGFR targeted therapies show great potential in some non-small cell lung cancer patients, their limited response rate calls for better prediction and evaluation of drug resistance. Antibodies against important biomarkers such as MET are very valuable for drug resistance evaluation and therapeutic applications. We successfully identified several novel human antibodies against MET from human scFv phage display libraries. The selected scFv clones were then re-formatted in to cys-diabodies or scFv-Fcs and expressed in bacteria or CHO cells. By flow cytometry using Hcc827 cells, we confirmed these antibody fragments have high affinities, ranging from 0.6 nM to 9 nM. These antibodies were then characterized and studied for therapeutic and diagnostic applications. Certain of the anti-MET cys-diabodies show therapeutic effects on erlotinib resistant cell lines with MET amplification. In conclusion, these novel human antibodies with high affinity and low immunogenicity can greatly help the study of drug resistance in EGFR targeted therapies, and improve the diagnosis and treatment of cancer patients.

(21) Herein, the selection and characterization of several novel human scFv antibodies against human c-MET from a naive human scFv phage display library is described. scFv clones were confirmed to bind to cell surface target, and reformatted into cys-diabodies. Cys-diabodies have been successfully expressed in bacteria and tested for affinity. The low immunogenicity, high affinity and varied pharmacokinetic characteristics of these fully human antibody fragments give them great potential in both in vivo and in vitro applications.

Definitions

(22) The term inhibit means the ability to substantially antagonize, prohibit, prevent, restrain, slow, disrupt, eliminate, stop, reduce, or reverse the biological effects of c-Met.

(23) The term treating (or treat or treatment) means slowing, interrupting, arresting, controlling, stopping, reducing, or reversing the progression or severity of a symptom, disorder, condition, or disease, but does not necessarily involve a total elimination of all disease-related symptoms, conditions, or disorders. The terms treating, treatment, and therapy as used herein refer to curative therapy, prophylactic therapy, and preventative therapy.

(24) The term effective amount refers to the amount or dose of an antibody compound of the present invention which, upon single or multiple dose administration to a patient, provides the desired treatment or prevention. Therapeutically effective amounts of the present antibody compounds can comprise an amount in the range of from about 0.1 mg/kg to about 100 mg/kg per single dose. A therapeutically effective amount for any individual patient can be determined by the health care provider by monitoring the effect of the antibody compounds on a biomarker, such as cell surface c-Met in tumor or non-tumor tissues, tumor regression, etc. Analysis of the data obtained by these methods permits modification of the treatment regimen during therapy so that optimal amounts of antibody compounds, whether employed alone or in combination with one another therapeutic agent, are administered, and so that the duration of treatment can be determined as well. In this way, the dosing/treatment regimen can be modified over the course of therapy so that the lowest amounts of antibody compounds used alone or in combination that exhibit satisfactory tumor reducing effectiveness are administered, and so that administration of such compounds is continued only so long as is necessary to successfully treat the patient.

(25) The antibody compounds of the present invention can be used as medicaments in human medicine, administered by a variety of routes. Most preferably, such compositions are for parenteral administration. Such pharmaceutical compositions can be prepared by methods well known in the art. See, e.g., Remington: The Science and Practice of Pharmacy, 19.sup.th ed. (1995), A. Gennaro et al., Mack Publishing Co., and comprise one or more antibody compounds disclosed herein, and a pharmaceutically acceptable carrier, diluent, or excipient.

(26) The term tumor refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues. The terms cancer, cancerous, and tumor are not mutually exclusive as used herein.

(27) The terms cancer and cancerous refer to or describe the physiological condition in mammals that is typically characterized by aberrant cell growth/proliferation. Examples of cancers include, but are not limited to, carcinomas, lymphomas, blastomas, sarcomas, and leukemias. The terms cancer and cancerous further refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth. Examples of cancer include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular examples of such cancers include squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial carcinoma, salivary gland carcinoma, kidney cancer, renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma and various types of head and neck cancer. Mammal for purposes of treatment refers to any animal classified as a mammal, including humans, domestic and farm animals, nonhuman primates, and zoo, sports, or pet animals, such as dogs, horses, cats, cows, etc

(28) The term conjugate is used herein according to its broadest definition to mean joined or linked together. Molecules are conjugated when they act or operate as if joined.

(29) The term antibody is used in the broadest sense and specifically covers single anti-c-Met monoclonal antibodies (including agonist, antagonist, and neutralizing or blocking antibodies) and anti-c-Met antibody compositions with polyepitopic specificity. Antibody as used herein includes intact immunoglobulin or antibody molecules, polyclonal antibodies, multispecific antibodies (i.e., bispecific antibodies formed from at least two intact antibodies), antigen binding fragments of an antibody, and immunoglobulin fragments (such as Fab, F(ab).sub.2, or Fv), so long as they exhibit any of the desired agonistic or antagonistic properties described herein. The term antibody can also mean any antibody fragments and antigen binding fragments thereof wherein an antibody fragment or antigen binding fragment thereof comprise a portion of an intact antibody, generally the antigen binding or variable region of the intact antibody. Examples of antibody fragments include Fab, Fab, F(ab)2, and Fv fragments, diabodies, single chain antibody molecules, and multispecific antibodies formed from antibody fragments.

(30) Antibodies are typically proteins or polypeptides which exhibit binding specificity to a specific antigen. Native antibodies are usually heterotetrameric glycoproteins, composed of two identical light (L) chains and two identical heavy (H) chains. Typically, each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies between the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges. Each heavy chain has at one end a variable domain (V.sub.H) followed by a number of constant domains. Each light chain has a variable domain at one end (V.sub.L) and a constant domain at its other end; the constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light chain variable domain is aligned with the variable domain of the heavy chain. Particular amino acid residues are believed to form an interface between the light and heavy chain variable domains (Chothia et al., J. Mol. Biol., 186:651-663 (1985); Novotny and Haber, Proc. Natl. Acad. Sci. USA, 82:4592-4596 (1985)). The light chains of antibodies from any vertebrate species can be assigned to one of two clearly distinct types, called kappa and lambda, based on the amino acid sequences of their constant domains. Depending on the amino acid sequence of the constant domain of their heavy chains, immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG-1, IgG-2, IgG-3, and IgG-4; IgA-1 and IgA-2. The heavy chain constant domains that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively.

(31) The term variable is used herein to describe certain portions of the variable domains, which differ in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not usually evenly distributed through the variable domains of antibodies. It is typically concentrated in three segments called complementarity determining regions (CDRs) or hypervariable regions both in the light chain and the heavy chain variable domains. The more highly conserved portions of the variable domains are called the framework (FR). The variable domains of native heavy and light chains each comprise four FR regions, largely adopting a .beta.-sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the .beta.-sheet structure. The CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen binding site of antibodies [see Kabat, E. A. et al., Sequences of Proteins of Immunological Interest, National Institutes of Health, Bethesda, Md. (1987)]. The constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.

(32) The term monoclonal antibody as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally-occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to conventional (polyclonal) antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen.

(33) The monoclonal antibodies herein include chimeric, hybrid and recombinant antibodies produced by splicing a variable (including hypervariable) domain of an anti-c-Met antibody with a constant domain (e.g. humanized antibodies), or a light chain with a heavy chain, or a chain from one species with a chain from another species, or fusions with heterologous proteins, regardless of species of origin or immunoglobulin class or subclass designation, as well as antibody fragments (e.g., Fab, F(ab).sub.2, and Fv), so long as they exhibit the desired biological activity or properties. See, e.g. U.S. Pat. No. 4,816,567 and Mage et al., in Monoclonal Antibody Production Techniques and Applications, pp. 79-97 (Marcel Dekker, Inc.: New York, 1987).

(34) Thus, the modifier monoclonal indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler and Milstein, Nature, 256:495 (1975), or may be made by recombinant DNA methods such as described in U.S. Pat. No. 4,816,567. The monoclonal antibodies may also be isolated from phage libraries generated using the techniques described in McCafferty et al., Nature, 348:552-554 (1990), for example.

(35) A diabody refers to an engineered antibody construct prepared by isolating the binding domains (both heavy and light chain) of a binding antibody, and supplying a linking moiety which joins or operably links the heavy and light chains on the same polypeptide chain thereby preserving the binding function as described in detail by Holliger et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444 and reviewed by Poljak (1994) Structure 2:1121-1123. This forms, in essence, a radically abbreviated antibody, having only the variable domain necessary for binding the antigen. By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites. These dimeric antibody fragments, or diabodies, are bivalent and bispecific. It should be clear that any method to generate diabodies, as for example described by Holliger, et al. (1993) supra, Poljak (1994) supra, Zhu, et al. (1996) Biotechnology 14:192-196, and U.S. Pat. No. 6,492,123, herein incorporated by reference, can be used. Once generated, the binding specificity can be determined by, for example, equilibrium methods (e.g., enzyme-linked immunoabsorbent assay (ELISA) or radioimmunoassay (RIA)), or kinetics (e.g. BIACORE analysis). Alternatively, the diabody can be subjected to other biological activity assays, e.g., bacterial aggregation or colognization assays, in order to evaluate its potency or pharmacological activity and potential efficacy as a therapeutic agent. Such assays are disclosed herein and are well-known in the art.

(36) A human antibody is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies known in the art or as disclosed herein. This definition of a human antibody includes antibodies comprising at least one human heavy chain polypeptide or at least one human light chain polypeptide, for example an antibody comprising murine light chain and human heavy chain polypeptides. Human antibodies can be produced using various techniques known in the art. In one embodiment, the human antibody is selected from a phage library, where that phage library expresses human antibodies (Vaughan et al. Nature Biotechnology, 14:309-314 (1996): Sheets et al. PNAS, (USA) 95:6157-6162 (1998)); Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991)). Human antibodies can also be made by introducing human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,661,016, and in the following scientific publications: Marks et al., Bio/Technology, 10: 779-783 (1992); Lonberg et al., Nature, 368: 856-859 (1994); Morrison, Nature, 368:812-13 (1994); Fishwild et al., Nature Biotechnology, 14: 845-51 (1996); Neuberger, Nature Biotechnology, 14: 826 (1996); Lonberg and Huszar, Intern. Rev. Immunol., 13:65-93 (1995). Alternatively, the human antibody may be prepared via immortalization of human B lymphocytes producing an antibody directed against a target antigen (such B lymphocytes may be recovered from an individual or may have been immunized in vitro). See, e.g., Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boerner et al., J. Immunol., 147 (1):86-95 (1991); and U.S. Pat. No. 5,750,373.

(37) The term cytotoxic agent as used herein refers to a substance that inhibits or prevents the function of cells and/or causes destruction of cells. The term is intended to include radioactive isotopes (e.g. At.sup.211, I.sup.131, I.sup.125, Ye.sup.90, Re.sup.186, Re.sup.188, Sm.sup.153, Bi.sup.212, P.sup.32 radioactive isotopes of Lu, and any other radioactive isotope known to one skilled in the art), chemotherapeutic agents, and toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof. Cytotoxic agents also include recomvinant immunotoxins (e.g. LMB7, LMB9, LMB2, BL22, SS1, MR1, TGF-PE38, IL3/13-PE38, DT-IL2, DT-GM-CSF). Cytotoxic agents also include toxins (e.g. ricin, botulinum, Coley toxins). Cytotoxic agents also include anti-angiogenesis agents, anti-mitotic agents, nucleoside antagonists, intercalating agents, spindle inhibitors, folate inhibitors, alkylating agents, anti-metabolites, anti-tumor antibiotics, topoisomerase inhibitors, corticosteroids, and differentiating agents.

(38) A chemotherapeutic agent is a chemical compound useful in the treatment of conditions like cancer. Examples of chemotherapeutic agents include alkylating agents such as thiotepa and cyclosphosphamide (CYTOXAN); alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethylenethiophosphaoramide and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analogue topotecan); bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues); cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogues, KW-2189 and CBI-TMI); eleutherobin; pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlomaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, ranimustine; antibiotics such as the enediyne antibiotics (e.g. calicheamicin, especially calicheamicin (.sub.1.sup.I and calicheamicin 2.sup.I.sub.1, see, e.g., Agnew Chem Intl. Ed. Engl. 33:183-186 (1994); dynemicin, including dynemicin A; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycins, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin (including morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine, 5-FU; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elformithine; elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidamine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidamol; nitracrine; pentostatin; phenamet; pirarubicin; podophyllinic acid; 2-ethylhydrazide; procarbazine; PSK; razoxane; rhizoxin; sizofiran; spirogermanium; tenuazonic acid; triaziquone; 2, 2,2-trichlorotriethylamine; trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine); urethan; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside (Ara-C); cyclophosphamide; thiotepa; taxoids, e.g. paclitaxel (TAXOL, Bristol-Myers Squibb Oncology, Princeton, N.J.) and doxetaxel (TAXOTERE, Rh{circle around (o)}ne-Poulenc Rorer, Antony, France); chlorambucil; gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin and carboplatin; vinblastine; platinum; etoposide (VP-16); ifosfamide; mitomycin C; mitoxantrone; vincristine; vinorelbine; navelbine; novantrone; teniposide; daunomycin; aminopterin; xeloda; ibandronate; CPT-11; topoisomerase inhibitor RFS 2000; difluoromethylomithine (DMFO); retinoic acid; capecitabine; and pharmaceutically acceptable salts, acids or derivatives of any of the above. Also included in this definition are anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens including for example tamoxifen, raloxifene, aromatase inhibiting 4(5)-imidazoles, 4-hydroxytamoxifen, trioxifene, keoxifene, LY117018, onapristone, and toremifene (Fareston); and anti-androgens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; and pharmaceutically acceptable salts, acids or derivatives of any of the above.

(39) The term mammal as used herein refers to any mammal classified as a mammal, including humans, higher primates, cows, horses, dogs and cats. In a preferred embodiment of the invention, the mammal is a human.

(40) Antibodies

(41) The antibodies of the invention may comprise polyclonal antibodies. Methods of preparing polyclonal antibodies are known to the skilled artisan. Polyclonal antibodies can be raised in a mammal, for example, by one or more injections of an immunizing agent and, if desired, an adjuvant. Typically, the immunizing agent and/or adjuvant will be injected in the mammal by multiple subcutaneous or intraperitoneal injections. The immunizing agent may include the c-Met polypeptide (or a c-Met ECD) or a fusion protein thereof. It may be useful to conjugate the immunizing agent to a protein known to be immunogenic in the mammal being immunized. Examples of such immunogenic proteins include but are not limited to keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, and soybean trypsin inhibitor. Examples of adjuvants which may be employed include Freund's complete adjuvant and MPL-TDM adjuvant (monophosphoryl Lipid A, synthetic trehalose dicorynomycolate). The immunization protocol may be selected by one skilled in the art without undue experimentation. The mammal can then be bled, and the serum assayed for c-Met antibody titer. If desired, the mammal can be boosted until the antibody titer increases or plateaus.

(42) The antibodies of the invention may, alternatively, be monoclonal antibodies. Monoclonal antibodies may be prepared using hybridoma methods, such as those described by Kohler and Milstein, Nature, 256:495 (1975). In a hybridoma method, a mouse, hamster, or other appropriate host animal, is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent. Alternatively, the lymphocytes may be immunized in vitro.

(43) The antibodies of the invention may, alternatively, be humanized antibodies. Generally, a humanized antibody has one or more amino acid residues introduced into it from a non-human source. These non-human amino acid residues are often referred to as import residues, which are typically taken from an import variable domain. Humanization can be essentially performed following the method of Winter and co-workers [Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature, 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988)], by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody.

(44) Accordingly, such humanized antibodies are chimeric antibodies wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In practice, humanized antibodies are typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.

(45) It is important that antibodies be humanized with retention of high affinity for the antigen and other favorable biological properties. To achieve this goal, according to a preferred method, humanized antibodies are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three dimensional models of the parental and humanized sequences. Three dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art. Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e. the analysis of residues that influence the ability of the candidate immunoglobulin to bind its antigen. In this way, FR residues can be selected and combined from the consensus and import sequence so that the desired antibody characteristic, such as increased affinity for the target antigen(s), is achieved. In general, the CDR residues are directly and most substantially involved in influencing antigen binding.

(46) The antibodies of the invention may, alternatively, be human monoclonal antibodies. Human monoclonal antibodies can be made by the hybridoma method. Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described, for example, by Kozbor, J. Immunol. 133, 3001 (1984), and Brodeur, et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987).

(47) It is now possible to produce transgenic animals (e.g. mice) that are capable, upon immunization, of producing a repertoire of human antibodies in the absence of endogenous immunoglobulin production. For example, it has been described that the homozygous deletion of the antibody heavy chain joining region (J.sub.H) gene in chimeric and germ-line mutant mice results in complete inhibition of endogenous antibody production. Transfer of the human germ-line immunoglobulin gene array in such germ-line mutant mice will result in the production of human antibodies upon antigen challenge. See, e.g. Jakobovits et al., Proc. Natl. Acad. Sci. USA 90, 2551-255 (1993); Jakobovits et al., Nature 362, 255-258 (1993).

(48) Mendez et al. (Nature Genetics 15: 146-156 [1997]) have further improved the technology and have generated a line of transgenic mice designated as Xenomouse II that, when challenged with an antigen, generates high affinity fully human antibodies. This was achieved by germ-line integration of megabase human heavy chain and light chain loci into mice with deletion into endogenous J.sub.H segment as described above. The Xenomouse II harbors 1,020 kb of human heavy chain locus containing approximately 66 V.sub.H genes, complete D.sub.H and J.sub.H regions and three different constant regions (.mu., .delta. and .chi.), and also harbors 800 kb of human .kappa. locus containing 32 V.kappa. genes, J.kappa. segments and C.kappa. genes. The antibodies produced in these mice closely resemble that seen in humans in all respects, including gene rearrangement, assembly, and repertoire. The human antibodies are preferentially expressed over endogenous antibodies due to deletion in endogenous J.sub.H segment that prevents gene rearrangement in the murine locus.

(49) Alternatively, the phage display technology (McCafferty et al., Nature 348, 552-553 [1990]) can be used to produce human antibodies and antibody fragments in vitro, from immunoglobulin variable (V) domain gene repertoires from unimmunized donors. According to this technique, antibody V domain genes are cloned in-frame into either a major or minor coat protein gene of a filamentous bacteriophage, such as M13 or fd, and displayed as functional antibody fragments on the surface of the phage particle. Because the filamentous particle contains a single-stranded DNA copy of the phage genome, selections based on the functional properties of the antibody also result in selection of the gene encoding the antibody exhibiting those properties. Thus, the phage mimics some of the properties of the B-cell. Phage display can be performed in a variety of formats; for their review see, e.g. Johnson, Kevin S. and Chiswell, David J., Current Opinion in Structural Biology 3, 564-571 (1993). Several sources of V-gene segments can be used for phage display. Clackson et al., Nature 352, 624-628 (1991) isolated a diverse array of anti-oxazolone antibodies from a small random combinatorial library of V genes derived from the spleens of immunized mice. A repertoire of V genes from unimmunized human donors can be constructed and antibodies to a diverse array of antigens (including self-antigens) can be isolated essentially following the techniques described by Marks et al., J. Mol. Biol. 222, 581-597 (1991), or Griffith et al., EMBO J. 12, 725-734 (1993). In a natural immune response, antibody genes accumulate mutations at a high rate (somatic hypermutation). Some of the changes introduced will confer higher affinity, and B cells displaying high-affinity surface immunoglobulin are preferentially replicated and differentiated during subsequent antigen challenge. This natural process can be mimicked by employing the technique known as chain shuffling (Marks et al., Bio/Technol. 10, 779-783 [1992]). In this method, the affinity of primary human antibodies obtained by phage display can be improved by sequentially replacing the heavy and light chain V region genes with repertoires of naturally occurring variants (repertoires) of V domain genes obtained from unimmunized donors. This technique allows the production of antibodies and antibody fragments with affinities in the nM range. A strategy for making very large phage antibody repertoires (also known as the mother-of-all libraries) has been described by Waterhouse et al., Nucl. Acids Res. 21, 2265-2266 (1993). Gene shuffling can also be used to derive human antibodies from rodent antibodies, where the human antibody has similar affinities and specificities to the starting rodent antibody. According to this method, which is also referred to as epitope imprinting, the heavy or light chain V domain gene of rodent antibodies obtained by phage display technique is replaced with a repertoire of human V domain genes, creating rodent-human chimeras. Selection on antigen results in isolation of human variable capable of restoring a functional antigen-binding site, i.e. the epitope governs (imprints) the choice of partner. When the process is repeated in order to replace the remaining rodent V domain, a human antibody is obtained (see PCT patent application WO 93/06213, published 1 Apr. 1993). Unlike traditional humanization of rodent antibodies by CDR grafting, this technique provides completely human antibodies, which have no framework or CDR residues of rodent origin.

(50) As discussed in detail below, the antibodies of the invention may optionally comprise monomeric, antibodies, dimeric antibodies, as well as multivalent forms of antibodies. Those skilled in the art may construct such dimers or multivalent forms by techniques known in the art and using the c-Met antibodies herein. Methods for preparing monovalent antibodies are also well known in the art. For example, one method involves recombinant expression of immunoglobulin light chain and modified heavy chain. The heavy chain is truncated generally at any point in the Fc region so as to prevent heavy chain crosslinking. Alternatively, the relevant cysteine residues are substituted with another amino acid residue or are deleted so as to prevent crosslinking.

(51) The antibodies of this invention may be diabody derivatives. The diabody derivatives of the present invention are advantageously useful over other antibody and antibody fragments known in the art because they are easy to express in large quantities, can penetrate tissues easily and lack the constant domains that promote often unwanted and usually superfluous effector functions. Further, because the diabodies of the invention are not of murine origin, they do not provoke an immune reaction in the human host, leading to rapid clearance and poor efficacy during long-term treatment. Since dental caries tend to be chronic rather than acute, murine antibodies are of little benefit to patients in the long-term. While scFvs to SAI/II have been produced (Ma, et al. (1990) supra), there are two drawbacks of scFvs compared to the ideal sIgA format, monovalency and instability. ScFvs are monovalent because the heavy and light chains are joined by a flexible peptide linker, which allows the two domains to fold and interact with each other. By using diabodies, wherein the linking peptide is shortened thereby forcing the heavy and light chain variable domains to interact to form a dimer, the drawback of using scFvs is overcome. Further, as a consequence of this interaction, the diabody is bivalent like the parent immunoglobulin, and therefore has increased binding avidity.

(52) Heteroconjugate antibodies are also within the scope of the present invention. Heteroconjugate antibodies are composed of two covalently joined antibodies. Heteroconjugate antibodies may be made using any convenient cross-linking methods. Suitable cross-linking agents are well known in the art, and are disclosed in U.S. Pat. No. 4,676,980, along with a number of cross-linking techniques.

(53) In certain embodiments, the anti-c-Met antibody is an antibody fragment. Various techniques have been developed for the production of antibody fragments. Traditionally, these fragments were derived via proteolytic digestion of intact antibodies (see, e.g., Morimoto et al., J. Biochem. Biophys. Methods 24:107-117 (1992) and Brennan et al., Science 229:81 (1985)). However, these fragments can now be produced directly by recombinant host cells. For example, Fab-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab).sub.2 fragments (Carter et al., Bio/Technology 10:163-167 (1992)). In another embodiment, the F(ab).sub.2 is formed using the leucine zipper GCN4 to promote assembly of the F(ab).sub.2 molecule. According to another approach, Fv, Fab or F(ab).sub.2 fragments can be isolated directly from recombinant host cell culture. A variety of techniques for the production of antibody fragments will be apparent to the skilled practitioner. For instance, digestion can be performed using papain. Examples of papain digestion are described in WO 94/29348 published Dec. 22, 1994 and U.S. Pat. No. 4,342,566. Papain digestion of antibodies typically produces two identical antigen binding fragments, called Fab fragments, each with a single antigen binding site, and a residual Fc fragment. Pepsin treatment yields an F(ab).sub.2 fragment that has two antigen combining sites and is still capable of cross-linking antigen.

(54) The Fab fragments produced in the antibody digestion also contain the constant domains of the light chain and the first constant domain (CHi) of the heavy chain. Fab fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CHi domain including one or more cysteines from the antibody hinge region. Fab-SH is the designation herein for Fab in which the cysteine residue(s) of the constant domains bear a free thiol group. F(ab).sub.2 antibody fragments originally were produced as pairs of Fab fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.

(55) In certain embodiments, there are amino acid sequence variants of the anti-c-Met antibody. These variants are prepared by introducing appropriate nucleotide changes into the anti-c-Met antibody DNA, or by peptide synthesis. Such variants include, for example, deletions from, and/or insertions into and/or substitutions of, residues within the amino acid sequences of the anti-c-Met antibodies of the examples herein. Any combination of deletion, insertion, and substitution is made to arrive at the final construct, provided that the final construct possesses the desired characteristics. The amino acid changes also may alter post-translational processes of the humanized or variant anti-c-Met antibody, such as changing the number or position of glycosylation sites.

(56) A useful method for identification of certain residues or regions of the anti-c-Met antibody that are preferred locations for mutagenesis is called alanine scanning mutagenesis, as described by Cunningham and Wells Science, 244:1081-1085 (1989). Here, a residue or group of target residues are identified (e.g., charged residues such as arg, asp, his, lys, and glu) and replaced by a neutral or negatively charged amino acid (most preferably alanine or polyalanine) to affect the interaction of the amino acids with c-Met antigen. Those amino acid locations demonstrating functional sensitivity to the substitutions then are refined by introducing further or other variants at, or for, the sites of substitution. Thus, while the site for introducing an amino acid sequence variation is predetermined, the nature of the mutation per se need not be predetermined. For example, to analyze the performance of a mutation at a given site, ala scanning or random mutagenesis is conducted at the target codon or region and the expressed anti-c-Met antibody variants are screened for the desired activity.

(57) Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an anti-c-Met antibody with an N-terminal methionyl residue or the antibody fused to an epitope tag. Other insertional variants of the anti-c-Met antibody molecule include the fusion to the N- or C-terminus of the anti-c-Met antibody of an enzyme or a polypeptide or polyol which increases the serum half-life of the antibody.

(58) The antibodies of this invention can be conjugated to secondary molecules. The antibodies can be conjugated to fluorophores, radioactive isotopes, chemoluminescent molecules, chemotherapeutic molecules, cytotoxic molecules, anti-viral molecules, antibiotic molecules, and any other imaging or diagnostic molecule known to one of skill in the art.

(59) In specific embodiments of this invention, the isolated human ant-c-Met antibody comprises the heavy chain variable domain amino acid sequence of SEQ ID NO:1 and the light chain variable domain amino acid sequence of SEQ ID NO:9 (i.e., the A12 antibody):

(60) TABLE-US-00001 SEQ ID NO: 1 QVQLVQSGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKSS SSWYRSYYFDYWGQGTLVTVSS SEQ ID NO: 9 QSALTQDPAVSVALGQTVRITCRGDSLRNYYASWYQQKPGQAPVLVIYGK NNRPSGIPDRFSGSFSGNTASLTITGAQAEDEADYYCNSRDSSANQMFGG GTKVTVLG

(61) In specific embodiments, the isolated human ant-c-Met antibody comprises the heavy chain variable domain amino acid sequence of SEQ ID NO:2 and the light chain variable domain amino acid sequence of SEQ ID NO:10 (i.e., the C2 antibody):

(62) TABLE-US-00002 SEQ ID NO: 2 QVQLQESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASQH VGEQSRYFDYWGQGTLVTVSS SEQ ID NO: 10 DIVMTQSPSSLSASIGDRVTITCRASHSISSYVNWYQKKPGKAPNLLIYA ASYLPRGVPSRFSGSGLGTDFTLTISNLQPEDFATYYCQESYSTPYSFGQ GTKVDIKR

(63) In specific embodiments, the isolated human ant-c-Met antibody comprises the heavy chain variable domain amino acid sequence of SEQ ID NO:3 and the light chain variable domain amino acid sequence of SEQ ID NO:11 (i.e., the E9 antibody).

(64) TABLE-US-00003 SEQ ID NO: 3 QVQLQESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVSA IGSSGGSTHDADTVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDR ARGFDYWGQGTLVTVSS SEQ ID NO: 11 EIVLTQSPSTLSASIGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYG ASSLQSGVPSRFSGRGSGADFTLTISSLQPEDFATYYCQQLISYPLTFGG GTKVEIKR

(65) In specific embodiments, the isolated human ant-c-Met antibody comprises the heavy chain variable domain amino acid sequence of SEQ ID NO:4 and the light chain variable domain amino acid sequence of SEQ ID NO:12 (i.e., the F1 antibody).

(66) TABLE-US-00004 SEQ ID NO: 4 QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMHWVRQAPGEGLEWMGW MNPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARSH YWDSWSPGTLVTVSS SEQ ID NO: 12 SALTQPASVSGSPGQSITISCTGTSGDVGGYNYVSWYQQHPGKAPKLMIY DVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCTSYAGSRNLVF GGGTKLTVLG

(67) In specific embodiments, the isolated human ant-c-Met antibody comprises the heavy chain variable domain amino acid sequence of SEQ ID NO:5 and the light chain variable domain amino acid sequence of SEQ ID NO:13 (i.e., the F11 antibody).

(68) TABLE-US-00005 SEQ ID NO: 5 QVQLQESGGGLLQPGGSLRLSCAASRFTFSNYAMSWVRQAPGKGLEWVSA ISGSGASTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCSNLY GDYDYWGQGTLVTVSS SEQ ID NO: 13 QSVLTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMI YDVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTLL FGGGTKLTVLG

(69) In specific embodiments, the isolated human ant-c-Met antibody comprises the heavy chain variable domain amino acid sequence of SEQ ID NO:6 and the light chain variable domain amino acid sequence of SEQ ID NO:14 (i.e., the G1 antibody).

(70) TABLE-US-00006 SEQ ID NO: 6 QVQLQESGGGVVQPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSS ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDL PSDDYGDYDYYYYGMDVWGQGTTVTVSS SEQ ID NO: 14 QSVLTQPPSASGTPGQRVTLFCSGSSSNIASNSVKWYQQPPQRAPKLLMF SDDQRPSGVPVRFSASKSGTSASLAISGLQSEDEADYYCAAWDDSLNAEV FGGGTKVTVLG

(71) In specific embodiments, the isolated human ant-c-Met antibody comprises the heavy chain variable domain amino acid sequence of SEQ ID NO:7 and the light chain variable domain amino acid sequence of SEQ ID NO:15 (i.e., the H2 antibody).

(72) TABLE-US-00007 SEQ ID NO: 7 EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREG GKWYYGMDVWGRGTLVTVSS SEQ ID NO: 15 SSELTQDPAVSVALGQTVRITCQGDSLRSYYTNWFQQKPGQAPLLVVYAK NKRPSGIPDRFSGSGSGDTASLTITGAQAEDEADYYCNSRDSSGNYLFAA GTKLTVLG

(73) In specific embodiments, the isolated human ant-c-Met antibody comprises the heavy chain variable domain amino acid sequence of SEQ ID NO:8 and the light chain variable domain amino acid sequence of SEQ ID NO:16 (i.e., the H5 antibody).

(74) TABLE-US-00008 SEQ ID NO: 8 QVQLQESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDR FRAAAYWGQGTLVTVSS SEQ ID NO: 16 QSVLTQPPSVSAAPGQKVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLI YGNSNRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDILNGE IFGGGTKVTVLG

(75) In specific embodiments of this invention, the isolated human ant-c-Met antibody is a cys-diabody which comprises SEQ ID NO:17, inclusive of the 6-His tag which can be removed using techniques known to one of skill in the art, for example by cleavage (i.e., the A12 cys-diabody):

(76) TABLE-US-00009 SEQ ID NO: 17 QVQLVQSGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKSS SSWYRSYYFDYWGQGTLVTVSSGGGGGSQSALTQDPAVSVALGQTVRITC RGDSLRNYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSFSGNTASL TITGAQAEDEADYYCNSRDSSANQMFGGGTKVTVLGAAAEQKLISEEDLN GAAHHHHHHC

(77) In specific embodiments of this invention, the isolated human ant-c-Met antibody is a cys-diabody which comprises SEQ ID NO:18, inclusive of the 6-His tag which can be removed using techniques known to one of skill in the art, for example by cleavage (i.e., the C2 cys-diabody):

(78) TABLE-US-00010 SEQ ID NO: 18 QVQLQESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASQH VGEQSRYFDYWGQGTLVTVSSGGGGGSDIVMTQSPSSLSASIGDRVTITC RASHSISSYVNWYQKKPGKAPNLLIYAASYLPRGVPSRFSGSGLGTDFTL TISNLQPEDFATYYCQESYSTPYSFGQGTKVDIKRAAAEQKLISEEDLNG AAHHHHHHC

(79) In specific embodiments of this invention, the isolated human ant-c-Met antibody is a cys-diabody which comprises SEQ ID NO:19, inclusive of the 6-His tag which can be removed using techniques known to one of skill in the art, for example by cleavage (i.e., the E9 cys-diabody):

(80) TABLE-US-00011 SEQ ID NO: 19 QVQLQESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVSA IGSSGGSTHDADTVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDR ARGFDYWGQGTLVTVSSGGGGGSEIVLTQSPSTLSASIGDRVTITCRASQ GISSYLAWYQQKPGKAPKLLIYGASSLQSGVPSRFSGRGSGADFTLTISS LQPEDFATYYCQQLISYPLTFGGGTKVEIKRAAAEQKLISEEDLNGAAHH HHHHC

(81) In specific embodiments of this invention, the isolated human ant-c-Met antibody is a cys-diabody which comprises SEQ ID NO:20, inclusive of the 6-His tag which can be removed using techniques known to one of skill in the art, for example by cleavage (i.e., the F1 cys-diabody):

(82) TABLE-US-00012 SEQ ID NO: 20 QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMHWVRQAPGEGLEWMGW MNPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARSH YWDSWSPGTLVTVSSGGGGGSSALTQPASVSGSPGQSITISCTGTSGDVG GYNYVSWYQQHPGKAPKLMIYDVSNRPSGVSNRFSGSKSGNTASLTISGL QAEDEADYYCTSYAGSRNLVFGGGTKLTVLGAAAEQKLISEEDLNGAAHH HHHHC

(83) In specific embodiments of this invention, the isolated human ant-c-Met antibody is a cys-diabody which comprises SEQ ID NO:21, inclusive of the 6-His tag which can be removed using techniques known to one of skill in the art, for example by cleavage (i.e., the F11 cys-diabody):

(84) TABLE-US-00013 SEQ ID NO: 21 QVQLQESGGGLLQPGGSLRLSCAASRFTFSNYAMSWVRQAPGKGLEWVSA ISGSGASTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCSNLY GDYDYWGQGTLVTVSSGGGGGSQSVLTQPASVSGSPGQSITISCTGTSSD VGGYNYVSWYQQHPGKAPKLMIYDVSNRPSGVSNRFSGSKSGNTASLTIS GLQAEDEADYYCSSYTSSSTLLFGGGTKLTVLGAAAEQKLISEEDLNGAA HHHHHHC

(85) In specific embodiments of this invention, the isolated human ant-c-Met antibody is a cys-diabody which comprises SEQ ID NO:22, inclusive of the 6-His tag which can be removed using techniques known to one of skill in the art, for example by cleavage (i.e., the G1 cys-diabody):

(86) TABLE-US-00014 SEQ ID NO: 22 QVQLQESGGGVVQPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSS ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDL PSDDYGDYDYYYYGMDVWGQGTTVTVSSGGGGGSQSVLTQPPSASGTPGQ RVTLFCSGSSSNIASNSVKWYQQPPQRAPKLLMFSDDQRPSGVPVRFSAS KSGTSASLAISGLQSEDEADYYCAAWDDSLNAEVFGGGTKVTVLGAAAEQ KLISEEDLNGAAHHHHHHC

(87) In specific embodiments of this invention, the isolated human ant-c-Met antibody is a cys-diabody which comprises SEQ ID NO:23, inclusive of the 6-His tag which can be removed using techniques known to one of skill in the art, for example by cleavage (i.e., the H2 cys-diabody):

(88) TABLE-US-00015 SEQ ID NO: 23 EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREG GKWYYGMDVWGRGTLVTVSSGGGGGSSSELTQDPAVSVALGQTVRITCQG DSLRSYYTNWFQQKPGQAPLLVVYAKNKRPSGIPDRFSGSGSGDTASLTI TGAQAEDEADYYCNSRDSSGNYLFAAGTKLTVLGAAAEQKLISEEDLNGA AHHHHHHC

(89) In specific embodiments of this invention, the isolated human ant-c-Met antibody is a cys-diabody which comprises SEQ ID NO:24, inclusive of the 6-His tag which can be removed using techniques known to one of skill in the art, for example by cleavage (i.e., the H5 cys-diabody):

(90) TABLE-US-00016 SEQ ID NO: 24 QVQLQESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDR FRAAAYWGQGTLVTVSSGGGGGSQSVLTQPPSVSAAPGQKVTISCTGSSS NIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAI SGLQSEDEADYYCAAWDDILNGEIFGGGTKVTVLGAAAEQKLISEEDLNG AAHHHHHHC

(91) In specific embodiments of this invention, the isolated human ant-c-Met antibody is a ScFv antibody which comprises SEQ ID NO:25 (i.e., the A12 ScFv antibody):

(92) TABLE-US-00017 SEQ ID NO: 25 QVQLVQSGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKSS SSWYRSYYFDYWGQGTLVTVSSGGGGGSGGGGSGGGGSQSALTQDPAVSV ALGQTVRITCRGDSLRNYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFS GSFSGNTASLTITGAQAEDEADYYCNSRDSSANQMFGGGTKVTVLG

(93) In specific embodiments of this invention, the isolated human ant-c-Met antibody is a ScFv antibody which comprises SEQ ID NO:26 (i.e., the C2 ScFv antibody):

(94) TABLE-US-00018 SEQ ID NO: 26 QVQLQESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASQH VGEQSRYFDYWGQGTLVTVSSGGGGGSGGGGSGGGGSDIVMTQSPSSLSA SIGDRVTITCRASHSISSYVNWYQKKPGKAPNLLIYAASYLPRGVPSRFS GSGLGTDFTLTISNLQPEDFATYYCQESYSTPYSFGQGTKVDIKR

(95) In specific embodiments of this invention, the isolated human ant-c-Met antibody is a ScFv antibody which comprises SEQ ID NO:27 (i.e., the E9 ScFv antibody):

(96) TABLE-US-00019 SEQ ID NO: 27 QVQLQESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVSA IGSSGGSTHDADTVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDR ARGFDYWGQGTLVTVSSGGGGGSGGGGSGGGGSEIVLTQSPSTLSASIGD RVTITCRASQGISSYLAWYQQKPGKAPKLLIYGASSLQSGVPSRFSGRGS GADFTLTISSLQPEDFATYYCQQLISYPLTFGGGTKVEIKR

(97) In specific embodiments of this invention, the isolated human ant-c-Met antibody is a ScFv antibody which comprises SEQ ID NO:28 (i.e., the F1 ScFv antibody):

(98) TABLE-US-00020 SEQ ID NO: 28 QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMHWVRQAPGEGLEWMGW MNPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARSH YWDSWSPGTLVTVSSGGGGGSGGGGSGGGGSSALTQPASVSGSPGQSITI SCTGTSGDVGGYNYVSWYQQHPGKAPKLMIYDVSNRPSGVSNRFSGSKSG NTASLTISGLQAEDEADYYCTSYAGSRNLVFGGGTKLTVLG

(99) In specific embodiments of this invention, the isolated human ant-c-Met antibody is a ScFv antibody which comprises SEQ ID NO:29 (i.e., the F11 ScFv antibody):

(100) TABLE-US-00021 SEQ ID NO: 29 QVQLQESGGGLLQPGGSLRLSCAASRFTFSNYAMSWVRQAPGKGLEWVSA ISGSGASTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCSNLY GDYDYWGQGTLVTVSSGGGGGSGGGGSGGGGSQSVLTQPASVSGSPGQSI TISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSNRPSGVSNRFSGSK SGNTASLTISGLQAEDEADYYCSSYTSSSTLLFGGGTKLTVLG

(101) In specific embodiments of this invention, the isolated human ant-c-Met antibody is a ScFv antibody which comprises SEQ ID NO:30 (i.e., the G1 ScFv antibody):

(102) TABLE-US-00022 SEQ ID NO: 30 QVQLQESGGGVVQPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSS ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDL PSDDYGDYDYYYYGMDVWGQGTTVTVSSGGGGGSGGGGSGGGGSQSVLTQ PPSASGTPGQRVTLFCSGSSSNIASNSVKWYQQPPQRAPKLLMFSDDQRP SGVPVRFSASKSGTSASLAISGLQSEDEADYYCAAWDDSLNAEVFGGGTK VTVLG

(103) In specific embodiments of this invention, the isolated human ant-c-Met antibody is a ScFv antibody which comprises SEQ ID NO:31 (i.e., the H2 ScFv antibody):

(104) TABLE-US-00023 SEQ ID NO: 31 EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREG GKWYYGMDVWGRGTLVTVSSGGGGGSGGGGSGGGGSSSELTQDPAVSVAL GQTVRITCQGDSLRSYYTNWFQQKPGQAPLLVVYAKNKRPSGIPDRFSGS GSGDTASLTITGAQAEDEADYYCNSRDSSGNYLFAAGTKLTVLG

(105) In specific embodiments of this invention, the isolated human ant-c-Met antibody is a ScFv antibody which comprises SEQ ID NO:32 (i.e., the H5 ScFv antibody):

(106) TABLE-US-00024 SEQ ID NO: 32 QVQLQESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDR FRAAAYWGQGTLVTVSSGGGGGSGGGGSGGGGSQSVLTQPPSVSAAPGQK VTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGS KSGTSASLAISGLQSEDEADYYCAAWDDILNGEIFGGGTKVTVLG

(107) In specific embodiments, Table 1 provides the heavy chain CDRs of each of the the A12, C2, E9, F1, F11, G1, H2, and H5 antibodies, cys-diabodies, and ScFv antibodies described herein. In specific embodiments, Table 2 provides the light chain CDRs of the A12, C2, E9, F1, F11, G1, H2, and H5 antibodies.

(108) TABLE-US-00025 TABLE 1 Heavy Chain CDR Sequences of the A12, C2, E9, F1, F11, G1, H2, and H5 antibodies. Heavy Chain CDR Antibody CDR SEQUENCE SEQ ID A12 CDR-H1 GFTFSSYAMS 33 CDR-H2 AISGSGGSTYYADSVKG 34 CDR-H3 SSSSWYRSYYFDY 35 C2 CDR-H1 GFTFSSYAMS 36 CDR-H2 AISGSGGSTYYADSVKG 37 CDR-H3 QHVGEQSRYFDY 38 E9 CDR-H1 GFTFSSYGMH 39 CDR-H2 AIGSSGGSTHDADTVKG 40 CDR-H3 DRARGFDY 41 F1 CDR-H1 GYTFTDYYMH 42 CDR-H2 WMNPNSGGTNYAQKFQG 43 CDR-H3 SHYWDS 44 F11 CDR-H1 RFTFSNYAMS 45 CDR-H2 AISGSGASTYYADSVKG 46 CDR-H3 LYGDYDY 47 G1 CDR-H1 GFTFSSYSMN 48 CDR-H2 SISSSSSYIYYADSVKG 49 CDR-H3 DLPSDDYGDYDYYYYGMDV 50 H2 CDR-H1 GFTFSTYAMS 51 CDR-H2 AISGSGGSTYYADSVKG 52 CDR-H3 EGGKWYYGMDV 53 H5 CDR-H1 GFTFSNYAMS 54 CDR-H2 AISGSGGSTYYADSVKG 55 CDR-H3 DRFRAAAY 56

(109) TABLE-US-00026 TABLE 2 Light Chain CDR Sequences of the A12, C2, E9, F1, F11, G1, H2, and H5 antibodies. Light Chain CDR Antibody CDR SEQUENCE SEQ ID A12 CDR-L1 RGDSLRNYYAS 57 CDR-L2 GKNNRPS 58 CDR-L3 NSRDSSANQM 59 C2 CDR-L1 RASHSISSYVN 60 CDR-L2 AASYLPR 61 CDR-L3 QESYSTPYS 62 E9 CDR-L1 RASQGISSYLA 63 CDR-L2 GASSLQS 64 CDR-L3 QQLISYPLT 65 F1 CDR-L1 TGTSGDVGGYNYVS 66 CDR-L2 DVSNRPS 67 CDR-L3 TSYAGSRNLV 68 F11 CDR-L1 TGTSSDVGGYNYVS 69 CDR-L2 DVSNRPS 70 CDR-L3 SSYTSSSTLL 71 G1 CDR-L1 SGSSSNIASNSVK 72 CDR-L2 SDDQRPS 73 CDR-L3 AAWDDSLNAEV 74 H2 CDR-L1 QGDSLRSYYTN 75 CDR-L2 AKNKRPS 76 CDR-L3 NSRDSSGNYL 77 H5 CDR-L1 TGSSSNIGAGYDVH 78 CDR-L2 GNSNRPS 79 CDR-L3 AAWDDILNGEI 80
Cancers

(110) The anti-c-Met antibodies and antigen binding fragments thereof can be used to treat, diagnose, and determine the prognosis of various types of cancers. The cancers include, for example, carcinoma, lymphoma, blastoma, sarcoma and leukemia. More specific examples of cancer include squamous cell cancer, small-cell lung cancer, non-small cell lung cancer (NSCLC), non-Hodgkin's lymphoma, blastoma, gastrointestinal cancer, renal cancer, ovarian cancer, liver cancer, stomach cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, pancreatic cancer, endometrial carcinoma, salivary gland carcinoma, kidney cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, and head and neck cancer. Particular groups of cancer include lung cancer (e.g., non-small cell lung carcinomaNSCLC); or adenocarcinoma, which can, for example, be colorectal, pancreatic, or metastatic adenocarcinoma. Hematological cancers are also included.

(111) Administrative Modalities

(112) The antibodies and chemotherapeutic agents of the invention are administered to a subject, in accord with known methods, such as intravenous administration as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerobrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, topical, or inhalation routes. In certain aspects, the antibodies and chemotherapeutic agents of the invention are administered to a subject with cancer. In certain aspects, the antibodies and chemotherapeutic agents of the invention are administered to a subject with breast cancer. In certain aspects, the antibodies and chemotherapeutic agents of the invention are administered to a subject with triple negative breast cancer. Intravenous or subcutaneous administration of the antibody is preferred.

(113) Treatment Modalities

(114) In the methods of the invention, therapy is used to provide a positive therapeutic response with respect to a disease or condition. By positive therapeutic response is intended an improvement in the disease or condition, and/or an improvement in the symptoms associated with the disease or condition. For example, a positive therapeutic response would refer to one or more of the following improvements in the disease: (1) a reduction in the number of neoplastic cells; (2) an increase in neoplastic cell death; (3) inhibition of neoplastic cell survival; (5) inhibition (i.e., slowing to some extent, preferably halting) of tumor growth; (6) an increased patient survival rate; and (7) some relief from one or more symptoms associated with the disease or condition.

(115) Positive therapeutic responses in any given disease or condition can be determined by standardized response criteria specific to that disease or condition. Tumor response can be assessed for changes in tumor morphology (i.e., overall tumor burden, tumor size, and the like) using screening techniques such as magnetic resonance imaging (Mill) scan, x-radiographic imaging, computed tomographic (CT) scan, bone scan imaging, endoscopy, and tumor biopsy sampling.

(116) In addition to these positive therapeutic responses, the subject undergoing therapy may experience the beneficial effect of an improvement in the symptoms associated with the disease.

(117) Such a response may persist for at least 4 to 8 weeks, or sometimes 6 to 8 weeks, following treatment according to the methods of the invention. Alternatively, an improvement in the disease may be categorized as being a partial response. By partial response is intended at least about a 50% decrease in all measurable tumor burden (i.e., the number of malignant cells present in the subject, or the measured bulk of tumor masses or the quantity of abnormal monoclonal protein) in the absence of new lesions, which may persist for 4 to 8 weeks, or 6 to 8 weeks.

(118) Treatment according to the present invention includes a therapeutically effective amount of the medicaments used. A therapeutically effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result.

(119) A therapeutically effective amount may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the medicaments to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the antibody or antibody portion are outweighed by the therapeutically beneficial effects.

(120) A therapeutically effective amount for tumor therapy may also be measured by its ability to stabilize the progression of disease. The ability of a compound to inhibit cancer may be evaluated in an animal model system predictive of efficacy in human tumors.

(121) Alternatively, this property of a composition may be evaluated by examining the ability of the compound to inhibit cell growth or to induce apoptosis by in vitro assays known to the skilled practitioner. A therapeutically effective amount of a therapeutic compound may decrease tumor size, or otherwise ameliorate symptoms in a subject. One of ordinary skill in the art would be able to determine such amounts based on such factors as the subject's size, the severity of the subject's symptoms, and the particular composition or route of administration selected.

(122) Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. Parenteral compositions may be formulated in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.

(123) The specification for the dosage unit forms of the present invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.

(124) The efficient dosages and the dosage regimens for the anti-c-Met antibodies used in the present invention depend on the disease or condition to be treated and may be determined by the persons skilled in the art.

(125) An exemplary, non-limiting range for a therapeutically effective amount of an anti-c-Met antibody used in the present invention is about 0.1-100 mg/kg, such as about 0.1-50 mg/kg, for example about 0.1-20 mg/kg, such as about 0.1-10 mg/kg, for instance about 0.5, about such as 0.3, about 1, or about 3 mg/kg. In another embodiment, the antibody is administered in a dose of 1 mg/kg or more, such as a dose of from 1 to 20 mg/kg, e.g. a dose of from 5 to 20 mg/kg, e.g. a dose of 8 mg/kg.

(126) A medical professional having ordinary skill in the art may readily determine and prescribe the effective amount of the pharmaceutical composition required. For example, a physician or a veterinarian could start doses of the medicament employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.

(127) In one embodiment, the anti-c-Met antibody is administered by infusion in a weekly dosage of from 10 to 500 mg/kg such as from 200 to 400 mg/kg. Such administration may be repeated, e.g., 1 to 8 times, such as 3 to 5 times. The administration may be performed by continuous infusion over a period of from 2 to 24 hours, such as from 2 to 12 hours.

(128) In one embodiment, the anti-c-Met antibody is administered by slow continuous infusion over a long period, such as more than 24 hours, if required to reduce side effects including toxicity.

(129) In one embodiment the anti-c-Met antibody is administered in a weekly dosage of from 250 mg to 2000 mg, such as for example 300 mg, 500 mg, 700 mg, 1000 mg, 1500 mg or 2000 mg, for up to 8 times, such as from 4 to 6 times. The administration may be performed by continuous infusion over a period of from 2 to 24 hours, such as from 2 to 12 hours. Such regimen may be repeated one or more times as necessary, for example, after 6 months or 12 months. The dosage may be determined or adjusted by measuring the amount of compound of the present invention in the blood upon administration by for instance taking out a biological sample and using anti-idiotypic antibodies which target the antigen binding region of the anti-c-Met antibody.

(130) In a further embodiment, the anti-c-Met antibody is administered once weekly for 2 to 12 weeks, such as for 3 to 10 weeks, such as for 4 to 8 weeks.

(131) In one embodiment, the anti-c-Met antibody is administered by maintenance therapy, such as, e.g., once a week for a period of 6 months or more.

(132) In one embodiment, the anti-c-Met antibody is administered by a regimen including one infusion of an anti-c-Met antibody followed by an infusion of an anti-c-Met antibody conjugated to a radioisotope. The regimen may be repeated, e.g., 7 to 9 days later.

(133) As non-limiting examples, treatment according to the present invention may be provided as a daily dosage of an antibody in an amount of about 0.1-100 mg/kg, such as 0.5, 0.9, 1.0, 1.1, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 40, 45, 50, 60, 70, 80, 90 or 100 mg/kg, per day, on at least one of day 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40, or alternatively, at least one of week 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 after initiation of treatment, or any combination thereof, using single or divided doses of every 24, 12, 8, 6, 4, or 2 hours, or any combination thereof.

(134) Combination Therapy

(135) In some embodiments the anti-c-Met antibody molecule thereof is used in combination with one or more additional therapeutic agents, e.g. a chemotherapeutic agent. Non-limiting examples of DNA damaging chemotherapeutic agents include topoisomerase I inhibitors (e.g., irinotecan, topotecan, camptothecin and analogs or metabolites thereof, and doxorubicin); topoisomerase II inhibitors (e.g., etoposide, teniposide, and daunorubicin); alkylating agents (e.g., melphalan, chlorambucil, busulfan, thiotepa, ifosfamide, carmustine, lomustine, semustine, streptozocin, decarbazine, methotrexate, mitomycin C, and cyclophosphamide); DNA intercalators (e.g., cisplatin, oxaliplatin, and carboplatin); DNA intercalators and free radical generators such as bleomycin; and nucleoside mimetics (e.g., 5-fluorouracil, capecitibine, gemcitabine, fludarabine, cytarabine, mercaptopurine, thioguanine, pentostatin, and hydroxyurea).

(136) Chemotherapeutic agents that disrupt cell replication include: paclitaxel, docetaxel, and related analogs; vincristine, vinblastin, and related analogs; thalidomide, lenalidomide, and related analogs (e.g., CC-5013 and CC-4047); protein tyrosine kinase inhibitors (e.g., imatinib mesylate and gefitinib); proteasome inhibitors (e.g., bortezomib); NF-B inhibitors, including inhibitors of IB kinase; antibodies which bind to proteins overexpressed in cancers and other inhibitors of proteins or enzymes known to be upregulated, over-expressed or activated in cancers, the inhibition of which downregulates cell replication.

(137) In some embodiments, the antibodies of the invention can be used prior to, concurrent with, or after treatment with any of the chemotherapeutic agents described herein or known to the skilled artisan at this time or subsequently.

(138) Efficacy of Methods Described Herein

(139) In certain aspects of this invention, efficacy of anti-c-Met therapy is measured by decreased serum concentrations of tumor specific markers, increased overall survival time, decreased tumor size, cancer remission, decreased metastasis marker response, and decreased chemotherapy adverse affects.

(140) In certain aspects of this invention, efficacy is measured with companion diagnostic methods and products. Companion diagnostic measurements can be made before, during, or after anti-c-Met treatment.

(141) Diagnostics

(142) In other embodiments, this disclosure relates to companion diagnostic methods and products. In one embodiment, the companion diagnostic method and products can be used to monitor the treatment of cancer, as described herein. In some embodiments, the companion diagnostic methods and products include molecular assays to measure levels of proteins, genes or specific genetic mutations. Such measurements can be used, for example, to predict whether anti-c-Met therapy will benefit a specific individual, to predict the effective dosage of anti-c-Met therapy, to monitor anti-c-Met therapy, adjust anti-c-Met therapy, tailor the anti-c-Met therapy to an individual, and track cancer progression and remission.

(143) In some embodiments, the companion diagnostic can be used to monitor a combination therapy.

(144) In some embodiments, the companion diagnostic can include an anti-c-Met antibody described herein.

(145) In some embodiments, the companion diagnostic can be used before, during, or after anti-c-Met therapy.

(146) Articles of Manufacture

(147) In other embodiments, an article of manufacture containing materials useful for the treatment of the disorders described above is provided. The article of manufacture comprises a container and a label. Suitable containers include, for example, bottles, vials, syringes, and test tubes. The containers may be formed from a variety of materials such as glass or plastic. The container holds a composition which is effective for treating the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). The active agent in the composition is the antibody. The label on, or associated with, the container indicates that the composition is used for treating the condition of choice. The article of manufacture may further comprise a second container comprising a pharmaceutically-acceptable buffer, such as phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with instructions for use.

EXAMPLES

Example 1

(148) Three rounds of selections on human MET protein were performed which were successfully reformatted and purified 3 cys-diabodies. C2, H2 and H5 cys-diabodies were tested for cross-reactivity to mouse MET protein. Different cys-diabodies were coated to 96-well plate (milk or anti-EpCAM cys-diabody was used as negative control). Either mouse or human MET protein was applied to the coated cys-diabodies. Then the MET-hFc proteins were detected by anti-human Fc antibody. FIG. 5 shows the result of the ELISA. C2 and H5 cys-diabodies bind to only human MET, while H2 also cross reacts with mouse MET protein

(149) The affinities of these 3 diabodies were determined by flow cytometry using the Hcc827 GR6 cell line, which expresses high level MET.

(150) These diabodies also show therapeutic effects on resistant cells with MET amplification. The parental cell line, Hcc827, was treated with the diabodies for 3 days, and the diabodies showed no effects on the growth of the parental line. The diabodies were also applied to the resistant cell line GR6 with or without 1 M gefitinib. The H2 diabody showed the best inhibition effect, while the C2 and H5 diabodies only showed some inhibition at high concentrations.

(151) These diabodies were also tested on other resistant cells without MET amplification (H1975 and H1650), and they show no effects on those cells. The H2 cys-diabody was site specifically conjugated with maleimide-DOTA and radiolabeled with 64Cu for PET imaging. Initial experiments showed targeting to both parental and resistant tumor.

(152) Phage Library Panning.

(153) The naive human scFv phage display library (the Sheets library) used for the panning was generated by JD Marks laboratory (Sheets et al. PNAS, 1998), which contains 6.7109 members. The antigens used in the panning were two slightly different constructs based on the extracellular domain of human c-MET. The recombinant human c-MET Fc chimera protein was purchased from R&D Systems (Cat#: 358-MT/CF). Another human c-MET protein without Fc conjugation was purchased from Sino Biological Inc. (Cat#: 10692-H08H). For the first round of panning, 100 g c-MET Fc chimera protein (R&D Systems) was coated onto an immunotube (Nunc) by overnight incubation in 2 mL PBS at 4 degrees. The immunotube was then washed and blocked with 2% milk in PBS at 37 degrees for 1 hour. After washing with PBS 3 times, 71012 phage antibodies (generated from the Sheets library) in 2 mL 1% milk-PBS are added to the antigen-coated immunotube. After 2 hours of incubation at room temperature, the immunotube was washed 2 times with PBS. The binding phage antibodies were then eluted with 1 mL of 100 mM triethylamine for 8 minutes and neutralized with 0.5 mL of 1M Tris-HCl (pH 7.5). Half of the eluted phage was used to infect 10 mL exponentially growing E. coli TG1. Phage amplification and purification were carried out as previously described (Antibody Engineering Methods and Protocols, Benny K. C. Lo). Two more rounds of similar panning were performed with reduced amounts of c-MET protein from Sino Biological (30 g for the 2nd round and 20 g for the 3rd round), and with increased washing stringency (30 min of incubation with 0.05% PBS-Tween and multiple times of PBS washing). 93 clones were picked from the 3rd round panning and evaluated by phage ELISA.

(154) Phage ELISA Screening of Individual Clones.

(155) Phage antibodies were expressed from 93 clones from the 3rd round of panning as previously described (Antibody Engineering Methods and Protocols, Benny K. C. Lo). 50 L of supernatant of the overnight culture was used for the ELISA. 0.5 g of human c-MET Fc Chimera protein was used to coat each well. Blocking, washing and phage incubations are done as previously described (Antibody Engineering Methods and Protocols, Benny K. C. Lo). 100 L of 1:2000 diluted HRP conjugated anti-M13 antibody (GE Healthcare, Cat#: 27-9421-01) was added to each well and incubated for 1 hour. After washing with PBS-Tween and PBS, 100 L of 0.1 mg/mL ABTS (Sigma, A9941, Dissolved in 0.05M phosphate-citrate buffer, pH5.0, add 1/1000 of 50% H2O2 before use) was added to each well. The plate was then incubated at room temperature for 10 to 30 minutes before reading A405. The best binders were sequenced to identify unique binders.

(156) Reformatting scFv into cys-diabody. ScFv (VH-Linker-VL) was reformatted into diabody by shortening the 15-aa linker to a 6-aa linker. The VH and VL fragments were amplified by PCR with new linker sequence fusing to the downstream of VH and upstream of VL. VH and VL PCR products and the pSYN1 vector were then assembled by isothermal DNA assembly following the previously published method (Gibson et al. Nature Methods, 2009). Myc tag, 6-his tag and a C-terminal cysteine were also fused to the C-terminal of the diabody in the process. All the coding sequences were confirmed by sequencing before protein expression.

(157) Expression and purification of cys-diabody. The cys-diabody constructs were cloned into pSYN1 or pET22b vectors. The pSYN1 vector was transformed into TG1 bacteria while pET22b was transformed into Origami 2 (DE3) pLysS bacteria (Novagen) for protein expression. The H2 cys-diabody exhibitied better yield with pSYN1 vector and TG1 strain, while others exhibited better yield with the pET22b vector and Origami 2 (DE3) pLysS. The bacteria cells were grown at 37 degrees until O.D. 600 reached 1. The expression was then induced by addition of 0.5 mM to 1 mM IPTG at 20 degrees overnight. The bacteria cells were then collected and lysed by bugbuster master mix (EMD Millipore, 71456), with 1 mM phenylmethylsulfonyl fluoride (PMSF) and 20 mM imidazole. The soluble fraction was then collected after centrifugation and filtered through 0.22 m filter before loading to a HisTrap HP column (GE Healthcare, 17-5247-01). The 6-his tagged cys-diabodies were then eluted with imidazole, desalted with PD-10 column (GE Healthcare, 17-0851-01), and dialyzed against PBS.

(158) Flow Cytometry.

(159) For phage antibodies, flow cytometry was used to confirm their binding to c-MET expressing cells. Bacteria culture containing phage was concentrated 30 times into PBS according to published method (Antibody Engineering Methods and Protocols, Benny K. C. Lo). 25105 c-MET positive Hcc827 or Hcc827-GR6 cells (Engelman et. al, Science, 2007) were incubated with 100 ul concentrated phage and 30 ul 4% milk-PBS on ice for 1 hour. Cells were then washed using flow buffer (PBS, 1% FBS, 2 mM EDTA), and the binding phage antibodies were detected by FITC conjugated anti-M13 monoclonal antibody (Santa Cruz Biotechnology, Cat# sc-53005 Fitc).

(160) The affinities of the cys-diabodies were evaluated by flow cytometry. Serial diluted cys-diabodies were incubated with Hcc827-GR6 cells at 4 degrees for 2 hours. The cys-diabodies were detected with 1/100 mouse anti-c-Myc antibody (Sigma, Cat# M4439) and stained with 1/100 PE or FITC conjugated goat anti mouse IgG polyclonal antibody (Jackson ImmunoResearch) in flow buffer.

(161) Cell Growth Assays.

(162) Cell growth and inhibition were evaluated by MTS assay. The MTS assay was based on the ability of live cells to convert 3-(4,5-dimethylthiazol-2-yl)-5-(3-carboxymethoxyphenyl)-2-(4-sulfophenyl)-2H-tetrazolium (MTS) to formazan. The quantity of formazan product was measured by 500 nm absorbance, which is proportional to the number of living cells in culture. The assay was performed with the CellTiter96 AQueous Assay Kit from Promega (Cat# G5421), according to the recommended protocol. 2104 cells were seeded in each well of the 96-well plates and treated with different combination of antibodies and drugs for 3 days before the MTS assay. Each combination of cell line and drug and antibody treatment was set up in at least 4 replicate wells. And the results were normalized to the cells treated with media only.

(163) Anti-MET ELISA.

(164) 1 g of purified anti-MET cys-diabodies in 1004, PBS were used to coat each well at 4 degree overnight. Anti-EpCAM cys-diabody or 2% milk-PBS were used for negative controls. The overnight coated plate was then washed with PBS and blocked with 2% milk-PBS at 37 degree for 2 hours. The plate was then washed with PBS before adding 0.1 g human or mouse MET-hIgG Fc fusion protein (purchased from Sino Biological Inc.) in 1004, 2% milk-PBS to each well. The plate was incubated at room temperature for 1.5 hours, and then washed with PBS-Tween and PBS. The captured human or mouse MET-hIgG Fc were detected with alkaline phosphatase conjugated goat anti-human IgG.

(165) Cell Lines and Tumor Models.

(166) Hcc827 parental cells and the gefitinib resistant Hcc827-GR6 cells were obtained from Jeffrey A. Engelman's lab. The parental Hcc827 cells were maintained with RPMI 1640 media supplemented with 10% FBS (fetal bovine serum, Invitrogen), 1% sodium pyruvate (Invitrogen) and 1% penicillin-streptomycin (Invitrogen). The Hcc827-GR6 cells were maintained with RPMI1640 media supplemented with 10% FBS, 1% sodium pyruvate, 1% penicillin-streptomycin and 100 nM gefitinib (Santa Cruz biotechnology, Cat#: sc-202166). MKN45 cells (Japanese Collection of Research Bioresources cell bank) were maintained in RPMI 1640 media supplemented with 10% FBS. C6 rat glioma cells were maintained in deficient DME high glucose media (Irvine Scientific) supplemented with 10% FBS, 1% penicillin-streptomycin and 2 mM L-glutamine. Female SCID mice (Jackson Laboratory) were injected subcutaneously into the left or right shoulders with cells (2-410.sup.6) in growth media: 50% Matrigel (BD Biosciences). The tumors were allowed to develop for 2-5 weeks before imaging. All animal studies were carried out under a protocol approved by the Chancellor's Animal Research Committee of the University of California in Los Angeles.

(167) Radiolabeling of Cys-Diabodies.

(168) Antibody fragments were first dialyzed into metal free PBS (0.5-2 mg/mL). Cys-diabodies were treated with 15-20 fold excess of TCEP (tris(2-carboxyethyl)phosphine) for approximately 2 hours at room temperature to reduce the C-terminal disulfide bond into free thiols. 20-fold excess Deferoxamine-maleimide (Macrocyclics, Cat#: B-772) was then added to the reaction to site-specifically label the C-terminal cysteine. After 3-4 hours at room temperature, the site-specifically labeled cys-diabody-maleimide-DFO was purified with PD-10 column (GE Healthcare). Zr-89 oxalic acid solution (Washington University) was neutralized with Na.sub.2CO.sub.3 (2M) and HEPES buffer (1M, pH 7.0), and then reacted with the cys-diabody-meleimide-DFO at room temperature for 1 hour. The Zr-89 labeled antibody fragments were then purified with PD-10 column. The labeling efficiency and radio-chemical purity were determined by ITLC (instant thin-layer chromatography). To assess immunoreactivity, a small amount of radiolabeled antibody fragment (0.2 ng) was incubated with excess antigen positive MKN45 cells (100 million cells in 0.5 mL PBS with 1% FBS) for 1 hour at room temperature, after which the cells were pelleted and washed with 1 mL PBS twice. The radioactivity of the combined and supernatant and cell pellet was measured by a Wizard 3 1480 Automatic Gamma Counter (Perkin-Elmer, Covina, Calif.). The immunoreactivity was calculated by dividing the radioactivity in the cell pellet with the total radioactivity of supernatant and cell pellet. The antigen negative C6 cells were also used as negative control.

(169) Small Animal PET Imaging and Ex-Vivo Biodistribution Studies.

(170) Tumor bearing mice were injected via tail vein with approximately 18-25 g of Zr-89 labeled cys-diabody in PBS. The 10-minute micro-PET scans were performed at 4 and 20 hours post injection with an Inveon PET Scanner (Siemens). A 10-minute CT scan was performed after each micro-PET scan to provide anatomical reference, with a MicroCAT II Scanner (Concorde Microsystems). The mice were anesthetized with 2% isoflurane during the scanning process. Micro-PET images were reconstructed using a filtered backprojection algorithm, and analyzed with AMIDE software. Ex-vivo biodistribution studies were performed after the final imaging time point. Organs, tumors and blood were harvested and weighed, and the radioactivities were measured with Wizard 3 1480 Automatic Gamma Counter. The percent injected dose per gram of tissue (% ID/g) was calculated after decay correction to evaluate the uptake level in each organ.

(171) Results. The naive human scFv library with 6.7109 members (Sheets library) was panned against human c-MET recombinant protein. The amount of antigen used, the input and output phage number and the recovery for each round is shown in Table 3.

(172) TABLE-US-00027 TABLE 3 Results of 3 rounds of anti-cMET panning Antigen used Input phage Output phage Recovery Round 1 100 g 6.8 10.sup.12 cfu 3.6 10.sup.8 cfu 5 10.sup.5 c-MET Fc chimera (R&D) Round 2 30 g c-MET 2 10.sup.13 cfu 7 10.sup.6 cuf 3.5 10.sup.7 (Sino Biological) Round 3 20 g c-MET 1 10.sup.14 cfu 5 10.sup.6 cfu 5 10.sup.8 (Sino Biological)

(173) 93 clones were randomly picked after 3 rounds of panning. The phage-containing supernatant was used for phage ELISA. Top 64 clones with highest A405 signal were sequenced, among which 19 distinctive clones with different sequences were identified. These distinctive clones were then tested for binding to cell surface MET by phage flow experiments. 8 of these clones show good binding to cell surface MET and were selected for the subsequent purification and characterizations. The phage flow results of the 8 best clones are shown in FIG. 5.

(174) H2, C2, and H5 cys-diabodies were expressed in higher levels than other clones. H2 cys-diabody was expressed well with pSYN1 vector in TG1 bacteria, with the yield of 3 mg per liter. C2 and H5 cys-diabodies were expressed with pET22b vector in Origami-2 (DE3) pLysS bacteria, with the yield of 0.6 mg per liter and 1 mg per liter respectively.

(175) The affinity of these 3 cys-diabodies were evaluated by flow cytometry. The concentrations of the purified proteins were determined by their A280, measured with Nanodrop 2000 (Thermal Scientific), and their calculated extinction coefficient (ProtParam tool, expasy.org). The binding curve was fitted with one-site total binding model by GraphPad Prism. The estimated dissociation constants were listed in Table 4 and the fitted binding curves are shown in FIG. 6.

(176) TABLE-US-00028 TABLE 4 Estimated dissociation constants and standard errors of the C2, H2 and H5 cys-diabodies Kd (dissociation constant) Std. Error C2 cys-diabody 2.4 nM 0.2 nM H2 cys-diabody 0.61 nM 0.07 nM H5 cys-diabody 4.6 nM 0.6 nM

(177) Different cell lines were treated with C2, H2 or H5 cys-diabodies at different concentrations with or without 1 micromolar of gefitinib for 3 days, and then the cell growth was evaluated with MTS assay. While H2 cys-diabody shows inhibition effect of the MET amplified, drug resistant Hcc827-GR6 cells with or without gefitinib, C2 cys-diabody actually protects the sensitive Hcc827 cells from gefitinib inhibition. H5 cys-diabody also shows inhibition of the resistant cells at higher concentration. All three cys-diabodies show no effects on the parental Hcc827 cells without gefitinib. These results are shown in FIG. 7.

(178) Anti-MET ELISA to Test Cross Reactivity of Cys-Diabodies.

(179) C2, H2 and H5 cys-diabodies were used to coat 96-well ELISA plate to capture human or mouse MET-hIgG Fc fusion protein. The human IgG Fc on the fusion protein was detected with alkaline phosphatase conjugated goat anti-human IgG. The results in FIG. 4 show H2 cys-diabody can bind to both human and mouse MET protein, while C2 and H5 cys-diabodies show minimal cross reactivity to the mouse MET. Anti-EpCAM H9 cys-diabody or 2% milk-PBS were used as negative controls.

(180) Anti-MET PET Imaging Using Zr-89 Labeled 112 Cys-Diabody.

(181) SCID mice were injected with either MET positive Hcc827 parental cells or Hcc827-GR6 resistant cells to the left shoulders, and C6 cells to the right shoulders as negative controls. H2 cys-diabody was site-specifically labeled with maleimide-DFO, and then radio-labeled with Zr-89. The radioactive H2 cys-diabody was then injected to the tumor bearing SCID mice through tail vein. FIG. 5A shows two SCID mice with similar-sized MET positive tumors (Hcc827: 212 mg; Hcc827-GR6: 262 mg) scanned at 4 hours and 20 hours post injection. FIG. 5B shows ex-vivo biodistribution study. The result shows significant difference in tumor uptake for Hcc827 and Hcc827-GR6 (n=4, P=0.0013). The difference in tumor uptake level (Hcc827: 1.10.1% ID/gram; Hcc827-GR6: 1.80.2% ID/gram) agrees with the difference in MET expression level (Hcc827: 6.710.sup.4; Hcc827-GR6: 2.610.sup.5).

Example 2

(182) MET over-expression is a known mechanism for acquired gefitinib resistance. J. Engelman's lab (Harvard) obtained several gefitinib resistant cell lines from Hcc827 cells by prolonged gefitinib treatment (Engelman et al. 2007, Science). These cells showed increased MET copy number and expression level. One of these cell lines, the GR6 cell line, was obtained and a higher MET expression level compared to Hcc827 parental cells by flow cytometry was determined. It was also found that the parental Hcc827 cells down-regulate their MET level by 50% after 18 hours of drug treatment. Accordingly, MET can be used as a resistance marker and a response marker.

(183) Three rounds of selections on human MET protein were performed, and three cys-diabodies were reformatted and purified (the C2, H2 and H5 cys-diabodies). The C2, H2 and H5 cys-diabodies were tested for cross-reactivity to mouse MET protein. Different cys-diabodies were coated to 96-well plate (milk or anti-EpCAM cys-diabody was used as negative control). Either mouse or human MET protein was applied to the coated cys-diabodies. Then the MET-hFc proteins were detected by anti-human Fc antibody. C2 and H5 cys-diabodies were shown to bind to only human MET, while H2 was shown to also cross react with mouse MET protein.

(184) The affinities of these 3 diabodies were determined by flow cytometry using the Hcc827 GR6 cell line, which expresses high level MET.

(185) These diabodies also show therapeutic effects on resistant cells with MET amplification. The parental cell line, Hcc827, was treated with the diabodies for 3 days, and the diabodies show no effects on the growth of the parental line at all. The diabodies were also applied to the resistant cell line GR6 with or without 1 M gefitinib, and H2 showed the greatest inhibition effect, while C2 and H5 show inhibition only at high concentrations.

(186) These diabodies were also applied to other resistant cells without MET amplification (H1975 and H1650). The diabodies had no effect on such cells. (Data not shown). The H2 cys-diabody was site specifically conjugated with maleimide-DOTA and radiolabeled with .sup.64Cu for PET imaging. Initial experiments showed targeting to both parental and resistant tumor.

(187) Each publication, patent application, patent, and other reference cited herein is incorporated by reference in its entirety to the extent that it is not inconsistent with the present disclosure. In particular, all publications cited herein are incorporated herein by reference in their entirety for the purpose of describing and disclosing the methodologies, reagents, and tools reported in the publications that might be used in connection with the invention. Nothing herein is to be construed as an admission that the invention is not entitled to antedate such disclosure by virtue of prior invention.

(188) Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it will be readily apparent to those of ordinary skill in the art in light of the teachings of this invention that certain changes and modifications may be made thereto without departing from the spirit or scope of the appended claims.