PROTOCELLS TO TREAT MICROBIAL INFECTION AND FOR SYNERGISTIC DELIVERY
20190262469 ยท 2019-08-29
Inventors
- C. Jeffrey Brinker (Albuquerque, NM)
- Eric C. Carnes (Albuquerque, NM, US)
- Carlee Erin Ashley (Albuquerque, NM, US)
- Oscar Negrete (Pleasanton, CA, US)
- Dan C Wilkinson (Los Angeles, CA, US)
- Brian S Wilkinson (Albuquerque, NM, US)
- David Patrick Padilla (Albuquerque, NM, US)
Cpc classification
A61K31/7088
HUMAN NECESSITIES
B82Y40/00
PERFORMING OPERATIONS; TRANSPORTING
A61K9/5146
HUMAN NECESSITIES
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
A61K9/1271
HUMAN NECESSITIES
B82Y5/00
PERFORMING OPERATIONS; TRANSPORTING
A61K47/6913
HUMAN NECESSITIES
A61K47/6929
HUMAN NECESSITIES
International classification
A61K47/69
HUMAN NECESSITIES
Abstract
The present disclosure relates to protocells that are useful in the treatment and prevention of viral infections, including but not limited to infections caused by a Hendra virus and Nipah virus (NiV). The present disclosure relates to protocells that are useful in the treatment of bacterial infections, including antibiotic-resistant bacterial infections. The protocells are coated with a lipid bi- or multilayer comprising at least one moiety that targets a viral cellular receptor and at least one moiety that ruptures a virally-infected cell membrane. The present disclosure further relates to novel mesoporous metal oxide nanoparticles and related protocells that are useful in the treatment and/or prevention of a wide variety of disorders, including a cancer or a bacterial or viral infection. Such nanoparticles and protocells can be functionalized to allow for synergistic loading of a wide variety of active ingredients.
Claims
1. An antimicrobial protocell comprising a mesoporous silica or metal oxide nanoparticle which is loaded with an anti-viral or anti-bacterial cargo and which is coated with a lipid bi- or multilayer, wherein: (a) the mesoporous metal oxide nanoparticle has a pore size which ranges from about 0.001 to about 100 nm, and a diameter ranging from about 25 nm to about 500 nm; and (b) the lipid bi- or multilayer comprises at least one targeting moiety that targets a virally-infected or a bacterially-infected host cell.
2. The protocell of claim 1, wherein the targeting moiety is a peptide or single chain variable fragment (scFv), or wherein the targeting moiety targets ephrin B2 and/or ephrin B3 or is a peptide or single chain variable fragment (scFv) that targets ephrin B2 and/or ephrin B3, or wherein the targeting moiety comprises one or more amino acid sequences selected from the groups consisting of TGAILHP, QGAINHP, QHIRKPP, QHRIKPP and QHILNPP, or wherein the targeting moiety is a peptide or single chain variable fragment (scFv) and optionally wherein the targeting moiety is a Fc from human IgG, human complement C3, ephrin B2 or mannosylated cholesterol.
3. The protocell of claim 1, further comprising an endosomolytic moiety, which optionally is a peptide and optionally ruptures acidic intracellular vesicles of the virally-infected cell, and optionally is a peptide selected from the group consisting of octaarginine (RS), H5WYG, Penetratin-HA2, modified HA2-TAT, 43E and Histidine 10, or further comprising an endosomolytic moiety wherein the endosomolytic moiety optionally ruptures a bacterially-infected cell membrane ruptures acidic intracellular vesicles of the bacterially-infected cell.
4. The protocell of claim 1, wherein the antiviral cargo is selected from the group consisting of a small molecule, a mRNA, a siRNA, a shRNA, a micro RNA, a PNA, a PNA comprised of RNA's, an antibody, a protein, a protein toxin (e.g., ricin toxin A-chain or diphtheria toxin A-chain) and/or DNA (including double stranded or linear DNA, minicircle DNA, plasmid DNA which may be supercoiled and/or packaged (e.g., with histones) and which may be optionally modified with a nuclear localization sequence), ribavirin or a nucleic acid or wherein the antiviral cargo is a siRNA or microRNA which targets conserved regions of EEEV or VEEV RNA-dependent RNA polymerase (RdRp) or nsp1 and E1 glycoprotein genes, an antibody fragment, or an IgG molecule or a fragment thereof.
5-6. (canceled)
7. The protocell of claim 1, wherein the nanoparticle is an aminated mesoporous silica nanoparticle (MSNP) optionally the nanoparticle is aminated with aminopropyltriethoxysilane (APTES) or 3-[2-(2 aminoethylamino)ethylamino]propyltrimethoxy silane (AEPTMS).
8. (canceled)
9. The protocell of claim 1, wherein the nanoparticle has a differential pore volume of between about 0.25 cm.sup.3/g to about 10 cm.sup.3/g, from about 0.3 cm.sup.3/g to about 3 cm.sup.3/g or from about 0.25 cm.sup.3/g to about 1.5 cm.sup.3/g, or has a nominal BET surface area of between about 50 m.sup.2/g to about 1,500 m.sup.2/g, or from about 100 m.sup.2/g to about 1,300 m.sup.2/g.
10. The protocell of claim 1, wherein the nanoparticle is a mesoporous silica nanoparticle (MSNP) and wherein the weight ratio of antiviral cargo to silica ranges from about 0.10 to about 0.75.
11. The protocell of claim 1, wherein the nanoparticle has a pore size ranges from about 0.001 to about 100 nm, from about 0.01 nm to about 50 nm, from about 0.1 to about 100 nm, or from about 2 nm to about 25 nm.
12. (canceled)
13. The protocell of claim 1, wherein the antibacterial cargo is effective in the treatment of an infection caused by a bacterium selected from the group consisting of multidrug-resistant (MDR) Klebsiella pneumoniae (Kpn), methicillin-resistant Staphylococcus aureus (MRSA), F, tularensis and B, pseudomallei pr wherein the antibacterial cargo is a nucleic acid molecule capable of inhibiting the translation of a mRNA selected from the group consisting of a TEM beta-lactamase (class A) mRNA, a SHV beta-lactamase (class A) mRNA, a CTX-M beta-lactamase (class A) mRNA, an OXA beta-lactamase (class D) mRNA, a PER mRNA, a VEB mRNA, a GES mRNA, an IBC beta-lactamase mRNA, an AmpC type -lactamase mRNA, and a carbapenemase mRNA (including but not limited to KPC (K, pneumoniae carbapenemase) (Class A) mRNA), and the mammalian and non-mammalian orthologs thereof or wherein the antibacterial cargo comprises a nucleic acid molecule capable of inhibiting the translation of a mRNA selected from the group consisting of Metallo-beta-lactamase NDM-1 mRNA, SHV and TEM beta-lactamase mRNA, CMY-6 AmpC-type beta-lactamase mRNA, CTX-M-15 extended spectrum beta-lactamase mRNA: TEM-1 beta-lactamase mRNA: OXA-1 beta-lactamase mRNA: Aminoglycoside-(3)(9)-adenyltransferase AADA2 mRNA: Sul1 dihydropteroate synthase mRNA: Undecaprenyl-diphosphatase mRNA: 16S ribosomal RNA methyltransferase mRNA; AAC(6)-Ib aminoglycoside 6-N-acetyl transferase type Ib mRNA; Sul1 dihvdropteroate synthase mRNA: 16S rRNA methyltransferase RmtC mRNA; Aminoglycoside 3 phosphotransferase APH(3)-Ib (strA) mRNA; Sul2 mRNA, sulfonamide insensitive dihvdropteroate svnthetase mRNA: Streptomycin 3-O-adenylyltransferase aadA ANT(3)-Ia mRNA: Dfra14 trimethoprim-resistant dihydrofolate reductase mRNA: QnrB10 mRNA: Aminoglycoside N(3)-acetyltransferase II (ACC(3)-II)mRNA; Tetracycline efflux protein TetA mRNA; and Macrolide 2-phosphotransferase mphA mRNA, and the mammalian and non-mammalian orthologs thereof, and optionally, wherein the nucleic acid molecule is selected from the group comprising siRNA, miRNA, shRNA and/or asRNA, or wherein the antibacterial cargo is a peptide nucleic acid (PNA) comprising nucleic acid molecules which inhibit the translation of a mRNA selected from the group consisting of a TEM beta-lactamase (class A) mRNA, a SHV beta-lactamase (class A) mRNA, a CTX-M beta-lactamase (class A) mRNA, an OXA beta-lactamase (class D) mRNA, a PER mRNA, a VEB mRNA, a GES mRNA, an IBC beta-lactamase mRNA, an AmpC type -lactamase mRNA, and a carbapenemase mRNA (including but not limited to KPC (K, pneumoniae carbapenemase) (Class A) mRNA), and the mammalian and non-mammalian orthologs thereof or wherein the antibacterial cargo comprises a peptide nucleic acid (PNA) comprising nucleic acid molecules that inhibit the translation of a mRNA selected from the group consisting of Metallo-beta-lactamase NDM-1 mRNA, SHV and TEM beta-lactamase mRNA, CMY-6 AmpC-type beta-lactamase mRNA, CTX-M-15 extended spectrum beta-lactamase mRNA: TEM-1 beta-lactamase mRNA; OXA-1 beta-lactamase mRNA; Aminoglycoside-(3)(9)-adenyltransferase AADA2 mRNA; Sul1 dihydropteroate synthase mRNA; Undecaprenyl-diphosphatase mRNA: 16S ribosomal RNA methyltransferase mRNA: AAC(6)-Ib aminoglycoside 6-N-acetyl transferase type Ib mRNA; Sul1 dihydropteroate synthase mRNA; 16S rRNA methyltransferase RmtC mRNA: Aminoglycoside 3 phosphotransferase APH(3)-Ib (strA) mRNA: Sul2 mRNA, sulfonamide insensitive dihydropteroate synthetase mRNA: Streptomycin 3-O-adenylyltransferase aadA ANT(3)-Ia mRNA: Dfra14 trimethoprim-resistant dihydrofolate reductase mRNA; QnrB10 mRNA; Aminoglycoside N(3)-acetyltransferase II (ACC(3)-II)mRNA: Tetracycline efflux protein TetA mRNA: Macrolide 2-phosphotransferase mphA mRNA, and the mammalian and non-mammalian orthologs thereof, asRNA molecules which comprise one or more nucleotide sequences selected from the group consisting of caagttttc, gaaatcagt, gaaatcagt, gggattcct, actcttcct, ttaatgagg, tcaaaggcc, eggctcggc, ccaattaaa, tgggtatta, ttaatgagg, ggcgtcagc, atatggtct, agaggttc, aggggcttc, gatgttaa, attctcat, atttgtacc, cgcgatatc, gtctggcct and gattcactc and equivalents and fragments thereof, a peptide nucleic acid (PNA) which binds to a ribosomal binding site of one or more genes selected from the group consisting of qnrB9, aac(6)-Ib, sul1, bla.sub.SHV-11, bla.sub.CTX-M-15, blaNDM-1, the bla gene encoding TEM-1 and equivalents thereof, clavulanic acid, Gentamicin, Kanamycin, Neomycin, Netilmicin, Tobramycin, Paromomycin, Spectinomycin, Geldanamycin, Herbimycin, Rifaximin, Streptomycin, Ertapenem, Doripenem, Imipenem/Cilastatin, Meropenem, Cefadroxil, Cefazolin, Ceohalothin, Cephalexin, Cefaclor, Cefamandole, Cefoxitin, Cefprozil, Cefuroxime, Cefixime, Cefdinir, Cefditoren, Cefoperazone Cefotaxime, Cefpodoxime, Ceftazidime, Ceftibuten, Ceftizoxime Ceftriaxone, Cefeoime, Ceftaroline fosamil, Ceftobiorole, Teicoplanin, Vancomycin, Telavancin, Daptomycin, Oritavancin, WAP-8294A, Azithromycin, Clarithromycin, Dirithromycin, Erythromycin, Roxithromycin, Telithromycin, Spiramycin, Clindamycin, Lincomycin, Aztreonam, Furazolidone, Nitrofurantoin, Oxazolidinones, Linezolid, Posizolid, Radezolid, Torezolid, Amoxicillin, Ampicillin, Azlocillin, Carbenicillin, Cloxacillin Dicloxacillin, Flucloxacillin, Mezlocillin, Methicillin, Nafcillin, Oxacillin, Penicillin G, Penicillin V, Piperacillin, Temocillin, Ticarcillin, Amoxicillin/clavulanate, Ampicillin/sulbactam, Piperacillin/tazobactam, Ticarcillin/clavulanate, Bacitracin, Colistin, Polymyxin B, Ciprofloxacin, Enoxacin, Gatifloxacin, Gemifloxacin, Levofloxacin, Lomefloxacin, Moxifloxacin, Nalidixic acid, Norfloxacin, Ofloxacin, Trovafloxacin, Grepafloxacin, Sparfloxacin, Mafenide, Sulfacetamide, Sulfadiazine, Sulfadimethoxine, Sulfamethizole, Sulfamethoxazole, Sulfasalazine, Sulfisoxazole, Trimethoprim-Sulfamethoxazole, Sulfonamidochrvsoidine, Demeclocycline, Doxycycline, Vibramycin Minocycline, Tigecycline, Oxytetracycline, Tetracycline, Clofazimine, Capreomycin, Cycloserine, Ethambutol, Rifampicin, Rifabutin, Rifapentine, Arsphenamine, Chloramphenicol, Fosfomycin, Fusidic acid, Metronidazole, Mupirocin, Platensimycin, Quinupristin/Dalfopristin, Thiamphenicol, Tigecycline or Tinidazole, and combinations thereof.
14. The protocell of claim 1, wherein the nanoparticle is a silica nanoparticle (MSNP) which is coated with a lipid bi- or multilayer and wherein: (a) at a pH of about 7 and a period of about 12 days after delivery, the protocell will release no more than about 10 wt % of its antiviral cargo; and (b) at a pH of about 5 and a period of about one day after delivery, the protocell will release no less than about 90 wt % of its antiviral cargo, or wherein the nanoparticle is a mesoporous silica nanoparticle (MSNP) which is coated with a lipid multilayer and wherein: (a) at a pH of about 7 and a period of about 12 days after delivery, the protocell will release no more than about 5 wt % of its antiviral cargo; and (b) at a pH of about 5 and a period of about ten days after delivery, the protocell will release no less than about 10 wt % to about 60 wt % of its antiviral cargo.
15. (canceled)
16. The protocell of claim 1, wherein the nanoparticle is loaded with: (a) an anti-HIV agent selected from the group consisting of 3TC (Lamivudine), AZT (Zidovudine), ()-FTC, ddI (Didanosine), ddC (zalcitabine), abacavir (ABC), tenofovir (PMPA), D-D4FC (Reverset), D4T (Stavudine), Racivir, L-FddC, L-FD4C, NVP (Nevirapine), DLV (Delavirdine), EFV (Efavirenz), SQVM (Saquinavir mesylate), RTV (Ritonavir), IDV (Indinavir), SQV (Saquinavir), NFV (Nelfinavir), APV (Amprenavir), LPV (Lopinavir), T20, fuseon, and mixtures thereof; or (b) an anti-HBV agent selected from the group consisting of hepsera (adefovir dipivoxil), lamivudine, entecavir, telbivudine, tenofovir, emtricitabine, clevudine, valtorcitabine, amdoxovir, pradefovir, racivir, BAM 205, nitazoxanide, UT 231-B, Bay 41-4109, EHT899, zadaxin (thymosin alpha-1), and mixtures thereof; or (c) an anti-HCV agent selected from the group consisting of interferon, pegylated interferon, ribavirin, NM 283, VX-950 (telaprevir), SCH 50304, TMC435, VX-500, BX-813, SCH503034, R1626, ITMN-191 (R7227), R7128, PF-868554, IT033, CGH-759, GI 5005, MK-7009, SIRNA-034, MK-0608, A-837093, GS 9190, ACH-1095, GSK625433, TG4040 (MVA-HCV), A-831, F351, NS5A, NS4B, ANA598, A-689, GNI-104, IDX102, ADXI84, GL59728, GL60667, PSI-7851, TLR9 Agonist, PHX1766, SP-30, and mixtures thereof.
17-20. (canceled)
21. The protocell of claim 1, wherein the nanoparticle has a differential pore volume of between about 0.25 cm.sup.3/g to about 10 cm.sup.3/g, optionally from about from about 0.3 cm.sup.3/g to about 3 cm.sup.3/g or from about 0.25 cm.sup.3/g to about 1.5 cm.sup.3/g, or wherein the nanoparticle has a nominal BET surface area of between about 50 m.sup.2/g to about 1,500 m.sup.2/g, optionally from about 100 m.sup.2/g to about 1,300 m.sup.2/g.
22-28. (canceled)
29. A nanoparticle comprising silica or metal oxide, the nanoparticle functionalized with a hydrophobic group and loaded with a water-insoluble cargo.
30. The nanoparticle of claim 29, wherein the nanoparticle is porous and wherein the pores optionally have a diameter of about 0.01 nm to about 50 nm.
31. The nanoparticle of claim 29, wherein the hydrophobic group is a methyl group or a phenyl group.
32. The nanoparticle of claim 29, wherein the nanoparticle is functionalized with a hydrophobic organosiloxane which hydrophobic organosiloxane optionally is hexamethyldisilazane (HDMS), sodium bis(trimethylsilyl)amide (NaHDMS), potassium bis(trimethylsilyl)amide (KHDMS), or phenyltriethoxysilane (PTS).
33-39. (canceled)
40. An evaporation-induced self-assembly (EISA) process for making functionalized silica nanoparticles loaded with a water-insoluble cargo comprising: (a) atomizing a precursor solution to generate droplets; wherein the precursor solution comprises (1) a surfactant, (2) tetraethyl orthosilicate (TEOS) or tetramethyl orthosilicate (TMOS), (3) a C.sub.1-4 alcohol, (4) a hydrophobic organosiloxane, and (5) water; (b) drying and heating the droplets, thereby evaporating solvent and increasing effective surfactant concentration; and (c) loading the nanoparticles with a water-insoluble cargo or (i) combining an aqueous phase precursor solution and an oil phase precursor solution, thereby forming an emulsion, whereinthe aqueous phase precursor solution comprises a hydrophobic organosiloxane, a first surfactant, tetraethyl orthosilicate (TEOS) or tetramethyl orthosilicate (TMOS), an acid, and water, and the oil phase precursor solution comprises a second surfactant and an oil; (ii) heating the emulsion, thereby generating nanoparticles; (iii) separating the nanoparticles from the remaining emulsion; (iv) loading the nanoparticles with a water-insoluble cargo.
41. The evaporation-induced self-assembly (EISA) process of claim 40, wherein the surfactant is below the critical micelle concentration of the surfactant.
42. The evaporation-induced self-assembly (EISA) process of claim 40, wherein the surfactant comprises a cationic surfactant or wherein the surfactant is selected from the group consisting of a dodecylsulfate salt, a tetradecyl-trimethyl-ammonium salt, a hexadecyltrimethylammonium salt, an octadecyltrimethylammonium salt, a dodecylethyldimethylammonium salt, a cetylpyridinium salt, polyethoxylated tallow amine (POEA), hexadecyltrimethylammonium p-toluenesulfonate, a benzalkonium salt, a Brij surfactant, a poloxamer, and a benzethonium salt or wherein the surfactant is selected from the group consisting of benzethonium chloride, benzalkonium chloride, cetylpyridinium chloride, dodecylethyldimethylammonium bromide, octadecyltrimethylammonium bromide, hexadecyltrimethylammonium bromide, tetradecyl-trimethyl-ammonium bromide, tetradecyl-trimethyl-ammonium chloride, sodium dodecylsulfate, lithium dodecylsulfate, Brij-56, Pluronic F108, and Pluronic P123.
43-56. (canceled)
Description
BRIEF DESCRIPTION OF THE FIGURES
[0106]
[0107]
[0108]
[0109]
[0110]
[0111]
[0112]
[0113]
[0114]
[0115]
[0116]
[0117]
[0118]
[0119]
[0120]
[0121]
[0122]
[0123]
[0124]
[0125]
[0126]
[0127]
[0128]
[0129]
[0130]
[0131]
[0132]
[0133]
[0134]
[0135]
[0136]
[0137]
[0138]
[0139]
[0140]
[0141]
[0142]
[0143]
[0144]
[0145]
[0146]
[0147]
[0148]
[0149]
[0150]
[0151]
[0152]
[0153]
[0154]
[0155]
[0156]
[0157]
[0158]
[0159]
DETAILED DESCRIPTION
Definitions
[0160] The following terms shall be used throughout the specification. Where a term is not specifically defined herein, that term shall be understood to be used in a manner consistent with its use by those of ordinary skill in the art.
[0161] Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context dearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges is also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either both of those included limits are also included in the invention. In instances where a substituent is a possibility in one or more Markush groups, it is understood that only those substituents which form stable bonds are to be used.
[0162] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing, in one embodiment methods and materials are now described.
[0163] It must be noted that as used herein and in the appended claims, the singular forms a, and and the include plural references unless the context clearly dictates otherwise.
[0164] The term broadly neutralizing Ab means an Ab that can recognize and neutralize multiple variants of highly variable antigens, which is particularly important in protection against fast mutating viruses such as the influenza virus. Artificial passive immunization relies on administration of pathogen-specific and neutralizing Abs present in the serum of an immunized individual or purified either from such a serum or from any protein expression system. This process leads to curing of the existing infection (therapeutic immunization) and/or to a short-term protection against subsequent infections (protective immunization).
[0165] The term protocell is used to describe a porous nanoparticle which is made of a material comprising silica, polystyrene, alumina, titania, zirconia, or generally metal oxides, organometallates, organosilicates or mixtures thereof. A porous (typically spherical) silica nanoparticle is used for the in one embodiment protocells and is surrounded by a supported lipid or polymer bilayer or multilayer. Various embodiments provide nanostructures and methods for constructing and using the nanostructures and providing protocells.
[0166] Multiphase pore-surface structure means that a nanoparticulate's pores and surface exhibit two (biphasic) or more distinct morphologies (e.g., crystalline or amorphous structures), as determined through well-known techniques such as X-ray absorption spectroscopy (XAS), X-ray diffraction (XRD) and inductively coupled plasma (ICP). See e.g., Moreau, et al., (2013).
[0167] Cationic surfactant and the poloxamer have different phases means that the cationic surfactant and poloxamer exhibit apparent absolute immiscibility at all ratios of the cationic surfactant and poloxamer.
[0168] Self-assembly using a templating surfactant system, e.g., as employed in aerosol-assisted evaporation-induced self-assembly (EISA), is described in Lu, Y. F. and Brinker J. C. et al. Aerosol-assisted self-assembly of mesostructured spherical nanoparticles, Nature 398, 223-226 (1999)), the complete contents of which are hereby incorporated by reference. As explained in U.S. Pat. No. 8,334,014, [t]emplating of oxide materials with surfactant micelles is a powerful method to obtain mesoporous oxide structures with controlled morphology. In this method, an oxide precursor solution is mixed with a templating surfactant and evaporation of the solvent leads to an increase in the surfactant concentration. The surfactant forms supra-molecular structures according to the solution phase diagram. This is known as evaporative induced self-assembly (EISA) and has been used to obtain bulk porous materials or microparticles using high-temperature aerosol methods. Alternatively, mesoporous particle synthesis via EISA can be performed in water in oil emulsion droplets under milder temperature stresses (citations omitted).
[0169] A multi-modal pore size distribution means that there are two or more nanoparticle pore size distributions, as opposed to a monomodal pore size distribution which exhibits a Gaussian or log normal form.
[0170] Differential pore volume distributions can be considered in the broadest sense to be logarithmic differential pore volume distributions defined by plots of (dV/dlog(D) vs. D (or [dV/dr]/[d(log (r)/dr] vs. r, where V is nanoparticle volume, D is nanoparticle diameter and r is nanoparticle radius. Differential pore volume distributions may be determined in a number of ways, including through use of the Barret-Joyner-Halenda (BJH) model, the Horvath-Kawazoe (HK) model and the Density Functional Theory (DFT) model, as illustrated in Muhammad Afiq Aizuddin Musa, Chun-Yang Yin and Robert Mikhail Savory, 2011, Analysis of the Textural Characteristics and Pore Size Distribution of a Commercial Zeolite using Various Adsorption Models, Journal of Applied Sciences, 11: 3650-3654. The theoretical bases of differential pore size distribution are presented in Meyer, et al., Comparison between different presentations of pore size distribution in porous materials, Fresenius' Journal of Analytical Chemistry, Vol. 363, Issue 2, pp. 174-178.
[0171] The term prophylactic administration refers to any action in advance of the occurrence of disease to reduce the likelihood of that disease or any action to reduce the likelihood of the subsequent occurrence of disease in the subject.
[0172] The term patient or subject is used throughout the specification within context to describe an animal, generally a mammal, especially including a domesticated animal and, e.g., a human, to whom treatment, including prophylactic treatment (prophylaxis), with the compounds or compositions is provided. For treatment of those infections, conditions or disease states which are specific for a specific animal such as a human patient, the term patient refers to that specific animal. In most instances, the patient or subject is a human patient of either or both genders.
[0173] The term effective is used herein, unless otherwise indicated, to describe an amount of a compound or component which, when used within the context of its use, produces or effects an intended result, whether that result relates to the prophylaxis and/or therapy of an infection and/or disease state or as otherwise described herein. The term effective subsumes all other effective amount or effective concentration terms (including the term therapeutically effective) which are otherwise described or used in the present application.
[0174] The term compound is used herein to describe any specific compound or bioactive agent disclosed herein, including any and all stereoisomers (including diastereomers), individual optical isomers (enantiomers) or racemic mixtures, pharmaceutically acceptable salts and prodrug forms. The term compound herein refers to stable compounds. Within its use in context, the term compound may refer to a single compound or a mixture of compounds as otherwise described herein.
[0175] The term cargo is used herein to describe any molecule or compound, whether a small molecule or macromolecule having an activity relevant to its use in MSNPs (MSNs), especially including biological activity, which can be included in MSNPs. The cargo may be included within the pores and/or on the surface of the MSNP. Representative cargo may include, for example, a small molecule bioactive agent, a nucleic acid (e.g., RNA or DNA), a polypeptide, including a protein or a carbohydrate. Particular examples of such cargo include RNA, such PNA's, PNA's comprising asRNA, mRNA, siRNA, shRNA micro RNA, a polypeptide or protein and/or DNA (including double stranded or linear DNA, complementary DNA (cDNA), minidrcle DNA, naked DNA and plasmid DNA (including CRISPR plasmids) which optionally may be supercoiled and/or packaged (e.g., with histones) and which may be optionally modified with a nuclear localization sequence). The nanoparticles may also be loaded with Locked Nucleic Acids (LNA), which are nucleic acid analogues in which the ribose ring is locked by a methylene bridge connecting the 2-O atom and the 4-C atom. Cargo may also include a reporter as described herein. Cargos may also include antibiotics or CPP-PNAs.
[0176] The term PEGylated in its principal use refers to an MSNP which has been produced using PEG-containing silanes or zwitterionic group-containing silanes to form the MSNP. In general, the amount of the PEG-containing silanes and/or zwitterionic-containing silanes which optionally are used to produce MSNPs represent about 0.05% to about 50% (about 0.1% to about 35%, about 0.5% to about 25%, about 1% to about 20%, about 2.5% to about 30%, about 0.25% to about 10%, about 0.75% to about 15%) by weight of these monomers in combination with the silane monomers which are typically used to form MSNPs. A PEG-containing silane is any silane which contains a PEG as one of the substituents and the remaining groups can facilitate the silane reacting with other silanes to produce MSNPs. For example, PEG-containing silanes and/or zwitterionic-containing silanes which are used in the present invention to create PEGylated MSNPs include 2-[methoxy(polyethyleneoxy)propyl]trimethoxysilane (containing varying molecular weights of PEG ranging from about 100 to 10,000 average molecule weight, often about 200 to 5,000 average molecular weight, about 1,000-2,500 average molecular weight, about 1500-2000 average molecular weight) and 3-{[Dimethoxyl(3-tnmethoxysilyl)propyl]ammonio)propane-1-sulfonate and mixtures thereof, among others. The term PEGylated may also refer to lipid bilayers which contain a portion of lipids which are PEGylated (from about 0.02% up to about 50%, about 0.1% to about 35%, about 0.5% to about 25%, about 1% to about 15%, about 0.5% to about 7.5%, about 1% to about 12.5% by weight of the lipids used to form the lipid bilayer or multilayer). These lipids often are amine-containing lipids (e.g., DOPE and DPPE) which are conjugated or derivatized to contain a PEG group (having an average molecule weight ranging from about 100 to 10,000, about 200 to 5,000, about 1,000-5,000, including 1,000, 2000, 3000 and 3400) and combined with other lipids to form the bilayer/multilayer which encapsulates the MSNP.
[0177] The terms targeting ligand, targeting active species, and targeting moiety are used interchangeably herein to describe a compound or moiety (for example, an antigen, antibody, or peptide) which is complexed or for example covalently bonded to the surface of a MSNPs and/or protocells which binds to a moiety on the surface of a cell to be targeted so that the MSNPs and/or protocells may selectively bind to the surface of the targeted cell and deposit their contents into the cell. The targeting active species for use in the present invention is, for example, a targeting peptide as otherwise described herein, a polypeptide including an antibody or antibody fragment, an aptamer, or a carbohydrate, among other species which bind to a targeted cell.
[0178] The terms treat, treating, and treatment, are used synonymously to refer to any action providing a benefit to a patient at risk for or afflicted with a disease, including improvement in the condition through lessening, inhibition, suppression or elimination of at least one symptom, delay in progression of the disease, prevention, delay in or inhibition of the likelihood of the onset of the disease, etc. In the case of microbial (e.g., viral and/or bacterial) infections, these terms, for example, include, in certain particularly favorable embodiments the eradication or elimination (as provided by limits of diagnostics) of the microbe (e.g., virus and/or bacterium) which is the causative agent of the infection. In one embodiment, the symptom is due to tetanus, anthrax, haemophilus, pertussis, diphtheria, cholera, lyme disease, bacterial meningitis, Streptococcus pneumoniae, or typhoid, or an infection by a fungus, protest, archaea, or virus.
[0179] Treatment, as used herein, encompasses both prophylactic and therapeutic treatment. Pharmaceutical formulations can, for example, be administered prophylactically to a mammal in advance of the occurrence of disease to reduce the likelihood of that disease. Prophylactic administration is effective to reduce or decrease the likelihood of the subsequent occurrence of disease in the mammal, or decrease the severity of disease (inhibition) that subsequently occurs. Alternatively, compounds can, for example, be administered therapeutically to a mammal that is already afflicted by disease. In one embodiment of therapeutic administration, administration of the present compounds is effective to eliminate the disease and produce a remission or substantially eliminate the likelihood of a recurrence. Administration of the protocels and pharmaceutical formulations is effective to decrease the severity of the disease or lengthen the lifespan of the mammal so afflicted, or inhibit or even eliminate the causative agent of the disease. In another embodiment of therapeutic administration, administration of the present compounds is effective to decrease the likelihood of infection or re-infection by a microbe and/or to decrease the symptom(s) or severity of an infection.
[0180] The term pharmaceutically acceptable as used herein means that the compound or composition is suitable for administration to a subject, including a human patient, to achieve the treatments described herein, without unduly deleterious side effects in light of the severity of the disease and necessity of the treatment.
[0181] The term lipid is used to describe the components which are used to form lipid bi- or multilayers on the surface of the nanoparticles which are used in the present invention and may indude a PEGylated lipid. Various embodiments provide nanostructures which are constructed from nanoparticles which support a lipid bilayer(s). In embodiments, the nanostructures, for instance, include, for example, a core-shell structure including a porous particle core surrounded by a shell of lipid bilayer(s). The nanostructure, for instance, a porous silica or alum nanostructure as described above, supports the lipid bilayer membrane structure.
[0182] The term reporter is used to describe an imaging agent or moiety which is incorporated into the phospholipid bilayer or cargo of MSNPs according to an embodiment and provides a signal which can be measured. The moiety may provide a fluorescent signal or may be a radioisotope which allows radiation detection, among others. Exemplary fluorescent labels for use in MSNPs and protocells (for example, via conjugation or adsorption to the lipid bi- or multilayer or silica core, although these labels may also be incorporated into cargo elements such as DNA, RNA, polypeptides and small molecules which are delivered to cells by the protocells) include Hoechst 33342 (350/461), 4,6-diamidino-2-phenylindole (DAPI, 356/451), Alexa Fluor 405 carboxylic acid, succinimidyl ester (401/421), CellTracker Violet BMQC (415/516), CellTracker Green CMFDA (492/517), calcein (495/515), Alexa FluoPr 488 conjugate of annexin V (495/519), Alexa Fluor 488 goat anti-mouse IgG (H+L) (495/519), Click-iT AHA Alexa Fluor 488 Protein Synthesis HCS Assay (495/519), LIVEOEAD Fixable Green Dead Cell Stain Kit (495/519), SYTOX Green nudeic acid stain (504/523), MitoSOX Red mitochondrial superoxide indicator (510/580). Alexa Fluor 532 carboxylic acid, succinimidyl ester(532/554), pHrodo succinimidyl ester (558/576), CellTracker Red CMTPX (577/602), Texas Red 1,2-dihexadecanoyl-sn-glycero-3-phosphoethanolamine (Texas Red DHPE, 583/608). Alexa Fluor 647 hydrazide (649/666), Alexa Fluor 647 carboxylic acid, succinimidyl ester (650/668), Ulysis Alexa Fluor 647 Nucleic Acid Labeling Kit (650/670) and Alexa Fluor 647 conjugate of annexin V (650/665). Moieties which enhance the fluorescent signal or slow the fluorescent fading may also be incorporated and include SlowFade Gold antifade reagent (with and without DAPI) and Image-iT FX signal enhancer. All of these are well known in the art. Additional reporters include polypeptide reporters which may be expressed by plasmids (such as histone-packaged supercoiled DNA plasmids) and include polypeptide reporters such as fluorescent green protein and fluorescent red protein. Reporters pursuant to the present invention are utilized principally in diagnostic applications including diagnosing the existence or progression of a viral infection in a patient and or the progress of therapy in a patient or subject.
[0183] The term histone-packaged supercoiled plasmid DNA is used to describe one embodiment of protocells which utilize in one embodiment plasmid DNA which has been supercoiled (i.e., folded in on itself using a supersaturated salt solution or other ionic solution which causes the plasmid to fold in on itself and supercoil in order to become more dense for efficient packaging into the protocells). The plasmid may be virtually any plasmid which expresses any number of polypeptides or encode RNA, including small hairpin RNA/shRNA or small interfering RNAl/siRNA, as otherwise described herein. Once supercoiled (using the concentrated salt or other anionic solution), the supercoiled plasmid DNA is then complexed with histone proteins to produce a histone-packaged complexed supercoiled plasmid DNA.
[0184] Packaged DNA herein refers to DNA that is loaded into protocells (either adsorbed into the pores or confined directly within the nanoporous silica core itself). To minimize the DNA spatially, it is often packaged, which can be accomplished in several different ways, from adjusting the charge of the surrounding medium to creation of small complexes of the DNA with, for example, lipids, proteins, or other nanoparticles (usually, although not exclusively cationic). Packaged DNA is often achieved via lipoplexes (i.e., complexing DNA with cationic lipid mixtures). In addition, DNA has also been packaged with cationic proteins (including proteins other than histones), as well as gold nanoparticles (e.g., NanoFlares- an engineered DNA and metal complex in which the core of the nanoparticle is gold).
[0185] The term nuclear localization sequence (NLS) refers to a peptide sequence incorporated or otherwise crosslinked into histone proteins which comprise the histone-packaged supercoiled plasmid DNA. In certain embodiments, protocels may further comprise a plasmid (often a histone-packaged supercoiled plasmid DNA) which is modified (crosslinked) with a nuclear localization sequence (note that the histone proteins may be crosslinked with the nuclear localization sequence or the plasmid itself can be modified to express a nuclear localization sequence) which enhances the ability of the histone-packaged plasmid to penetrate the nucleus of a cell and deposit its contents there (to facilitate expression and ultimately cell death. These peptide sequences assist in carrying the histone-packaged plasmid DNA and the associated histones into the nucleus of a targeted cell whereupon the plasmid will express peptides and/or nucleotides as desired to deliver therapeutic and/or diagnostic molecules (polypeptide and/or nucleotide) into the nucleus of the targeted cell. Any number of crosslinking agents, well known in the art, may be used to covalently link a nuclear localization sequence to a histone protein (often at a lysine group or other group which has a nucleophilic or electrophilic group in the side chain of the amino acid exposed pendant to the polypeptide) which can be used to introduce the histone packaged plasmid into the nucleus of a cell. Alternatively, a nucleotide sequence which expresses the nuclear localization sequence can be positioned in a plasmid in proximity to that which expresses histone protein such that the expression of the histone protein conjugated to the nuclear localization sequence will occur thus facilitating transfer of a plasmid into the nucleus of a targeted cell.
[0186] A promoter sequence is a DNA regulatory region capable of binding RNA polymerase in a cell and initiating transcription of a downstream (3 direction) coding sequence. For purposes of defining the present invention, the promoter sequence is bounded at its 3 terminus by the transcription initiation site and extends upstream (5 direction) to include the minimum number of bases or elements necessary to initiate transcription at levels detectable above background. Within the promoter sequence will be found a transcription initiation, as well as protein binding domains (consensus sequences) responsible for the binding of RNA polymerase. Eukaryotic promoters will often, but not always, contain TATA boxes and CAT boxes. Prokaryotic promoters contain Shine-Dalgamo sequences in addition to the 10 and 35 consensus sequences.
[0187] An expression control sequence is a DNA sequence that controls and regulates the transcription and translation of another DNA sequence. A coding sequence is under the control of transcriptional and translational control sequences in a cell when RNA polymerase transcribes the coding sequence into mRNA, which is then translated into the protein encoded by the coding sequence. Transcriptional and translational control sequences are DNA regulatory sequences, such as promoters, enhancers, polyadenylation signals, terminators, and the like, that provide for the expression of a coding sequence in a host cell.
[0188] A signal sequence can be included before the coding sequence. This sequence encodes a signal peptide. N-terminal to the polypeptide, that communicates to the host cell to direct the polypeptide to the cell surface or secrete the polypeptide into the media, and this signal peptide is dipped off by the host cell before the protein leaves the cell. Signal sequences can be found associated with a variety of proteins native to prokaryotes and eukaryotes.
[0189] A nucleic acid molecule is operatively linked to, or operably associated with, an expression control sequence when the expression control sequence controls and regulates the transcription and translation of nucleic acid sequence. The term operatively linked includes having an appropriate start signal (e.g., ATG) in front of the nucleic acid sequence to be expressed and maintaining the correct reading frame to permit expression of the nucleic acid sequence under the control of the expression control sequence and production of the desired product encoded by the nucleic acid sequence. If a gene that one desires to insert into a recombinant DNA molecule does not contain an appropriate start signal, such a start signal can be inserted in front of the gene.
[0190] A peptide nucleic acid (PNA) is a synthetic nucleic acid mimic in which the sugar-phosphate backbone is replaced by a peptide backbone. PNAs hybridize to complementary DNA and RNA with higher affinity and superior sequence selectivity compared to DNA. PNAs are resistant to nucleases and proteases and have a low affinity for proteins. These properties make PNAs an attractive agent for biological and medical applications. To improve the antisense and antigene properties of PNAs, many backbone modifications of PNAs have been explored under the concept of preorganization. Sugiyama, et al., Chiral peptide nucleic acids with a substituent in the N-(2-aminoethy)glycne backbone, Molecules, 2012 Dec. 27:18(1):287-310. doi: 10.3390/moleculesl 8010287.
[0191] A control as used herein may be a positive or negative control as known in the art and can refer to a control cell, tissue, sample, or subject. The control may, for example, be examined at precisely or nearly the same time the test cell, tissue, sample, or subject is examined. The control may also, for example, be examined at a time distant from the time at which the test cell, tissue, sample, or subject is examined, and the results of the examination of the control may be recorded so that the recorded results may be compared with results obtained by examination of a test cell, tissue, sample, or subject. For instance, as can be appreciated by a skilled artisan, a control may comprise data from one or more control subjects that is stored in a reference database. The control may be a subject who is similar to the test subject (for instance, may be of the same gender, same race, same general age and/or same general health) but who is known to not have a fibrotic disease. As can be appreciated by a skilled artisan, the methods can also be modified to compare a test subject to a control subject who is similar to the test subject (for instance, may be of the same gender, same race, same general age and/or same general health) but who is known to express symptoms of a disease. In this embodiment, a diagnosis of a disease or staging of a disease can be made by determining whether protein or gene expression levels as described herein are statistically similar between the test and control subjects.
[0192] As used herein, the term polypeptide refers broadly to a polymer of two or more amino acids joined together by peptide bonds. The term polypeptide also includes molecules which contain more than one polypeptide joined by a disulfide bond, or complexes of polypeptides that are joined together, covalently or noncovalently, as multimers (e g., dimers, tetramers). Thus, the terms peptide, oligopeptide, and protein are all included within the definition of polypeptide and these terms are used interchangeably. It should be understood that these terms do not connote a specific length of a polymer of amino acids, nor are they intended to imply or distinguish whether the polypeptide is produced using recombinant techniques, chemical or enzymatic synthesis, or is naturally occurring.
[0193] A ligand can be any natural or synthetic moiety, including but not limited to a small molecule, an antibody, a nucleic acid, an amino acid, a protein (e.g., an enzyme) or a hormone that binds to a cell, for example, at a receptor (binding site) located on he surface of the cell. The term ligand therefore includes any targeting active species (compound or moiety, e.g., antigen) which binds to a moiety (for example, a receptor) on, in or associated with a cell. In some embodiments, a ligand is a peptide, a polypeptide including an antibody or antibody fragment, an aptamer, or a carbohydrate, among other species which bind to a targeted cell.
[0194] Binding site as used herein is not limited to receptor protein surface areas that interact directly with ligands, but also indudes any atomic sequence, whether or not on the surface of a receptor, that is implicated (by affecting conformation or otherwise) in ligand binding. A purely illustrative list of binding sites include those targeted by detector antibodies which are specific to a viral infection cell receptors, as illustrated by the antibodies described in the Examples herein and as otherwise identifiable by techniques which are well-known to those of ordinary skill in the art.
[0195] The phrase effective average particle size as used herein to describe a multiparticulate (e.g., a porous nanoparticulate) means that at least 50% of the particles therein are of a specified size. Accordingly, effective average particle size of less than about 2,000 nm in diameter means that at least 50% of the particles therein are less than about 2,000 nm in diameter. In certain embodiments, nanoparticulates have an effective average particle size of less than about 2,000 nm (i.e., 2 microns), less than about 1,900 nm, less than about 1,800 nm, less than about 1,700 nm, less than about 1,600 nm, less than about 1,500 nm, less than about 1,400 nm, less than about 1,300 nm, less than about 1,200 nm, less than about 1,100 nm, less than about 1,000 nm, less than about 900 nm, less than about 800 nm, less than about 700 nm, less than about 600 nm, less than about 500 nm, less than about 400 nm, less than about 300 nm, less than about 250 nm, less than about 200 nm, less than about 150 nm, less than about 100 nm, less than about 75 nm, less than about 50 nm, less than 30 nm, less than 25 nm, less than 20 nm, less than 15 nm, less than 10 nm, as measured by light-scattering methods, microscopy, or other appropriate methods. D.sub.50 refers to the particle size below which 50% of the particles in a multiparticulate fall. Similarly, D.sub.90 is the particle size below which 90% of the particles in a multiparticulate fall.
[0196] The term neoplasia refers to the uncontrolled and progressive multiplication of tumor cells, under conditions that would not elicit, or would cause cessation of, multiplication of normal cells. Neoplasia results in a neoplasm, which is defined herein to mean any new and abnormal growth, particularly a new growth of tissue, in which the growth of cells is uncontrolled and progressive. Thus, neoplasia includes cancer, which herein refers to a proliferation of tumor cells having the unique trait of loss of normal controls, resulting in unregulated growth, lack of differentiation, local tissue invasion, and/or metastasis.
[0197] As used herein, neoplasms include, without limitation, morphological irregularities in cells in tissue of a subject or host, as well as pathologic proliferation of cells in tissue of a subject, as compared with normal proliferation in the same type of tissue. Additionally, neoplasms include benign tumors and malignant tumors (e.g., colon tumors) that are either invasive or noninvasive. Malignant neoplasms are distinguished from benign neoplasms in that the former show a greater degree of anaplasia, or loss of differentiation and orientation of cells, and have the properties of invasion and metastasis. Examples of neoplasms or neoplasias from which the target cell may be derived include, without limitation, carcinomas (e.g., squamous-cel carcinomas, adenocarcinomas, hepatocellular carcinomas, and renal cell carcinomas), particularly those of the bladder, bowel, breast, cervix, colon, esophagus, head, kidney, liver, lung, neck, ovary, pancreas, prostate, and stomach; leukemias; benign and malignant lymphomas, particularly Burkitt's lymphoma and Non-Hodgkin's lymphoma; benign and malignant melanomas; myeloproliferative diseases; sarcomas, particularly Ewing's sarcoma, hemangiosarcoma, Kaposi's sarcoma, liposarcoma, myosarcomas, peripheral neuroepithelioma, and synovial sarcoma; tumors of the central nervous system (e.g., gliomas, astrocytomas, oligodendrogliomas, ependymomas, glioblastomas, neuroblastomas, ganglioneuromas, gangliogliomas, medulloblastomas, pineal cell tumors, meningiomas, meningeal sarcomas, neurofibromas, and Schwannomas); germ-line tumors (e.g., bowel cancer, breast cancer, prostate cancer, cervical cancer, uterine cancer, lung cancer, ovarian cancer, testicular cancer, thyroid cancer, astrocytoma, esophageal cancer, pancreatic cancer, stomach cancer, liver cancer, colon cancer, and melanoma); mixed types of neoplasias, particularly carcinosarcoma and Hodgkin's disease; and tumors of mixed origin, such as Wilms' tumor and teratocarcinomas (Beers and Berkow (eds.), The Merck Manual of Diagnosis and Therapy, 17.sup.th ed. (Whitehouse Station, N.J.: Merck Research Laboratories, 1999) 973-74, 976, 986, 988, 991.
[0198] The need further exists for clinically effective, widely-applicable nanoparticle-based formulations that will target selected cells or pathogens in vivo and that will administer requisite active ingredient dosages, e.g., combinations of active ingredients over a wide range of therapeutic time periods.
[0199] Porous silica particles of varying sizes ranging in size (diameter) from less than 5 nm to 200 nm or 500 nm or more are readily available in the art or can be readily prepared using methods known in the art or alternatively, can be purchased from Melorium Technologies, Rochester, N.Y. Sky Spring Nanomaterials, Inc., Houston, Tex., USA or from Discovery Scientific, Inc., Vancouver, British Columbia. Multimodal silica nanoparticles may be readily prepared using the procedure of Carroll, et al., Langmuir, 25, 13540-13544 (2009).
[0200] The examples herein provide various methodologies for obtaining protocells which are useful in the present invention. Useful general techniques include those described in Liu et al., (2009), Liu et al, (2009), Liu et al., (2009); Lu et al., (1999), Ashley et al., (2011), Lu et al., (1999), and Caroll et al, (2009).
[0201] Nanostructures include a core-shell structure which comprises a porous particle core surrounded by a shell of lipid for example a bilayer, but possibly a monolayer or mutilayer (see Liu, et al., J. Amer. Chem. Soc., 131, 7567-7569 (2009)). The porous particle core can include, for example, a porous nanoparticle made of an inorganic and/or organic material as set forth above surrounded by a lipid bilayer.
[0202] The porous particle core of the protocells can be loaded with various desired species (cargo), including small molecules (e.g., antiviral agents as otherwise described herein), large molecules (e.g., including macromolecules such as asRNA, siRNA or shRNA or a polypeptide which may include an antiviral polypeptide or a reporter polypeptide (e.g., fluorescent green protein, among others), semiconductor quantum dots, or metallic nanoparticles, or metal oxide nanoparticles or combinations thereof). Representative cargo may include, for example, a small molecule bioactive agent, a nucleic acid (e.g., RNA or DNA), a polypeptide, including a protein, or a carbohydrate. Particular examples of such cargo include RNA, such PNA's, PNA's comprising asRNA, mRNA, siRNA, shRNA, micro RNA, a polypeptide or protein and/or DNA (including double stranded or linear DNA, complementary DNA (cDNA), minicircle DNA, naked DNA and plasmid DNA (including CRISPR plasmids) which optionally may be supercoiled and/or packaged (e.g., with histones) and which may be optionally modified with a nuclear localization sequence). Cargo may also include a reporter as described herein. For example, protocells can also be loaded with super-coiled plasmid DNA, which can be used to deliver a therapeutic and/or diagnostic peptide(s) or a small hairpin RNA/shRNA or small interfering RNA/siRNA, which can be used to inhibit expression of proteins associated with antibiotic resistance.
[0203] In some embodiments, protocells are comprised of a spherical mesoporous silica nanoparticle (MSNP) core encased within a supported lipid bilayer (SLB). MSNPs have an extremely high surface area (>1200 m.sup.2/g), which enables high concentrations of various therapeutic and diagnostic agents to be adsorbed within the core by simple immersion in a solution of the cargo(s) of interest. Furthermore, since the aerosol-assisted evaporation-induced self-assembly (EISA) process we pioneered to synthesize MSNPs is compatible with a wide range of structure-directing surfactants and amenable to post-synthesis processing, the overall size can be varied from 20-nm to >10-m, the pore size can be varied from 2.5-nm to 50-nm, and the naturally negatively-charged pore walls can be modified with a variety of functional moieties, enabling facile encapsulation of physicochemically disparate molecules, including acidic, basic, and hydrophobic drugs, proteins, small interfering RNA, minicircle DNA vectors, plasmids, and diagnostic agents like quantum dots and iron oxide nanoparticles.
[0204] Protocells are provided that have a loading capacity of up to 60 wt % for small molecule drugs, which is 10-fold higher than other MSNP-based delivery vehicles and 1000-fold higher than similarly-sized liposomes. Release rates can be tailored by controlling the core's degree of silica condensation and, therefore, its dissolution rate under physiological conditions; thermal calcination maximizes condensation and results in particles with sustained release profiles (7-10% release per day for up to 2 weeks), while use of acidified ethanol to extract surfactants enhances particle solubility and results in burst release of encapsulated drugs (100% release within 12 hours). Liposome fusion to cargo-loaded MSNPs results in the formation of a coherent SLB that provides a stable, fluid, biocompatible interface for display of functional molecules, such as polyethylene glycol (PEG) and targeting ligands.
[0205] Protocells stably encapsulate small molecule drugs for up to 4 weeks when dispersed in complex biological fluids (e.g., complete growth medium and blood), regardless of whether the SLB is composed of lipids that are fluid or non-fluid at body temperature: in contrast, liposomes rapidly leak their encapsulated drugs, even when their bilayers are composed of fully saturated lipids, which have a high packing density and should, therefore, limit diffusion of drugs across the bilayer. The fluid, yet stable SLB enables us to achieve exquisitely high targeting specificities at low ligand densities, which, in turn, reduces immunogenicity and non-specific interactions; we have shown that protocells modified with an average of just 6 targeting peptides per particle have a 10,000-fold higher affinity for target cells than for non-target cells when the SLB is composed of the fluid, zwittenonic lipid, 1, 2-dioleoyl-sn-glycero-3-phosphocholine (DOPC).
[0206] Protocells are highly biocompatible and can be engineered for both broad distribution and persistence within target tissues. Balb/c mice injected intravenously (i.v.) with 200 mg/kg doses of PEGylated protocells three times each week for three weeks show no signs of gross or histopathological toxicity. Given their high loading capacity, this result indicates that protocells can deliver at least 900 mg/kg of therapeutic molecules with either burst or sustained release kinetics. Furthermore, PEGylated protocells 20-200 nm in diameter remain broadly distributed for 2-7 days when injected i.v., which provides a sufficient period of time for targeted protocells to accumulate within target tissues, where they can persist for up to 4 weeks with no adverse effects. Additionally, we and others have demonstrated that MSNPs are biodegradable and ultimately excreted in the urine and feces as silicic acid. Finally, protocells modified with up to 10 wt % of targeting ligands induce neither IgG nor IgM responses when injected in C57Bl/6 mice at a total dose of 400 mg/kg. Depending upon the biodistribution required for a specific application, the MSNP size and shape (spherical, disk-shaped, and rod-shaped and the SLB charge and surface modification(s), may be designed making the protocell a highly modular, flexible nanoparticle delivery system.
[0207] Conventionally, a mesoporous nanoparticle has pores whose diameters range in size from about 2 nm to about 50 nm, a microporous nanoparticle has pores whose diameters are less than about 2 nm (often about 0.001 to about 2 nm) and a macroporous nanoparticle has pores whose diameters are from about 50 nm to about 100 nm. MSNPs can have both mesoporous, microporous and macroporous pores, but often have pores whose diameters range in size from about 2 nm to about
[0208] A nanoparticle may have a variety of shapes and cross-sectional geometries that may depend, in part, upon the process used to produce the particles. In one embodiment, a nanoparticle may have a shape that is a torus (toroidal). A nanoparticle may include particles having two or more of the aforementioned shapes. In one embodiment, a cross-sectional geometry of the particle may be one or more of toroidal, circular, ellipsoidal, triangular, rectangular, or polygonal. In one embodiment, a nanoparticle may consist essentially of non-spherical particles. For example, such particles may have the form of ellipsoids, which may have all three principal axes of differing lengths, or may be oblate or prelate ellipsoids of revolution. Non-spherical nanoparticles alternatively may be laminar in form, wherein laminar refers to particles in which the maximum dimension along one axis is substantially less than the maximum dimension along each of the other two axes. Non-spherical nanoparticles may also have the shape of frusta of pyramids or cones, or of elongated rods. In one embodiment, the nanoparticles may be irregular in shape. In one embodiment, a plurality of nanoparticles may consist essentially of spherical nanoparticles.
[0209] Effective average particle size includes a multiparticulate (e.g., a porous nanoparticulate) where at least 50% of the particles therein are of a specified size. Accordingly, effective average particle size of less than about 2,000 nm in diameter means that at least 50% of the particles therein are less than about 2,000 nm in diameter. In certain embodiments, nanoparticulates have an effective average particle size of less than about 2,000 nm (i.e., 2 microns), less than about 1,900 nm, less than about 1,800 nm, less than about 1,700 nm, less than about 1,600 nm, less than about 1,500 nm, less than about 1,400 nm, less than about 1,300 nm, less than about 1,200 nm, less than about 1.100 nm, less than about 1,000 nm, less than about 900 nm, less than about 800 nm, less than about 700 nm, less than about 600 nm, less than about 500 nm, less than about 400 nm, less than about 300 nm, less than about 250 nm, less than about 200 nm, less than about 150 nm, less than about 100 nm, less than about 75 nm, less than about 50 nm, less than 30 nm, less than 25 nm, less than 20 nm, less than 15 nm, less than 10 nm, as measured by light-scattering methods, microscopy, or other appropriate methods. D.sub.50 refers to the particle size below which 50% of the particles in a multiparticulate fall. Similarly, D.sub.90 is the particle size below which 90% of the particles in a multiparticulate fall.
[0210] The MSNP size distribution, depends on the application, but is principally monodisperse (e.g., a uniform sized population varying no more than about 5-20% in diameter, as otherwise described herein). The term monodisperse is used as a standard definition established by the National Institute of Standards and Technology (NIST) (Particle Size Characterization, Special Publication 960-1, January 2001) to describe a distribution of particle size within a population of particles, in this case nanoparticles, which particle distribution may be considered monodisperse if at least 90% of the distribution lies within 5% of the median size. See Takeuchi, et al., Advanced Materials, 2005, 17, No. 8, 1067-1072.
[0211] In certain embodiments, mesoporous silica nanoparticles can be range, e.g., from around 5 nm to around 500 nm (for example, about 50 nm to about 500 nm) in size, including all integers and ranges there between. The size is measured as the longest axis of the particle. In various embodiments, the particles are from around 10 nm to around 500 nm and from around 10 nm to around 100 nm in size. The mesoporous silica nanoparticles have a porous structure. The pores can be from around 1 to around 20 nm in diameter, including all integers and ranges there between. In one embodiment, the pores are from around 1 to around 10 nm in diameter. In one embodiment, around 90% of the pores are from around 1 to around 20 nm in diameter. In another embodiment, around 95% of the pores are around 1 to around 20 nm in diameter.
[0212] In one embodiment, MSNPs are monodisperse and range in size from about 25 nm to about 300 nm; exhibit stability (colloidal stability); have single cell binding specification to the substantial exclusion of non-targeted cells; are neutral or cationic for specific targeting (for example, cationic); are optionally modified with agents such as PEI, NMe3+, dye, crosslinker, ligands (ligands provide neutral charge); and optionally, are used in combination with a cargo to be delivered to a targeted cell.
[0213] In certain embodiments, the MSNPs are monodisperse and range in size from about 25 nm to about 300 nm. The sizes used, for example, include 50 nm (+/10 nm) and 150 nm (+1-15 nm), within a narrow monodisperse range, but may be more narrow in range. A broad range of particles is not used because such a population is difficult to control and to target specifically.
[0214] Illustrative examples of a cationic surfactant include, but are not limited to, cetyl trimethylammonium bromide (CTAB), dodecylethydimethylammonium bromide, cetylpyridinium chloride (CPC), polyethoxylated tallow amine (POEA), hexadecyltrimethylammonium p-toluenesulfonate, benzalkonium chloride (BAC), or benzethonium chloride (BZT).
[0215] Poloxamers such as F127 are difunctional block copolymer surfactants terminating in primary hydroxyl groups. They are composed of a central hydrophobic chain of polyoxypropylene (poly(propylene oxide)) flanked by two hydrophilic chains of polyoxyethylene (poly(ethylene oxide)). Because the lengths of the polymer blocks can be customized, many different poloxamers exist having slightly different properties. For the generic term poloxamer, these copolymers are commonly named with the letter P (for poloxamer) followed by three digits, the first two digits.times.100 give the approximate molecular mass of the polyoxypropylene core, and the last digit.times.10 gives the percentage polyoxyethylene content (e.g., P407=Poloxamer with a polyoxypropylene molecular mass of 4,000 g/mol and a 70% polyoxyethylene content). For the Pluronic tradename, coding of these copolymers starts with a letter to define it's physical form at room temperature (L=liquid, P=paste, F=flake (solid)) followed by two or three digits, the first digit(s) refer to the molecular mass of the polyoxypropylene core (determined from BASF's PluronicdD grid) and the last digit.times.10 gives the percentage polyoxyethylene content (e.g., F127 is a Pluronic with a polyoxypropylene molecular mass of 4,000 g/mol and a 70% polyoxyethylene content). In the example given, poloxamer 407 (P407) is Pluronic F127.
[0216] Targeting ligands which may be used to target cells include but are not limited to peptides, affibodies and antibodies (including monoclonal and/or polyclonal antibodies). In certain embodiments, targeting ligands selected from the group consisting of Fc from human IgG (which binds to Fc receptors on macrophages and dendritic cells), human complement C3 (which binds to CR1 on macrophages and dendritic cells), ephrin B2 (which binds to EphB4 receptors on alveolar type II epithelial cells), and the SP94 peptide (which binds to unknown receptor(s) on hepatocyte-derived cells).
[0217] In some embodiments, targeting moieties induce protocell binding to virally-infected host cells. In some embodiments, the targeting moiety targets a virally-infected host cell. In some embodiments, the targeting moiety specifically targets a host cell surface molecule specifically present during a viral infection.
[0218] In some embodiments, the protocells described herein further comprise an endosomolytic moiety. After binding to a virally-infected host cell, the protocells described herein are internalized by the host cell. The endosomolytic moiety promotes escape of the antiviral cargo into the host cell, where it can promote death of the intracellular bacteria. In some embodiments, the endosomolytic moiety ruptures a virally-infected cell membrane ruptures acidic intracellular vesicles of the virally-infected host cell. In some embodiments, the endosomolytic moiety is a peptide. In some embodiments, the endosomolytic moiety is octaarginine (R8), H5WYG, Penetratin-HA2, modified HA2-TAT, 43E or Histidine 10.
[0219] The charge is controlled based on what is to be accomplished (via PEI, NMe3+, dye, crosslinker, ligands, etc.), but for targeting the charge is, for example, cationic. Charge also changes throughout the process of formation. Initially the targeted particles are cationic and are often delivered as cationically charged nanoparticles, however post modification with ligands they are closer to neutral. The ligands which find use in the present invention include peptides, affibodies and antibodies, among others. These ligands are site specific and are useful for targeting specific cells which express peptides to which the ligand may bind selectively to targeted cells.
[0220] MSNPs may be used to deliver cargo to a targeted cell, including, for example, cargo component selected from the group consisting of at least one polynucleotide, such as double stranded linear DNA, minicircle DNA, naked DNA or plasmid DNA, messenger RNA, small interfering RNA, small hairpin RNA, microRNA, a polypeptide, a protein, a drug (in particular, an antibiotic drug), an imaging agent, or a mixture thereof. The MSNPs present are effective for accommodating cargo which are long and thin (e.g., naked) in three-dimensional structure, such as polynucleotides (e.g., various DNA and RNA) and polypeptides.
[0221] In protocells, a PEGylated lipid bi- or multilayer encapsulates a population of MSNPs as described herein and comprises (1) a PEGylated lipid which is optionally-thiolated (2) at least one additional lipid and, optionally (3) at least one targeting ligand which is conjugated to the outer surface of the lipid bi- or multilayer and which is specific against one or more receptors of virally-infected cells.
[0222] Protocells are highly flexible and modular. High concentrations of physiochemically-disparate molecules can be loaded into the protocells and their therapeutic and/or diagnostic agent release rates can be altered without altering the protocell's size, size distribution, stability, or synthesis strategy. Properties of the supported lipid bi- or multilayer and mesoporous silica nanoparticle core can also be modulated independently, thereby altering properties as surface charge, colloidal stability, and targeting specificity independently from overall size, type of cargo(s), loading capacity, and release rate.
[0223] Exemplary Anti-Microbial Protocels
[0224] In the anti-viral uses, silencing of a target gene will result in a reduction in viral titer in the cell or in the subject. As used herein, reduction in viral titer refers to a decrease in the number of viable virus produced by a cell or found in an organism undergoing the silencing of a viral target gene. Reduction in the cellular amount of virus produced may lead to a decrease in the amount of measurable virus produced in the tissues of a subject undergoing treatment and a reduction in the severity of the symptoms of the viral infection.
[0225] Nipah virus (NiV), a highly pathogenic member of the Paramyxoviridae family, was first isolated and identified after a 1998-1999 outbreak of fatal encephalitis among pig farmers and abattoir workers in Southeast Asia. NiV and its dose relative, Hendra virus, have been classified as Biosafety Level 4 (BSL-4) select agents due to their broad host range, their numerous routes of transmission, and the high rates of mortality associated with infection. Despite recent advances in understanding the cellular tropism of NiV, there is currently no prophylaxis available for animals or humans, and treatment remains primarily supportive.
[0226] The Hendra (Hev) and Nipah Viruses (NiV) are recently emerged zoonotic pathogens of the family Paramyxoviridae. Found naturally in bats, they have a wide host range and can infect humans as well as a number of other animal species. Hendra was discovered in Australia in 1994 when it killed 13 horses and their human trainer near Brisbane, Australia. The closely related virus called Nipah appeared in 1999 as an infection of pigs in Malaysia. It resulted in the culling of about a million pigs, but is known also to have caused 257 human infections, 105 of them resulting in death. The henipaviruses are considered important emerging natural pathogens and potential bioweapons. Both viruses are characterized by a pleomorphic, enveloped virion ranging in size from 40 to 600 nm, and containing a single-stranded negative sense RNA genome about 18.2 kb in length. The lipid envelope is decorated with an attachment protein (called G-protein) and a fusion protein (the F-protein). The literature reports the isolation of a number of monoclonal antibodies capable of neutralizing NiV through binding of the G-protein.
[0227] NiV glycoprotein (G) binds to ephrin B2 and ephrin B3, while NiV fusion protein (F) induces macropinocytosis. Other NiV proteins include RNA polymerase (L), matrix protein (M), nucleocapsid protein (N) and phosphoprotein (P).
[0228] Non-limiting examples of NiV M siRNA and NiV N siRNA sequences include the following sequences (all sequences presented 5 to 3):
[0229] Niv-N siRNA Sequences:
TABLE-US-00001 (SEQIDNO:8) CUGCUCUGCCUUUAGCAGAUCCUCCUU-Antisense (SEQIDNO:9) GGAGGAUCUGCUAAAGGCAGAGCAG-Sense (SEQIDNO:10) GCUGGUACAAAUAUCCUUAUCUUGGUU-Antisense (SEQIDNO:11) CCAAGAUAAGGAUAUUUGUACCAGC-Sense (SEQIDNO:12) GAAUCCUGCCAUACCAGUUUCCUCGAC-Antisense (SEQIDNO:13) CGAGGAAACUGGUAUGGCAGGAUTC-Sense (SEQIDNO:14) CUUGAGUUCUGUUGCUGAUUGCUGGAU-Antisense (SEQIDNO:15) CCAGCAAUCAGCAACAGAACUCAAG-Sense
[0230] Niv-M siRNA Sequences:
TABLE-US-00002 (SEQIDNO:16) AAAUAUUCUCAGAGCUUGAUGCUUGUC-Antisense (SEQIDNO:17) CAAGCAUCAAGCUCUGAGAAUAUTT-Sense (SEQIDNO:18) CCAGAAUCAUUGAGCUUUGUGAUACUG-Antisense (SEQIDNO:19) GUAUCACAAAGCUCAAUGAUUCUGG-Sense (SEQIDNO:20) AUCUUCUUGCGUUUCCCUGUCUCUGGG-Antisense (SEQIDNO:21) CAGAGACAGGGAAACGCAAGAAGAT-Sense (SEQIDNO:22) ACCACUAGUCAGUACUUUCUUCCACGG-Antisense (SEQIDNO:23) GUGGAAGAAAGUACUGACUAGUGGT-Sense
[0231] Non-limiting examples of targeting moieties that target ephrin B2 and/or ephrin B3 include the ephrin B2-targeting peptide sequences identified in
[0232] Exemplary Antiviral Protocell Compositions
[0233] Ribavirin is a nucleoside-based, anti-metabolite prodrug that exerts a mutagenic effect on RNA viruses by facilitating G-to-A and C-to-U nucleotide transitions (Dietz et al., 2013). It has broad in vitro activity against RNA viruses and is a component of the FDA-approved treatment for chronic hepatitis C infection. Ribavirin has also been shown to have IC.sub.50 values in the low micromolar range for several alphaviruses (Huggins et al., 1984; Sindac et al., 2012). We use protocells to improve its circulation half-life (currently <48 hours for a single dose) and to concentrate it in the CNS.
[0234] Nucleic acids, including siRNAs and artificial microRNAs, that target highly conserved regions of divergent VEEV strains have demonstrated in vitro efficacy (Steele et al., 2010; Diamond, 2009). Furthermore, since complete genome sequences are readily available for multiple alphaviruses, novel nucleic acid-based antivirals that target viral genes can be designed using web-based tools. Published siRNA sequences that target conserved regions of VEEV RNA-dependent RNA polymerase (RdRp), as well as nsp1 and E1 glycoprotein genes, can be used in our protocells (Bhomia et al., 2013; O'Brien, 2007). Since siRNAs for EEEV have not been reported, computational sequence analysis and siRNA design software can be used to generate novel siRNAs that target similar conserved sequences as described for VEEV.
[0235] In some embodiments, protocells have enhanced blood-brain barrier (BBB) penetration, which enables them to deliver antivirals to the cytosol of target cells in the central nervous system (CNS).
[0236] Broadly cross-reactive neutralizing monoclonal antibodies and antibody fragments have been reported to protect mouse models of VEEV infection upon post-exposure treatment (Goodchild et al., 2011; O'Brien et al., 2012). The therapeutic window for post-exposure antibody treatment is narrow, however. Therefore, protocells can be used to deliver therapeutic antibody fragments (F(ab).sub.2 or scFvs) to the CNS in order to prevent neuronal virus spread and increase the therapeutic window; these antibody fragments have been shown to neutralize several VEEV subtypes (IA/B, IE) and EEEV (O'Brien et al., 2012; Rulker et al., 2012).
[0237] VEEV Strains.
[0238] The VEEV vaccine strain TC-83 can used in identifying useful antivirals; TC-83 is a live attenuated, licensed veterinary vaccine and is used to immunize horses in regions endemic for IAB and IC strains, as well as laboratory workers and military personnel. TC-83 was generated by 83 serial passages of the Trinidad donkey (TrD) IAB strain in guinea pig heart cells (Berge et al., 1961). Use the fully-virulent 3908 and TrD strains. TrD (subtype IA/B) was isolated in 1943 and can cause severe, often fatal infections in horses and humans (Weaver et al., 1999). 3908 is an epidemic subtype IC strain and was isolated in 1995 from a febrile human during a major epidemic in Venezuela (Weaver et al., 1996).
[0239] EEEV Strain.
[0240] The North American EEEV strain FL93-939 can be used in identifying useful antivirals. This strain was isolated from a pool of Culiseta melanura mosquitoes collected in Florida during 1993 and was passaged once in Vero cells. Virus stocks were prepared from BHK-21 cell cultures (White et al., 2011).
[0241] Disease Progression of Alphaviral Encephalitis in Mouse Models.
[0242] New World alphaviruses are naturally transmitted to vertebrate hosts through the bite of infected mosquitoes. In humans, cardinal features of the more severe consequences of VEE include a biphasic febrile illness with CNS manifestations and damage to lymphoid tissues (Steele et al., 2010). Mouse models of VEEV infection mimic both encephalitis and lymphotropism of human disease. Natural mosquito-transmitted infection is modeled by subcutaneous inoculation of mice with virulent strains of VEEV. Using this route of infection, virus first moves to the draining lymph nodes via dermal dendrilic cells and begins to replicate by about 4 hours post-infection (PI). Viremia begins about 12 hours PI and causes systemic infection with a strong tropism for lymphoid tissue, including the spleen. GALT, thymus, and bone marrow. VEEV then enters the CNS through the olfactory bulbs and begins to replicate in the brain by 36-48 hours PI.
[0243] More pertinent to biodefense is the aerosol route of inoculation, where VEEV moves directly through olfactory neurons to the CNS without causing viremia. Once in the CNS, neurons are the primary target of viral infection in the brain and spinal cord, resulting in the majority of clinical symptoms of VEE in mice and the near-uniform lethality, which occurs between 6-9 days PI for virulent strains of VEEV. Similar to VEE in mice and mimicking aspects of EEE in humans, young mice infected with EEEV develop a biphasic disease course that manifests as initial virus replication in peripheral tissues followed by viremia, CNS invasion, and encephalitis. Mice typically die 4-6 days after peripheral inoculation with EEEV.
[0244] Disease Progression of Alphaviral Encephalitis in Hamster Models.
[0245] Intraperitoneal inoculation of VEEV produces different symptoms in hamsters than in mice (Jackson et al., 1991). In the hamster model, VEEV causes acute, fulminant disease typified by massive necrosis of lymphoid tissues (especially the GALT), and animals often die before the onset of CNS disease. Since VEEV does not cause encephalitis in hamsters via peripheral routes of infection, we will challenge hamsters with aerosolized VEEV. Although the pathology of aerosol VEEV infection in hamsters has not been well described in the literature, aerosol inoculation of virulent VEEV and EEEV strains cause neurological disease in mice and NHPs; we, therefore, anticipate a similar progression of neurological disease in the hamster model (Steele et al., 2010). Similar to mice, hamsters inoculated peripherally with EEEV develop an early visceral phase, which is accompanied by viremia and followed by neuroinvasion and death due to encephalitis about 4-6 days PI (Paessler et al., 2004). EEEV enters the brain about 2 days PI and replicates progressively thereafter, reaching titers that grossly exceed those in other tissues. The appearance of virus in multiple regions of the brain at the same time suggests entry from the vasculature. Histopathological features of EEE in the brains of hamsters include neuronal tropism and necrosis, and inflammatory cell infiltration.
[0246] Disease Progression of Alphaviral Encephalitis in NHP Models.
[0247] Most VEE studies involving NHPs have used Cynomolgus macaques (Cynos) (Steele et al., 2010). Key features of VEE in Cynos include the development of fever, viremia, and lymphopenia within 1-3 days of infection and signs of encephalitis 3-6 days after infection; most animals recover from VEE, however (Reed et al., 2005; Reed et al., 2004). In contrast, Cynos challenged with aerosolized EEEV develop fever, elevated white blood cell counts and liver enzymes, and major CNS changes, including severe meningoencephalomyelitis, widespread neuronal necrosis, and the presence of perivascular cuffs, cellular debris, gliosis, satelitosis, edema, and hemorrhage, causing the majority of animals to succumb 5-9 days after infection (Reed et al., 2007). Taken together, these studies suggest that NHP models develop key features of EEE in humans, such as neuronal tropism and necrosis, meningoencephalitis, and vascular damage.
[0248] In exemplary embodiments, pharmaceutical formulations and protocells can also be used in the treatment of an infection caused by dengue virus: yellow fever virus; West Nile virus; Japanese encephalitis virus; HIV; HTLV-I, Bunyaviridae viruses including the hantaviruses, Crimean-Congo hemorrhagic fever, Rift Valley fever virus, and fever and severe fever and thrombocytopenia virus; arenaviruses including al agents of South American hemorrhagic fever, Lassa virus and lymphocytic choriomeningitis virus; filoviruses including Ebola and Marburg viruses; paramyxoviruses including morbilliviruses, henipaviruses, respiroviruses including RSV and metapneumovirus and rubellaviruses: Alphaviruses including Chikungunya, O'nyung-nyung, Semliki Forest, Ross River, Sindbis, eastern, western and Venezuelan equine encephalitis; picornaviruses; papillomaviruses including HPV; herpesviruses including HSV-1/2, EBV, CMV, HHV-6, 7, and 8; polyomaviruses including SV40, JC and BK viruses; poxviruses including variola and vaccinia viruses.
[0249] In certain embodiments, the anti-viral pharmaceutical formulations and protocels can be used in the treatment of subject who is infected by a Hendra virus, a Nipah virus (NiV), a Group A arbovirus (Alphavirus of the Togavirus family) including Eastern equine encephalitis (EEEV) or a Venezuelan equine encephalitis (VEEV) and who has not responded successfully to treatment with ribavirin.
[0250] In addition to, or as an alternative to, the therapeutic nucleic acid cargo described herein, pharmaceutical formulations and protocells can also contain one or more antiviral agents including, but not limited to anti-HIV agents including, for example, nucleoside reverse transcriptase inhibitors (NRTI), non-nucleoside reverse transcriptase inhibitors (NNRTI), protease inhibitors, fusion inhibitors, among others, exemplary compounds of which may include, for example, 3TC (Lamivudine), AZT (Zidovudine), ()-FTC, ddl (Didanosine), ddC (zalcitabine), abacavir (ABC), tenofovir (PMPA), D-D4FC (Reverset), D4T (Stavudine), Racivir, L-FddC, L-FD4C, NVP (Nevirapine), DLV (Delavirdine), EFV (Efavirenz), SQVM (Saquinavir mesylate), RTV (Ritonavir), IDV (Indinavir), SQV (Saquinavir), NFV (Nelfinavir), APV (Amprenavir), LPV (Lopinavir), fusion inhibitors such as T20, among others, fuseon and mixtures thereof, including anti-HIV compounds presently in clinical trials or in development, anti-HBV agents including, for example, hepsera (adefovir dipivoxil), lamivudine, entecavir, telbivudine, tenofovir, emtricitabine, clevudine, valtorcitabine, amdoxovir, pradefovir, racivir, BAM 205, nitazoxanide, UT 231-B, Bay 41-4109. EHT899, zadaxin (thymosin alpha-1) and mixtures thereof, and anti-HCV agents including, for example, interferon, pegylated interferon, ribavirin, NM 283, VX-950 (telaprevir). SCH 50304, TMC435, VX-500, BX-813, SCH503034, R1626, ITMN-191 (R7227), R7128, PF-868554, TT033, CGH-759, GI 5005. MK-7009, SIRNA-034, MK-0608, A-837093, GS 9190, ACH-1095, GSK625433, TG4040 (MVA-HCV), A-831, F351, NS5A, NS4B, ANA598, A-689, GNI-104, IDX102, ADX184, GL59728, GL60667, PSI-7851, TLR9 Agonist, PHX1766, SP-30 and mixtures thereof.
[0251] Typically pharmaceutical formulations and protocells can be loaded with cargo to a capacity up to about 10, 20, 30, 40, 50, 60, 70, 80 or about 90 weight % or more (or from about 0.01% to about 70%, about 0.02% to about 60%, about 0.2 to about 55%, about 0.5% to about 45%, about 1% to about 35%, about 1.5% to about 25%, about 0.1% to about 10%, about 0.01% to about 5%): defined as (cargo weight/weight of loaded protocell)100. The optimal loading of cargo is often about 0.01 to 60% but this depends on the drug or drug combination which is incorporated as cargo into the MSNPs. This is generally expressed in M per 10.sup.10 particles where we have values ranging from 2000-100 M per 10.sup.10 particles. For example, MSNPs exhibit release of cargo at pH about 5.5, which is that of the endosome, but are stable at physiological pH of 7 or higher (7.4).
[0252] The surface area of the internal space for loading is the pore volume whose optimal value ranges from about 1.1 to 0.5 cubic centimeters per gram (cc/g). Note that in the MSNPs according to one embodiment, the surface area is mainly internal as opposed to the external geometric surface area of the nanoparticle.
[0253] The lipid bi- or multilayer supported on the porous particle according to one embodiment has a lower melting transition temperature, i.e., is more fluid than a lipid bi- or multilayer supported on a non-porous support or the lipid bi- or multilayer in a liposome. This is sometimes important in achieving high affinity binding of immunogenic peptides or targeting ligands at low peptide densities, as it is the bilayer fluidity that allows lateral diffusion and recruitment of peptides by target cell surface receptors. One embodiment provides for peptides to duster, which facilitates binding to a complementary target.
[0254] The lipid bi- or multilayer may vary significantly in composition. Ordinarily, any lipid or polymer which may be used in liposomes may also be used in MSNPs. For example, lipids are as otherwise described herein.
[0255] In some embodiments according, the lipid bi- or multilayer of the protocells can provide biocompatibility and can be modified to possess targeting species including, for example, antigens, targeting peptides, fusogenic peptides, antibodies, aptamers, and PEG (polyethylene glycol) to allow, for example, further stability of the protocels and/or a targeted delivery into a cell to maximize an immunogenic response. PEG, when included in lipid bilayers, can vary widely in molecular weight (although PEG ranging from about 10 to about 100 units of ethylene glycol, about 15 to about 50 units, about 15 to about 20 units, about 15 to about 25 units, about 16 to about 18 units, etc., may be used) and the PEG component which is generally conjugated to phospholipid through an amine group comprises about 1% to about 20%, for example, about 5% to about 15%, about 10% by weight of the lipids which are included in the lipid bi- or multilayer. The PEG component is generally conjugated to an amine-containing lipid such as DOPE or DPPE or other lipid, but in alterative embodiments may also be incorporated into the MSNPs, through inclusion of a PEG containing silane.
[0256] Numerous lipids which are used in liposome delivery systems may be used to form the lipid bi- or multilayer on nanoparticles. Virtually any lipid which is used to form a liposome may be used in the lipid bi- or multilayer which surrounds the nanoparticles according to an embodiment. For example, lipids for use in the present invention include, for example, 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC), 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC), 1,2-dioleoyl-sn-glycero-3-[phosphor-L-serine] (DOPS), 1,2-dioleoyl-3-trimethylammonium-propane (18:1 DOTAP), 1,2-dioleoyl-sn-glycero-3-phospho-(1-rac-glycerol) (DOPG), 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE), 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine (DPPE), 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene glycol)-2000] (18:1 PEG-2000 PE), 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene glycol)-2000] (16:0 PEG-2000 PE), 1-oleoyl-2-[12-[(7-nitro-2-1,3-benzoxadiazol-4-yl)amino]auroyl]-sn-glycero)-3-phosphocholine (18:1-12:0 NBD PC), 1-palmitoyl-2-{12-[(7-nitro-2-1,3-benzoxadiazol-4-yl)amino]lauroyl}-sn-glycero-3-phosphocholine (16:0-12:0 NBD PC), cholesterol and mixtures/combinations thereof. Cholesterol, not technically a lipid, but presented as a lipid for purposes of an embodiment given the fact that cholesterol may be an important component of the lipid bilayer of protocells according to an embodiment. Often cholesterol is incorporated into lipid bilayers of protocells in order to enhance structural integrity of the bilayer. These lipids are all readily available commercially from Avanti Polar Lipids, Inc. (Alabaster, Ala., USA). DOPE and DPPE are particularly useful for conjugating (through an appropriate crosslinker) PEG, peptides, polypeptides, including immunogenic peptides, proteins and antibodies, RNA and DNA through the amine group on the lipid.
[0257] MSNPs and protocells can be PEGylated with a variety of polyethylene glycol-containing compositions as described herein. PEG molecules can have a variety of lengths and molecular weights and include, but are not limited to, PEG 200, PEG 1000, PEG 1500, PEG 4600, PEG 10,000, PEG-peptide conjugates or combinations thereof.
[0258] Pharmaceutical compositions comprise an effective population of MSNPs and/or protocells as otherwise described herein formulated to effect an intended result (e.g., immunogenic result, therapeutic result and/or diagnostic analysis, including the monitoring of therapy) formulated in combination with a pharmaceutically acceptable carrier, additive or excipient. The MSNPs and/or protocells within the population of the composition may be the same or different depending upon the desired result to be obtained. Pharmaceutical compositions may also comprise an additional bioactive agent or drug, such as an antiviral agent.
[0259] Generally, dosages and routes of administration of the compound are determined according to the size and condition of the subject, according to standard pharmaceutical practices. Dose levels employed can vary widely, and can readily be determined by those of skill in the art. Typically, amounts in the milligram up to gram quantities are employed. The composition may be administered to a subject by various routes, e.g., orally, transdermally, perineurally or parenteraly, that is, by intravenous, subcutaneous, intraperitoneal, intrathecal or intramuscular injection, among others, including buccal, rectal and transdermal administration. Subjects contemplated for treatment according to the method include humans, companion animals, laboratory animals, and the like. The invention contemplates immediate and/or sustained/controlled release compositions, including compositions which comprise both immediate and sustained release formulations. This is particularly true when different populations of MSNPs and/or protocells are used in the pharmaceutical compositions or when additional bioactive agent(s) are used in combination with one or more populations of protocells as otherwise described herein.
[0260] Formulations containing the compounds may take the form of liquid, solid, semi-solid or lyophilized powder forms, such as, for example, solutions, suspensions, emulsions, sustained-release formulations, tablets, capsules, powders, suppositories, creams, ointments, lotions, aerosols, patches or the like. In one embodiment, in unit dosage forms suitable for simple administration of precise dosages.
[0261] Pharmaceutical compositions typically include a conventional pharmaceutical carrier or excipient and may additionally include other medicinal agents, carriers, adjuvants, additives and the like. In one embodiment, the composition is about 0.1% to about 85%, about 0.5% to about 75% by weight of a compound or compounds, with the remainder consisting essentially of suitable pharmaceutical excipients.
[0262] An injectable composition for parenteral administration (e.g., intravenous, intramuscular or intrathecal) will typically contain the compound in a suitable i.v. solution, such as sterile physiological salt solution. The composition may also be formulated as a suspension in an aqueous emulsion.
[0263] Liquid compositions can be prepared by dissolving or dispersing the population of MSNPs and/or protocels (about 0.5% to about 20% by weight or more), and optional pharmaceutical adjuvants, in a carrier, such as, for example, aqueous saline, aqueous dextrose, glycerol, or ethanol, to form a solution or suspension. For use in an oral liquid preparation, the composition may be prepared as a solution, suspension, emulsion, or syrup, being supplied either in liquid form or a dried form suitable for hydration in water or normal saline.
[0264] For oral administration, such excipients include pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, talcum, cellulose, glucose, gelatin, sucrose, magnesium carbonate, and the like. If desired, the composition may also contain minor amounts of non-toxic auxiliary substances such as wetting agents, emulsifying agents, or buffers.
[0265] When the composition is employed in the form of solid preparations for oral administration, the preparations may be tablets, granules, powders, capsules or the like. In a tablet formulation, the composition is typically formulated with additives, e.g., an excipient such as a saccharide or cellulose preparation, a binder such as starch paste or methyl cellulose, a filler, a disintegrator, and other additives typically used in the manufacture of medical preparations.
[0266] Methods for preparing such dosage forms are known or is apparent to those skilled in the art; for example, see Remington's Pharmaceutical Sciences (17th Ed., Mack Pub. Co., 1985). The composition to be administered will contain a quantity of the selected compound in a pharmaceutically effective amount for therapeutic use in a biological system, including a patient or subject.
[0267] Methods of treating patients or subjects in need for a particular disease state or infection comprise administration an effective amount of a pharmaceutical composition comprising therapeutic MSNPs and/or protocells and optionally at least one additional bioactive (e.g., antiviral, antibiotic, and/or antimicrobial) agent.
[0268] Intranasal (IN) delivery of broad-spectrum small molecule, nucleic acid, and antibody-based antivirals to central nervous system (CNS) tissues and cells infected with encephalitic New World alphaviruses (e.g., Venezuelan (VEEV), eastern (EEEV), and western (WEEV) equine encephalitis viruses) illustrates in one embodiment treatment modality.
[0269] Diagnostic methods may comprise administering to a patient in need an effective amount of a population of diagnostic MSNPs and/or protocels (e.g., MSNPs and/or protocells which comprise a target species, such as a targeting peptide which binds selectively to virally-infected cells and a reporter component to indicate the binding of the protocells) whereupon the binding of the MSNPs and/or protocells to cells as evidenced by the reporter component (moiety) will enable a diagnosis of the existence of a disease state in the patient.
[0270] An alternative of the diagnostic method may be used to monitor the therapy of a disease state in a patient, the method comprising administering an effective population of diagnostic MSNPs and/or protocels (e.g., MSNPs and/or protocels which comprise a target species, such as a targeting peptide which binds selectively to target cells and a reporter component to indicate the binding of the protocells to virally-infected cells if such cells are present) to a patient or subject prior to treatment, determining the level of binding of diagnostic protocells to target cells in said patient and during and/or after therapy, determining the level of binding of diagnostic protocels to target cells in said patient, whereupon the difference in binding before the start of therapy in the patient and during and/or after therapy will evidence the effectiveness of therapy in the patient, including whether the patient has completed therapy or whether the disease state has been inhibited or eliminated.
[0271] In accordance with the present disclosure may be employed conventional molecular biology, microbiology, and recombinant DNA techniques within the skill of the art. Such techniques are explained fully in the literature. See, e.g., Sambrook at al, 2001, Molecular Cloning: A Laboratory Manual; Ausubel, ed., 1994, Current Protocols in Molecular Biology Volumes I-III: Cells, ed., 1994, Cell Biology: A Laboratory Handbook Volumes I-III; Coligan, ed., 1994, Current Protocols in Immunology Volumes I-III; Gait ed., 1984, Oligonucleotide Synthesis; Hames & Higgins eds., 1985, Nucleic Acid Hybridization; Hames & Higgins, eds., 1984, Transcription And Translation; Freshney, ed., 1986, Animal Cell Culture; IRL.
[0272] Any number of histone proteins, as well as other means to package the DNA into a smaller volume such as normally cationic nanoparticles, lipids, or proteins, may be used to package the supercoiled plasmid DNA histone-packaged supercoiled plasmid DNA, but in therapeutic aspects which relate to treating human patients, the use of human histone proteins are for example used. In certain aspects, a combination of human histone proteins H1, H2A, H2B, H3 and H4 in one embodiment ratio of 1:2:2:2:2, although other histone proteins may be used in other, similar ratios, as is known in the art or may be readily practiced pursuant to the teachings. The DNA may also be double stranded linear DNA, instead of plasmid DNA, which also may be optionally supercoiled and/or packaged with histones or other packaging components.
[0273] Other histone proteins which may be used in this aspect include, for example, H1F, H1F0, H1FNT, H1FOO, H1FX H1H1 HIST1H1A, HIST1H1B, HIST1H1C, HIST1H1D, HIST1H1E, HIST1H1T, H2AF, H2AFB1, H2AFB2, H2AFB3, H2AFJ, H2AFV, H2AFX, H2AFY, H2AFY2, H2AFZ, H2A1, HIST1H2AA, HIST1H2AB, HIST1H2AC, HIST1H2AD, HIST1H2AE, HIST1H2AG, HIST1H2AI, HIST1H2AJ, HIST1H2AK, HIST1H2AL, HIST1H2AM, H2A2, HIST2H2AA3, HIST2H2AC, H2BF, H2BFM, HSBFS, HSBFWT, H2B1, HIST1H2BA, HIST1HSBB, HIST1HSBC, HIST1HSBD, HIST1H2BE, HIST1H2BF, HIST1H2BG, HIST1H2BH, HIST1H2BI, HIST1H2BJ, HIST1H2BK, HIST1H2BL, HIST1H2BM, HIST1H2BN, HIST1H2BO, H2B2, HIST2H2BE, H3A1, HIST1H3A, HIST1H3B, HIST1H3C, HIST1H3D, HIST1H3E, HIST1H3F, HIST1H3G, HIST1H3H, HIST1H31, HIST1H3J, H3A2, HIST2H3C, H3A3, HIST3H3, H41, HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, HIST1H4E, HIST1H4F, HIST1H4G, HIST1H4H, HIST1H41, HIST1H4J, HIST1H4K, HIST1H4L, H44 and HIST4H4.
[0274] Proteins gain entry into the nucleus through the nuclear envelope. The nuclear envelope consists of concentric membranes, the outer and the inner membrane. These are the gateways to the nucleus. The envelope consists of pores or large nuclear complexes. A protein translated with a NLS will bind strongly to importin (aka karyopherin), and together, the complex will move through the nuclear pore. Any number of nuclear localization sequences may be used to introduce histone-packaged plasmid DNA into the nucleus of a cell. Exemplary nuclear localization sequences include H.sub.2N-GNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGC-COOH, RRMKWKK, PKKKRKV, and KR[PAATKKAGQA]KKKK (SEQ ID NOs: 24-27, the NLS of nucleoplasmin, a prototypical bipartite signal comprising two clusters of basic amino acids, separated by a spacer of about 10 amino acids. Numerous other nuclear localization sequences are well known in the art. See LaCasse et al., (1995); Weis, (1998); and Murat Cokol et al., at the website ubic.bioc.columbia.edulpapers/2000 nls/paper.html#tab2.
[0275] A peptide nucleic acid can consist of repeating N-(2-aminoethyl)-glycine units linked by amide bonds. The purine (A, G) and pyimidine (C, T) bases are attached to the backbone through methylene carbonyl linkages. Unlike DNA or DNA analogs, PNAs do not contain any (pentose) sugar moieties or phosphate groups. Surprisingly, PNA's in many respects mimic the behavior of DNA, and in some applications demonstrate superior properties. By convention, PNAs are depicted like peptides, with the N-terminus at the (left) position and the C-terminus at the right. Besides the obvious structural difference, PNA is set apart from DNA in that the backbone of PNA is acyclic, achiral and neutral. PNAs can bind to complementary nucleic acids in both antiparallel and parallel orientation. However, the antiparallel orientation is strongly in one embodiment, and the parallel duplex has been shown to have a different structure. Nielsen, et al., An Introduction to Peptide Nucleic Acid, Current Issues Molec. Biol. (1999) 1(2): 89-104.
[0276] A level and/or an activity and/or expression of a translation product of a gene and/or of a fragment, or derivative, or variant of said translation product, and/or the level or activity of said translation product, and/or of a fragment, or derivative, or variant thereof, can be detected using an immunoassay, an activity assay, and/or a binding assay. These assays can measure the amount of binding between said protein molecule and an anti-protein antibody by the use of enzymatic, chromodynamic, radioactive, magnetic, or luminescent labels which are attached to either the anti-protein antibody or a secondary antibody which binds the anti-protein antibody. In addition, other high affinity ligands may be used. Immunoassays which can be used include, e.g., ELISAs, Western blots and other techniques known to those of ordinary skill in the art (see Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor. N.Y., 1999 and Edwards R, Immunodiagnostics: A Practical Approach, Oxford University Press, Oxford; England, 1999). All these detection techniques may also be employed in the format of microarrays, protein-arrays, antibody microarrays, tissue microarrays, electronic biochip or protein-chip based technologies (see Schena M., Microarray Biochip Technology, Eaton Publishing, Natick, Mass., 2000).
[0277] Certain diagnostic and screening methods utilize an antibody, for example, a monoclonal antibody, capable of specifically binding to a protein as described herein or active fragments thereof. The method of utilizing an antibody to measure the levels of protein allows for non-invasive diagnosis of the pathological states of kidney diseases. In one embodiment, the antibody is human or is humanized. In one embodiment, antibodies may be used, for example, in standard radioimmunoassays or enzyme-linked immunosorbent assays or other assays which utilize antibodies for measurement of levels of protein in sample. In a particular embodiment, the antibodies are used to detect and to measure the levels of protein present in a sample.
[0278] Humanized antibodies are antibodies, or antibody fragments, that have the same binding specificity as a parent antibody, (e.g., typically of mouse origin) and increased human characteristics. Humanized antibodies may be obtained, for example, by chain shuffling or by using phage display technology. For example, a polypeptide comprising a heavy or light chain variable domain of a non-human antibody specific for a disease related protein is combined with a repertoire of human complementary (light or heavy) chain variable domains. Hybrid pairings specific for the antigen of interest are selected. Human chains from the selected pairings may then be combined with a repertoire of human complementary variable domains (heavy or light) and humanized antibody polypeptide dimers can be selected for binding specificity for an antigen. Techniques described for generation of humanized antibodies that can be used in the method are disclosed in, for example, U.S. Pat. Nos. 5,565,332; 5,585,089; 5,694,761; and 5,693,762. Furthermore, techniques described for the production of human antibodies in transgenic mice are described in, for example, U.S. Pat. Nos. 5,545,806 and 5,569,825.
[0279] In order to identify small molecules and other agents useful in the present methods for treating a viral infection by modulating the activity and expression of a disease-related protein and biologically active fragments thereof can be used for screening therapeutic compounds in any of a variety of screening techniques. Fragments employed in such screening tests may be free in solution, affixed to a solid support, bore on a cell surface, or located intracellularly. The blocking or reduction of biological activity or the formation of binding complexes between the disease-related protein and the agent being tested can be measured by methods available in the art.
[0280] Other techniques for drug screening which provide for a high throughput screening of compounds having suitable binding affinity to a protein, or to another target polypeptide useful in modulating, regulating, or inhibiting the expression and/or activity of a disease, are known in the art. For example, microarrays carrying test compounds can be prepared, used, and analyzed using methods available in the art. See, e.g., Shalon, D. et al., 1995, International Publication No. WO95/35505, Baldeschweiler et al., 1995, International Publication No. WO95/251116; Brennan et al., 1995, U.S. Pat. No. 5,474,796; Heller et al., 1997, U.S. Pat. No. 5,605,662.
[0281] To determine specific binding, various immunoassays may be employed for detecting, for example, human or primate antibodies bound to the cells. Thus, one may use labeled anti-hlg, e.g., anti-hlgM, hlgG or combinations thereof to detect specifically bound human antibody. Various labels can be used such as radioisotopes, enzymes, fluorescers, chemiluminescers, particles, etc. There are numerous commercially available kits providing labeled anti-hlg, which may be employed in accordance with the manufacturer's protocol.
[0282] In one embodiment, a kit can comprise: (a) at least one reagent which is selected from the group consisting of (i) reagents that detect a transcription product of the gene coding for a protein marker as described herein (ii) reagents that detect a translation product of the gene coding for proteins, and/or reagents that detect a fragment or derivative or variant of said transcription or translation product; (b) instructions for diagnosing, or prognosticating a disease, or determining the propensity or predisposition of a subject to develop such a disease or of monitoring the effect of a treatment by determining a level, or an activity, or both said level and said activity, and/or expression of said transcription product and/or said translation product and/or of fragments, derivatives or variants of the foregoing, in a sample obtained from said subject; and comparing said level and/or said activity and/or expression of said transcription product and/or said translation product and/or fragments, derivatives or variants thereof to a reference value representing a known disease status (patient) and/or to a reference value representing a known health status (control) and/or to a reference value; and analyzing whether said level and/or said activity and/or expression is varied compared to a reference value representing a known health status, and/or is similar or equal to a reference value representing a known disease status or a reference value; and diagnosing or prognosticating a disease, or determining the propensity or predisposition of said subject to develop such a disease, wherein a varied or altered level, expression or activity, or both said level and said activity, of said transcription product and/or said translation product and/or said fragments, derivatives or variants thereof compared to a reference value representing a known health status (control) and/or wherein a level, or activity, or both said level and said activity, of said transcription product and/or said translation product and/or said fragments, derivatives or variants thereof is similar or equal to a reference value and/or to a reference value representing a known disease stage, indicates a diagnosis or prognosis of a disease, or an increased propensity or predisposition of developing such a disease, a high risk of developing signs and symptoms of a disease.
[0283] Reagents that selectively detect a transcription product and/or a translation product of the gene coding for proteins can be sequences of various length, fragments of sequences, antibodies, aptamers, siRNA, microRNA, and ribozymes. Such reagents may be used also to detect fragments, derivatives or variants thereof.
[0284] Purely by way of example, comparing measured levels of a viral infection biomarker (e.g., viral titer) in a sample to corresponding control levels, or comparing measured viral marker levels to control viral marker levels determined in a healthy control subject, and determining that a subject suffers from a viral infection or that a subject's viral infection is progressing, can include determinations based on comparative level differences of about between about 5-10%, or about 10-15%, or about 15-20%, or about 20-25%, or about 25-30%, or about 30-35%, or about 35-40%, or about 40-45%, or about 45-50%, or about 50-55%, or about 55-60%, or about 60-65%, or about 65-70%, or about 70-75%, or about 75-80%, or about 80-85%, or about 85-90%, or about 90-95%, or about 95-100%, or about 100-110%, or about 110-120%, or about 120-130%, or about 130-140%, or about 140-150%, or about 150-160%, or about 160-170%, or about 170-180%, or about 180-190%, or 190-200%, or 200-210%, or 210-220%, or 220-230%, or 230-240%, or 240-250%, or 250-260%, or about 260-270%, or about 270-280%, or about 280-290%, or about 290-300%, or differences of about between about 50% to about 0.5%, or about 45% to about 1%, or about 40% to about 1.5%, or about 35% to about 2.0%, or about 30% to about 2.5%, or about 25% to about 3.0%, or about 20% to about 3.5%, or about 15% to about 4.0%, or about 10% to about 5.0%, or about 9% to about 1.0%, or about 8% to about 2%, or about 7% to about 3%, or about 6% to about 5%, or about 5%, or about 4.5%, or about 4.0%, or about 3.5%, or about 3.0%, or about 2.5%, or about 2.0%, or about 1.5%, or about 1.0%.
[0285] Exemplary Anti-Bacterial Protocell Compositions
[0286] The present disclosure provides protocells comprising a porous nanoparticle core encapsulated by a lipid bilayer or lipid multilayer, a targeting moiety attached to the lipid bilayer, and an antibacterial cargo. In some embodiments, the targeting moiety binds to a bacterial cellular receptor. In some embodiments, the targeting moiety binds to a protein present on the surface of a bacterially-infected host cell. In some embodiments, the antibacterial cargo is an antibiotic. In some embodiments, the antibacterial cargo is a peptide nucleic acid (PNA) or a cell penetrating peptide-peptide nucleic acid (CPP-PNA) conjugate. In some embodiments, the PNA or CPP-PNA inhibits the expression of a bacterial protein that enables antibiotic-resistance to the bacteria. In some embodiments, the antibacterial cargo comprises an antibiotic and a PNA or CPP-PNA that inhibits the expression of a bacterial protein that enables resistance to the antibiotic. A non-limiting, exemplary protocell is depicted in
[0287] The following terms shall be used throughout the specification to describe the present invention. Where a term is not specifically defined herein, that term shall be understood to be used in a manner consistent with its use by those of ordinary skill in the art.
[0288] Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context dearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges is also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either both of those included limits are also included in the invention. In instances where a substituent is a possibility in one or more Markush groups, it is understood that only those substituents which form stable bonds are to be used.
[0289] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing, in one embodiment methods and materials are now described.
[0290] It must be noted that as used herein and in the appended claims, the singular forms a, and and the include plural references unless the context dearly dictates otherwise.
[0291] Furthermore, the following terms shall have the definitions set out below.
[0292] Porous silica particles of varying sizes ranging in size (diameter) from less than 5 nm to 200 nm or 500 nm or more are readily available in the art or can be readily prepared using methods known in the art or alternatively, can be purchased from Melorium Technologies, Rochester, N.Y. Sky Spring Nanomaterials, Inc., Houston, Tex., USA or from Discovery Scientific. Inc., Vancouver, British Columbia. Multimodal silica nanoparticles may be readily prepared using the procedure of Carroll, et al., Langmuir, 25, 13540-13544 (2009).
[0293] The examples herein provide various methodologies for obtaining protocells which are useful in the present invention. Useful general techniques include those described in Liu, et al., Chem. Comm., 5100-5102 (2009), Liu, et al., J. Amer. Chem. Soc., 131, 1354-1355 (2009), Liu, et al., J. Amer. Chem. Soc., 131, 7567-7569 (2009) Lu, et al., Nature, 398, 223-226 (1999), Ashley, et al., Nature Materials, 2011. May; 10(5):389-97, Lu, et al., Nature, 398, 223-226 (1999), and Caroll, et al., Langmuir, 25, 13540-13544 (2009).
[0294] Nanostructures include a core-shell structure which comprises a porous particle core surrounded by a shell of lipid for example a bilayer, but possibly a monolayer or multiayer (see Liu, et al., J. Amer. Chem. Soc., 131, 7567-7569 (2009)). The porous particle core can include, for example, a porous nanoparticle made of an inorganic and/or organic material as set forth above surrounded by a lipid bilayer.
[0295] The porous particle core of the protocells can be loaded with various desired species (cargo), including small molecules (e.g., antibacterial agents as otherwise described herein), large molecules (e.g., including macromolecules such as asRNA, siRNA or shRNA or a polypeptide which may include an antibacterial polypeptide or a reporter polypeptide (e.g., fluorescent green protein, among others), semiconductor quantum dots, or metallic nanoparticles, or metal oxide nanoparticles or combinations thereof). Protocells can also be loaded with super-coiled plasmid DNA, which can be used to deliver a therapeutic and/or diagnostic peptide(s) or a small hairpin RNA/shRNA or small interfering RNA/siRNA, which can be used to inhibit expression of proteins associated with antibiotic resistance.
[0296] In some embodiments, protocells are comprised of a spherical mesoporous silica nanoparticle (MSNP) core encased within a supported lipid bilayer (SLB) (Ashley et al., 2012; Ashley et al., 2011; Epler et al., 2012). MSNPs have an extremely high surface area (>1200 m.sup.2/g), which enables high concentrations of various therapeutic and diagnostic agents to be adsorbed within the core by simple immersion in a solution of the cargo(s) of interest. Furthermore, since the aerosol-assisted evaporation-induced self-assembly (EISA) process (Lu at al., 1999) we pioneered to synthesize MSNPs is compatible with a wide range of structure-directing surfactants and amenable to post-synthesis processing, the overall size can be varied from 20-nm to >10-m, the pore size can be varied from 2.5-nm to 50-nm, and the naturally negatively-charged pore walls can be modified with a variety of functional moieties, enabling facile encapsulation of physicochemically disparate molecules, including acidic, basic, and hydrophobic drugs, proteins, small interfering RNA, minicircle DNA vectors, plasmids, and diagnostic agents like quantum dots and iron oxide nanoparticles (Ashley et al., 2012; Ashley et al., 2011; Epler et al., 2012).
[0297] Protocells have a loading capacity of up to 60 wt % for small molecule drugs, which is 10-fold higher than other MSNP-based delivery vehicles (Meng et al., 2010) and 1000-fold higher than similarly-sized liposomes (Ashley et al., 2011). Release rates can be tailored by controlling the core's degree of silica condensation and, therefore, its dissolution rate under physiological conditions; thermal calcination maximizes condensation and results in particles with sustained release profiles (7-10% release per day for up to 2 weeks), while use of acidified ethanol to extract surfactants enhances particle solubility and results in burst release of encapsulated drugs (100% release within 12 hours). Liposome fusion to cargo-loaded MSNPs results in the formation of a coherent SLB that provides a stable, fluid, biocompatible interface for display of functional molecules, such as polyethylene glycol (PEG) and targeting ligands.
[0298] Protocells stably encapsulate small molecule drugs for up to 4 weeks when dispersed in complex biological fluids (e.g., complete growth medium and blood), regardless of whether the SLB is composed of lipids that are fluid or non-fluid at body temperature; in contrast, liposomes rapidly leak their encapsulated drugs, even when their bilayers are composed of fully saturated lipids, which have a high packing density and should, therefore, limit diffusion of drugs across the bilayer. The fluid, yet stable SLB enables us to achieve exquisitely high targeting specificities at low ligand densities, which, in turn, reduces immunogenicity and non-specific interactions; we have shown that protocells modified with an average of just 6 targeting peptides per particle have a 10,000-fold higher affinity for target cells than for non-target cells when the SLB is composed of the fluid, zwitterionic lipid, 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC) (Ashley et al., 2011).
[0299] Protocells are highly biocompatible and can be engineered for both broad distribution and persistence within target tissues. Balb/c mice injected intravenously (i.v.) with 200 mg/kg doses of PEGylated protocells three times each week for three weeks show no signs of gross or histopathological toxicity. Given their high loading capacity, this result indicates that protocells can deliver at least 900 mg/kg of therapeutic molecules with either burst or sustained release kinetics. Furthermore, PEGylated protocells 20-200 nm in diameter remain broadly distributed for 2-7 days when injected i.v., which provides a sufficient period of time for targeted protocells to accumulate within target tissues, where they can persist for up to 4 weeks with no adverse effects. Additionally, we and others have demonstrated that MSNPs are biodegradable and ultimately excreted in the urine and feces as silicic acid (Lu et al., 2010). Finally, we have shown that protocels modified with up to 10 wt % of targeting ligands induce neither IgG nor IgM responses when injected in C57Bl/6 mice at a total dose of 400 mg/kg. Depending upon the biodistribution required for a specific application, we can control the MSNP size and shape (spherical, disk-shaped, and rod-shaped (Meng at al., 2011) and the SLB charge and surface modification(s), making the protocell a highly modular, flexible nanoparticle delivery system.
[0300] A nanoparticle may have a variety of shapes and cross-sectional geometries that may depend, in part, upon the process used to produce the particles. In one embodiment, a nanoparticle may have a shape that is a torus (toroidal). A nanoparticle may include particles having two or more of the aforementioned shapes. In one embodiment, a cross-sectional geometry of the particle may be one or more of toroidal, circular, ellipsoidal, triangular, rectangular, or polygonal. In one embodiment, a nanoparticle may consist essentially of non-spherical particles. For example, such particles may have the form of ellipsoids, which may have all three principal axes of differing lengths, or may be oblate or prelate ellipsoids of revolution. Non-spherical nanoparticles alternatively may be laminar in form, wherein laminar refers to particles in which the maximum dimension along one axis is substantially less than the maximum dimension along each of the other two axes. Non-spherical nanoparticles may also have the shape of frusta of pyramids or cones, or of elongated rods. In one embodiment, the nanoparticles may be irregular in shape. In one embodiment, a plurality of nanoparticles may consist essentially of spherical nanoparticles.
[0301] The MSNP size distribution depends on the application, but is principally monodisperse (e.g., a uniform sized population varying no more than about 5-20% in diameter, as otherwise described herein). The term monodisperse is used as a standard definition established by the National Institute of Standards and Technology (NIST) (Particle Size Characterization, Special Publication 960-1, January 2001) to describe a distribution of particle size within a population of particles, in this case nanoparticles, which particle distribution may be considered monodisperse if at least 90% of the distribution lies within 5% of the median size. See Takeuchi, et al., Advanced Materials, 2005, 17, No. 8, 1067-1072.
[0302] In certain embodiments, mesoporous silica nanoparticles can be in range, e.g., from around 5 nm to around 500 nm (e.g., about 50 nm to about 500 nm) in size, including all integers and ranges there between. The size is measured as the longest axis of the particle. In various embodiments, the particles are from around 10 nm to around 500 nm and from around 10 nm to around 100 nm in size. The mesoporous silica nanoparticles have a porous structure. The pores can be from around 1 to around 20 nm in diameter, including all integers and ranges there between. In one embodiment, the pores are from around 1 to around 10 nm in diameter. In one embodiment, around 90% of the pores are from around 1 to around 20 nm in diameter. In another embodiment, around 95% of the pores are around 1 to around 20 nm in diameter.
[0303] In one embodiment, MSNPs are monodisperse and range in size from about 25 nm to about 300 nm; exhibit stability (colloidal stability); have single cell binding specification to the substantial exclusion of non-targeted cells; are neutral or cationic for specific targeting (for example, cationic); are optionally modified with agents such as PEI, NMe3+, dye, crosslinker, ligands (ligands provide neutral charge); and optionally, are used in combination with a cargo to be delivered to a targeted cell.
[0304] In certain embodiments, the MSNPs are monodisperse and range in size from about 25 nm to about 300 nm. The sizes used for example include 50 nm (+/10 nm) and 150 nm (+/15 nm), within a narrow monodisperse range, but may be more narrow in range. A broad range of particles is not used because such a population is difficult to control and to target specifically.
[0305] Illustrative examples of a cationic surfactant include, but are not limited to, cetyl trimethylammonium bromide (CTAB), dodecylethyldimethylammonium bromide, cetylpyridinium chloride (CPC), polyethoxylated tallow amine (POEA), hexadecyltrimethylammonium p-toluenesulfonate, benzalkonium chloride (BAC), or benzethonium chloride (BZT).
[0306] Poloxamers such as F127 are difunctional block copolymer surfactants terminating in primary hydroxyl groups. They are composed of a central hydrophobic chain of polyoxypropylene (poly(propylene oxide)) flanked by two hydrophilic chains of polyoxyethylene (poly(ethylene oxide)). Because the lengths of the polymer blocks can be customized, many different poloxamers exist having slightly different properties. For the generic term poloxamer, these copolymers are commonly named with the letter P (for poloxamer) followed by three digits, the first two digits.times.100 give the approximate molecular mass of the polyoxypropylene core, and the last digit.times.10 gives the percentage polyoxyethylene content (e.g., P407=Poloxamer with a polyoxypropylene molecular mass of 4,000 g/mol and a 70% polyoxyethylene content). For the Pluronic tradename, coding of these copolymers starts with a letter to define it's physical form at room temperature (L=liquid, P=paste, F=flake (solid)) followed by two or three digits, the first digit(s) refer to the molecular mass of the polyoxypropylene core (determined from BASF's Pluronic grid) and the last digit.times.10 gives the percentage polyoxyethylene content (e.g., F127 is a PluronicdD with a polyoxypropylene molecular mass of 4,000 g/mol and a 70% polyoxyethylene content). In the example given, poloxamer 407 (P407) is Pluronic F127.
[0307] In some embodiments, targeting moieties induce protocell binding to bacterially-infected host cells. In some embodiments, the targeting moiety targets a bacterially-infected host cell. In some embodiments, the targeting moiety specifically targets a host cell surface molecule specifically present during an intracellular bacterial infection.
[0308] Exemplary targeting ligands which may be used to target cells include peptides, affibodies and antibodies (including monoclonal and/or polydonal antibodies). In certain embodiments, targeting ligands selected from the group consisting of Fc from human igG (which binds to Fc receptors on macrophages and dendritic cells), human complement C3 (which binds to CR1 on macrophages and dendritic cells), ephrin B2 (which binds to EphB4 receptors on alveolar type II epithelial cells), and the SP94 peptide (which binds to unknown receptor(s) on hepatocyte-derived cells).
[0309] In some embodiments, the protocells described herein further comprise an endosomolytic moiety. After binding to a bacterially-infected host cell, the protocells described herein are internalized by the host cell. The endosomolytic moiety promotes escape of the antibacterial cargo into the host cell, where it can promote death of the intracellular bacteria. In some embodiments, the endosomolytic moiety ruptures a bacterially-infected cell membrane ruptures acidic intracellular vesicles of the bacterially-infected host cell. In some embodiments, the endosomolytic moiety is a peptide. In some embodiments, the endosomolytic moiety is octaarginine (R8). H5WYG, Penetratin-HA2, modified HA2-TAT, 43E or Histidine 10.
[0310] The charge is controlled based on what is to be accomplished (via PEI, NMe3+, dye, crosslinker, ligands, etc.), but for targeting the charge is for example cationic. Charge also changes throughout the process of formation. Initially the targeted particles are cationic and are often delivered as cationically charged nanoparticles, however post modification with ligands they are closer to neutral. The ligands which find use in the present invention include peptides, affibodies and antibodies, among others. These ligands are site specific and are useful for targeting specific cells which express peptides to which the ligand may bind selectively to targeted cells.
[0311] MSNPs may be used to deliver cargo to a targeted cell, including, for example, cargo component selected from the group consisting of at least one polynucleotide, such as double stranded linear DNA, minicircle DNA, naked DNA or plasmid DNA, messenger RNA, small interfering RNA, small hairpin RNA, microRNA, a polypeptide, a protein, a drug (in particular, an antibiotic drug), an imaging agent, or a mixture thereof. The MSNPs pursuant to the present invention are effective for accommodating cargo which are long and thin (e.g., naked) in three-dimensional structure, such as polynucleotides (e.g., various DNA and RNA) and polypeptides. In some embodiments, the cargo is an antibiotic (e.g., an antibiotic) or a CPP-PNA.
[0312] In protocells, a PEGylated lipid bi- or multilayer encapsulates a population of MSNPs as described herein and comprises (1) a PEGylated lipid which is optionally-thiolated (2) at least one additional lipid and, optionally (3) at least one targeting ligand which is conjugated to the outer surface of the lipid bi- or multilayer and which is specific against one or more receptors of bacterially-infected cells.
[0313] Protocells are highly flexible and modular. High concentrations of physiochemically-disparate molecules can be loaded into the protocells and their therapeutic and/or diagnostic agent release rates can be optimized without altering the protocell's size, size distribution, stability, or synthesis strategy. Properties of the supported lipid bi- or multilayer and mesoporous silica nanoparticle core can also be modulated independently, thereby optimizing properties as surface charge, colloidal stability, and targeting specificity independently from overall size, type of cargo(s), loading capacity, and release rate.
[0314] Pharmaceutical formulations and protocells can be used in the treatment of an infection caused by a bacterium selected from the group consisting of multidrug-resistant (MDR) Klebsiella pneumoniae (Kpn), methicillin-resistant Staphylococcus aureus (MRSA), F. tularensis and B. pseudomallei. Infections associated with S. aureus or extracellular toxin complex (ETC) produced by K. pneumoniae can also be treated effectively. The pharmaceutical formulations and protocels are particularly useful in the treatment of methicillin-resistant Staphylococcus aureus (MRSA) skin and soft tissue infections (SSTI).
[0315] In certain embodiments, the pharmaceutical formulations and protocells can be used in the treatment of subject who is infected by a bacterium selected from the group consisting of multidrug-resistant (MDR) Klebsiella pneumoniae (Kpn), methicillin-resistant Staphylococcus aureus (MRSA), F. tularensis and B. pseudomallei.
[0316] Thus, pharmaceutical formulations and protocells can be used to treat a wide variety of bacterial infections including, but not limited to, infections caused by bacteria selected from the group consisting of F. tularensis, B. pseudomallei, Mycobacterium, staphylococcus, streptococcaceae, neisseriaceae, cocci, enterobacteriaceae, pseudomonadaceae, vibrionaceae, campylobacter, pasteurellaceae, bordetella, francisella, brucella, legionellaceae, bacteroidaceae, gram-negative bacilli, clostridium, corynebacterium, propionibacterium, gram-positive bacilli, anthrax, actinomyces, nocardia, mycobacterium, treponema, b rrelia, leptospira, mycoplasma, ureaplasma, rickettsia, chlamydiae and P. aeruginosa.
[0317] In addition to, or as an alternative to, the therapeutic nucleic acid cargo described herein, pharmaceutical formulations and protocells can also contain one or more antibiotics, e.g., antibiotics selected from the group consisting of Gentamicin, Kanamycin, Neomycin, Netilmicin, Tobramycin, Paromomycin, Spectinomycin, Geldanamycin, Herbimycin, Rifaximin, Streptomycin, Ertapenem, Doripenem, Imipenem/Cilastatin, Meropenem, Cefadroxil, Cefazolin, Cephalothin, Cephalexin, Cefaclor, Cefamandole, Cefoxitin, Cefprozil, Cefuroxime, Cefixime, Cefdinir, Cefditoren, Cefoperazone Cefotaxime, Cefpodoxime, Ceftazidime, Ceflibuten, Ceflizoxime Ceftriaxone, Cefepime. Ceftaroline fosamil, Ceftobiprole, Teicoplanin, Vancomycin, Telavancin, Daptomycin. Oritavancin, WAP-8294A, Azithromycin, Clarithromycin, Dirithromycin, Erythromycin, Roxithromycin, Telithromycin. Spiramycin. Clindamycin, Lincomycin, Aztreonam, Furazolidone, Nitrofurantoin, Oxazolidinones, Unezolid, Posizolid, Radezolid, Torezolid, Amoxicillin, Ampicilin, Azlocillin, Carbenicillin, Cloxacilin Dicloxacilin, Fludoxacillin, Mezlocillin, Methicilln, Nafcillin, Oxacillin, Penicillin G, Penicillin V, Piperacillin, Temocillin, Ticarcillin, Amoxicillin/clavulanate, Ampicillin/sulbactam, Piperacillin/tazobactam, Ticarcillin/clavulanate, Bacitracin, Colistin, Polymyxin B, Ciprofloxacin, Enoxacin, Gatifloxacin, Gemifloxacin, Levofloxacin, Lomefloxacin, Moxifloxacin, Nalidixic acid, Norfloxacin, Ofloxacin, Trovafloxacin, Grepafloxacin, Sparfloxacin, Mafenide, Sulfacetamide, Sulfadiazine, Sulfadimethoxine, Sulfamethizole, Sulfamethoxazole, Sulfasalazine, Sulfisoxazole, Trimethoprim-Sulfamethoxazole, Sulfonamidochrysoidine, Demedocydine, Doxycydine, Vibramycin Minocycline, Tigecydine, Oxytetracycline, Tetracycline, Clofazimine, Capreomycin, Cycloserine, Ethambutol, Rifampicin, Rifabutin, Rifapentine, Arsphenamine, Chloramphenicol, Fosfomycin, Fusidic acid, Metronidazole, Mupirocin, Platensimycin, Quinupristin/Dalfopristin, Thiamphenicol, Tigecycline and Tinidazole and combinations thereof.
[0318] Typically pharmaceutical formulations and protocells can be loaded with cargo to a capacity up to about 10, 20, 30, 40, 50, 60, 70, 80 or about 90 weight % or more (or from about 0.01% to about 70%, about 0.02% to about 60%, about 0.2 to about 55%, about 0.5% to about 45%, about 1% to about 35%, about 1.5% to about 25%, about 0.1% to about 10%, about 0.01% to about 5%): defined as (cargo weight/weight of loaded protocel)100. The optimal loading of cargo is often about 0.01 to 60% but this depends on the drug or drug combination which is incorporated as cargo into the MSNPs. This is generally expressed in M per 10.sup.10 particles where we have values ranging from 2000-100 M per 10.sup.10 particles. For example, MSNPs exhibit release of cargo at pH about 5.5, which is that of the endosome, but are stable at physiological pH of 7 or higher (7.4).
[0319] The surface area of the internal space for loading is the pore volume whose optimal value ranges from about 1.1 to 0.5 cubic centimeters per gram (cc/g). Note that in the MSNPs according to one embodiment, the surface area is mainly internal as opposed to the external geometric surface area of the nanoparticle.
[0320] The lipid bi- or multilayer supported on the porous particle according to one embodiment has a lower melting transition temperature, i.e. is more fluid than a lipid bi- or multilayer supported on a non-porous support or the lipid bi- or multilayer in a liposome. This is sometimes important in achieving high affinity binding of immunogenic peptides or targeting ligands at low peptide densities, as it is the bilayer fluidity that allows lateral diffusion and recruitment of peptides by target cell surface receptors. One embodiment provides for peptides to cluster, which facilitates binding to a complementary target.
[0321] The lipid bi- or multilayer may vary significantly in composition. Ordinarily, any lipid or polymer which may be used in liposomes may also be used in MSNPs. Exemplary lipids are as otherwise described herein.
[0322] In some embodiments, the lipid bi- or multilayer of the protocells can provide biocompatibility and can be modified to possess targeting species including, for example, antigens, targeting peptides, fusogenic peptides, antibodies, aptamers, and PEG (polyethylene glycol) to allow, for example, further stability of the protocells and/or a targeted delivery into a cell to maximize an immunogenic response. PEG, when included in lipid bilayers, can vary widely in molecular weight (although PEG ranging from about 10 to about 100 units of ethylene glycol, about 15 to about 50 units, about 15 to about 20 units, about 15 to about 25 units, about 16 to about 18 units, etc., may be used) and the PEG component which is generally conjugated to phospholipid through an amine group comprises about 1% to about 20%, for example about 5% to about 15%, about 10% by weight of the lipids which are included in the lipid bi- or multilayer. The PEG component is generally conjugated to an amine-containing lipid such as DOPE or DPPE or other lipid, but in alternative embodiments may also be incorporated into the MSNPs, through inclusion of a PEG containing silane.
[0323] Numerous lipids which are used in liposome delivery systems may be used to form the lipid bi- or multilayer on nanoparticles. Virtually any lipid which is used to form a liposome may be used in the lipid bi- or multilayer which surrounds the nanoparticles according to an embodiment. For example, lipids for use in the present invention include, for example, 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC), 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC), 1,2-dioleoyl-sn-glycero-3-[phosphor-L-serine] (DOPS), 1,2-dioleoyl-3-trimethylammonium-propane (18:1 DOTAP), 1,2-dioleoyl-sn-glycero-3-phospho-(1-rac-glycerol) (DOPG), 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE), 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine (DPPE), 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene glycol)-2000] (18:1 PEG-2000 PE), 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene glycol)-2000] (16:0 PEG-2000 PE), 1-oleoyl-2-[12-[(7-nitro-2-1,3-benzoxadiazol-4-yl)amino]lauroyl]-sn-glycero-3-phosphocholine (18:1-12:0 NBD PC), 1-palmitoyl-2-{12-[(7-nitro-2-1,3-benzoxadiazol-4-yl)amino]lauroyl}-sn-glycero-3-phosphocholine (16:0-12:0 NBD PC), cholesterol and mixtures/combinations thereof. Cholesterol, not technically a lipid, but presented as a lipid for purposes of an embodiment given the fact that cholesterol may be an important component of the lipid bilayer of protocels according to an embodiment. Often cholesterol is incorporated into lipid bilayers of protocells in order to enhance structural integrity of the bilayer. These lipids are all readily available commercially from Avanti Polar Lipids, Inc. (Alabaster, Ala. USA). DOPE and DPPE are particularly useful for conjugating (through an appropriate crosslinker) PEG, peptides, polypeptides, including immunogenic peptides, proteins and antibodies, RNA and DNA through the amine group on the lipid.
[0324] MSNPs and protocells can be PEGylated with a variety of polyethylene glycol-containing compositions as described herein. PEG molecules can have a variety of lengths and molecular weights and include, but are not limited to, PEG 200, PEG 1000, PEG 1500, PEG 4600, PEG 10,000, PEG-peptide conjugates or combinations thereof.
[0325] Exemplary fluorescent labels for use in MSNPs and protocells (for example via conjugation or adsorption to the lipid bi- or multilayer or silica core, although these labels may also be incorporated into cargo elements such as DNA. RNA, polypeptides and small molecules which are delivered to cells by the protocells) include Hoechst 33342 (350/461), 4,6-diamidino-2-phenylindole (DAPI, 356/451), Alexa Fluor 405 carboxylic acid, succinimidyl ester (401/421). CellTracker Violet BMQC (415/516), CellTracker Green CMFDA (492/517), calcein (495/515), Alexa Fluor 488 conjugate of annexin V (495/519), Alexa FluoP 488 goat anti-mouse IgG (H+L) (495/519), Click-iT AHA Alexa Fluor 488 Protein Synthesis HCS Assay (495/519), LIV5tOEAD.sup.D Fixable Green Dead Cell Stain Kit (495/519), SYTOX Green nucleic acid stain (504/523), MitoSOX Red mitochondrial superoxide indicator (510/580). Alexa Fluor 532 carboxylic acid, succinimidyl ester(532/554), pHrodo succinimidyl ester (558/576), CellTracker Red CMTPX (577/602), Texas Red 1,2-dihexadecanoyl-sn-glycero-3-phosphoethanolamine (Texas Red DHPE, 583/608), Alexa Fluor 647 hydrazide (649/666), Alexa Fluor 647 carboxylic acid, succinimidyl ester (650/668), Ulysis Alexa Fluor 647 Nucleic Acid Labeling Kit (650/670) and Alexa Fluor 647 conjugate of annexin V (650/665). Moieties which enhance the fluorescent signal or slow the fluorescent fading may also be incorporated and include SlowFade Gold antifade reagent (with and without DAPI) and Image-iT FX signal enhancer. All of these are well known in the art.
[0326] Additional reporters include polypeptide reporters which may be expressed by plasmids (such as histone-packaged supercoiled DNA plasmids) and include polypeptide reporters such as fluorescent green protein and fluorescent red protein. Reporters pursuant to the present invention are utilized principally in diagnostic applications including diagnosing the existence or progression of a bacterial infection in a patient and or the progress of therapy in a patient or subject. Using the above-described protocells which comprise at least one reporter, this approach can include a method of first diagnosing and then treating an antibiotic-resistant bacterial infection, the method comprising administering to a subject in need thereof a population of antibacterial protocells after diagnosing the existence of the disease state in the patient by comparing infected tissue from the patient to a standard. In alternative embodiments, the diagnostic method can be used at various times during therapy of an infected patient to measure the impact of the treatment on the progression of disease.
[0327] Pharmaceutical compositions comprise an effective population of MSNPs and/or protocells as otherwise described herein formulated to effect an intended result (e.g., immunogenic result, therapeutic result and/or diagnostic analysis, including the monitoring of therapy) formulated in combination with a pharmaceutically acceptable carrier, additive or excipient. The MSNPs and/or protocells within the population of the composition may be the same or different depending upon the desired result to be obtained. Pharmaceutical compositions may also comprise an additional bioactive agent or drug, such as an antiviral agent.
[0328] Generally, dosages and routes of administration of the compound are determined according to the size and condition of the subject, according to standard pharmaceutical practices. Dose levels employed can vary widely, and can readily be determined by those of skill in the art. Typically, amounts in the milligram up to gram quantities are employed. The composition may be administered to a subject by various routes, e.g., orally, transdermally, perineurally or parenterally, that is, by intravenous, subcutaneous, intraperitoneal, intrathecal or intramuscular injection, among others, including buccal, rectal and transdermal administration. Subjects contemplated for treatment according to the method include humans, companion animals, laboratory animals, and the like. The invention contemplates immediate and/or sustained/controlled release compositions, including compositions which comprise both immediate and sustained release formulations. This is particularly true when different populations of MSNPs and/or protocells are used in the pharmaceutical compositions or when additional bioactive agent(s) are used in combination with one or more populations of protocens as otherwise described herein.
[0329] Formulations containing the compounds may take the form of liquid, solid, semi-solid or lyophilized powder forms, such as, for example, solutions, suspensions, emulsions, sustained-release formulations, tablets, capsules, powders, suppositories, creams, ointments, lotions, aerosols, patches or the like, for example in unit dosage forms suitable for simple administration of precise dosages.
[0330] Pharmaceutical compositions typically include a conventional pharmaceutical carrier or excipient and may additionally include other medicinal agents, carriers, adjuvants, additives and the like. For example, the composition is about 0.1% to about 85%, about 0.5% to about 75% by weight of a compound or compounds, with the remainder consisting essentially of suitable pharmaceutical excipients.
[0331] An injectable composition for parenteral administration (e.g., intravenous, intramuscular or intrathecal) will typically contain the compound in a suitable i.v. solution, such as sterile physiological salt solution. The composition may also be formulated as a suspension in an aqueous emulsion.
[0332] Liquid compositions can be prepared by dissolving or dispersing the population of MSNPs and/or protocells (about 0.5% to about 20% by weight or more), and optional pharmaceutical adjuvants, in a carrier, such as, for example, aqueous saline, aqueous dextrose, glycerol, or ethanol, to form a solution or suspension. For use in an oral liquid preparation, the composition may be prepared as a solution, suspension, emulsion, or syrup, being supplied either in liquid form or a dried form suitable for hydration in water or normal saline.
[0333] For oral administration, such excipients include pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, talcum, cellulose, glucose, gelatin, sucrose, magnesium carbonate, and the like. If desired, the composition may also contain minor amounts of non-toxic auxiliary substances such as wetting agents, emulsifying agents, or buffers.
[0334] When the composition is employed in the form of solid preparations for oral administration, the preparations may be tablets, granules, powders, capsules or the like. In a tablet formulation, the composition is typically formulated with additives, e.g., an excipient such as a saccharide or cellulose preparation, a binder such as starch paste or methyl cellulose, a filer, a disintegrator, and other additives typically used in the manufacture of medical preparations.
[0335] Methods for preparing such dosage forms are known or is apparent to those skilled in the art; for example, see Remington's Pharmaceutical Sciences (17th Ed., Mack Pub. Co., 1985). The composition to be administered will contain a quantity of the selected compound in a pharmaceutically effective amount for therapeutic use in a biological system, including a patient or subject.
[0336] Methods of treating patients or subjects in need for a particular disease state or infection comprise administration an effective amount of a pharmaceutical composition comprising therapeutic MSNPs and/or protocells and optionally at least one additional bioactive (e.g., antibacterial or antiviral) agent.
[0337] Diagnostic methods may comprise administering to a patient in need an effective amount of a population of diagnostic MSNPs and/or protocels (e.g., MSNPs and/or protocells which comprise a target species, such as a targeting peptide which binds selectively to bacterially-infected cells and a reporter component to indicate the binding of the protocells) whereupon the binding of the MSNPs and/or protocels to cells as evidenced by the reporter component (moiety) will enable a diagnosis of the existence of a disease state in the patient.
[0338] An alternative of the diagnostic method may be used to monitor the therapy of a disease state in a patient, the method comprising administering an effective population of diagnostic MSNPs and/or protocels (e.g., MSNPs and/or protocels which comprise a target species, such as a targeting peptide which binds selectively to target cells and a reporter component to indicate the binding of the protocells to bacterially-infected cells if such cells are present) to a patient or subject prior to treatment, determining the level of binding of diagnostic protocells to target cells in said patient and during and/or after therapy, determining the level of binding of diagnostic protocels to target cells in said patient, whereupon the difference in binding before the start of therapy in the patient and during and/or after therapy will evidence the effectiveness of therapy in the patient, including whether the patient has completed therapy or whether the disease state has been inhibited or eliminated.
[0339] There may be employed conventional molecular biology, microbiology, and recombinant DNA techniques within the skill of the art. Such techniques are explained fully in the literature. See, e.g., Sambrook et al, 2001, Ausubel, ed., 1994, Coligan, ed., 1994, Hames & Higgins eds., 1985, Hames & Higgins, eds., 1984, Freshney, ed., 1986.
[0340] Any number of histone proteins, as well as other means to package the DNA into a smaller volume such as normally cationic nanoparticles, lipids, or proteins, may be used to package the supercoiled plasmid DNA histone-packaged supercoiled plasmid DNA, but in therapeutic aspects which relate to treating human patients, the use of human histone proteins are for example used. In certain aspects, a combination of human histone proteins H1, H2A, H2B, H3 and H4 in one embodiment ratio of 1:2:2:2:2, although other histone proteins may be used in other, similar ratios, as is known in the art or may be readily practiced pursuant to the teachings. The DNA may also be double stranded linear DNA, instead of plasmid DNA, which also may be optionally supercoiled and/or packaged with histones or other packaging components.
[0341] Other histone proteins which may be used in this aspect include, for example, H1F, H1FO, H1FNT, H1FOO, H1FX H1H1 HIST1H1A, HIST1H1B, HIST1H1C, HIST1H1D, HIST1H1E, HIST1H1T, H2AF, H2AFB1, H2AFB2, H2AFB3, H2AFJ, H2AFV, H2AFX, H2AFY, H2AFY2, H2AFZ, H2A1, HIST1H2AA, HIST1H2AB, HIST1H2AC, HIST1H2AD, HIST1H2AE, HIST1H2AG, HIST1H2AI, HIST1H2AJ, HIST1H2AK, HIST1H2AL, HIST1H2AM, H2A2, HIST2H2AA3, HIST2H2AC, H2BF, H2BFM, HSBFS, HSBFWT, H2B1, HIST1H2BA, HIST1HSBB, HIST1HSBC, HIST1HSBD, HIST1H2BE, HIST1H2BF, HIST1H2BG, HIST1H2BH, HIST1H2BI, HIST1H2BJ, HIST1H2BK, HIST1H2BL, HIST1H2BM, HIST1H2BN, HIST1H2BO, H2B2, HIST2H2BE, H3A1, HIST1H3A, HIST1H3B, HIST1H3C, HIST1H3D, HIST1H3E, HIST1H3F, HIST1H3G, HIST1H3H, HIST1H31, HIST1H3J, H3A2, HIST2H3C, H3A3, HIST3H3, H41, HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, HIST1H4E, HIST1H4F, HIST1H4G, HIST1H4H, HIST1H41, HIST1H4J, HIST1H4K, HIST1H4L, H44 and HIST4H4.
[0342] Proteins gain entry into the nucleus through the nuclear envelope. The nuclear envelope consists of concentric membranes, the outer and the inner membrane. These are the gateways to the nucleus. The envelope consists of pores or large nuclear complexes. A protein translated with a NLS will bind strongly to importin (aka karyopherin), and together, the complex will move through the nuclear pore. Any number of nuclear localization sequences may be used to introduce histone-packaged plasmid DNA into the nucleus of a cell. Exemplary nuclear localization sequences include H2N-GNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGC-COOH, RRMKWKK, PKKKRKV, and KR[PAATKKAGQA]KKKK (SEQ ID NOs:24-27), the NLS of nucleoplasmin, a prototypical bipartite signal comprising two clusters of basic amino acids, separated by a spacer of about 10 amino acids. Numerous other nuclear localization sequences are well known in the art. See, for example, LaCasse et al., (1995); Weis, (1998); and Murat Cokol et al., at the website ubic.bioc.columbia.edu/papers/2000 nls/paper.html#tab2.
[0343] A peptide nucleic acid can consist of repeating N-(2-aminoethyl)-glycine units linked by amide bonds. The purine (A, G) and pyrimidine (C, T) bases are attached to the backbone through methylene carbonyl linkages. Unlike DNA or DNA analogs. PNAs do not contain any (pentose) sugar moieties or phosphate groups. Surprisingly, PNA's in many respects mimic the behavior of DNA, and in some applications demonstrate superior properties. By convention, PNAs are depicted like peptides, with the N-terminus at the (left) position and the C-terminus at the right. Besides the obvious structural difference, PNA is set apart from DNA in that the backbone of PNA is acyclic, achiral and neutral. PNAs can bind to complementary nucleic acids in both antiparallel and parallel orientation. However, the antiparallel orientation is strongly in one embodiment, and the parallel duplex has been shown to have a different structure. Nielsen, et al., An Introduction to Peptide Nucleic Acid, Current Issues Molec. Biol. (1999) 1(2): 89-104.
[0344] A level and/or an activity and/or expression of a translation product of a gene and/or of a fragment, or derivative, or variant of said translation product, and/or the level or activity of said translation product, and/or of a fragment, or derivative, or variant thereof, can be detected using an immunoassay, an activity assay, and/or a binding assay. These assays can measure the amount of binding between said protein molecule and an anti-protein antibody by the use of enzymatic, chromodynamic, radioactive, magnetic, or luminescent labels which are attached to either the anti-protein antibody or a secondary antibody which binds the anti-protein antibody. In addition, other high affinity ligands may be used. Immunoassays which can be used include e.g. ELISAs, Western blots and other techniques known to those of ordinary skill in the art (see Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1999 and Edwards R, Immunodiagnostics: A Practical Approach, Oxford University Press, Oxford; England, 1999). All these detection techniques may also be employed in the format of microarrays, protein-arrays, antibody microarrays, tissue microarrays, electronic biochip or protein-chip based technologies (see Schena M., Microarray Biochip Technology, Eaton Publishing. Natick, Mass., 2000).
[0345] Certain diagnostic and screening methods utilize an antibody, for example, a monoclonal antibody, capable of specifically binding to a protein as described herein or active fragments thereof. The method of utilizing an antibody to measure the levels of protein allows for non-invasive diagnosis of the pathological states of kidney diseases. In one embodiment, the antibody is human or is humanized. In one embodiment, antibodies may be used, for example, in standard radioimmunoassays or enzyme-linked immunosorbent assays or other assays which utilize antibodies for measurement of levels of protein in sample. In a particular embodiment, the antibodies are used to detect and to measure the levels of protein present in a sample.
[0346] Humanized antibodies are antibodies, or antibody fragments, that have the same binding specificity as a parent antibody, (i.e., typically of mouse origin) and increased human characteristics. Humanized antibodies may be obtained, for example, by chain shuffling or by using phage display technology. For example, a polypeptide comprising a heavy or light chain variable domain of a non-human antibody specific for a disease related protein is combined with a repertoire of human complementary (light or heavy) chain variable domains. Hybrid pairings specific for the antigen of interest are selected. Human chains from the selected pairings may then be combined with a repertoire of human complementary variable domains (heavy or light) and humanized antibody polypeptide dimers can be selected for binding specificity for an antigen. Techniques described for generation of humanized antibodies that can be used in the method are disclosed in, for example, U.S. Pat. Nos. 5,565,332; 5,585,089; 5,694,761; and 5,693,762. Furthermore, techniques described for the production of human antibodies in transgenic mice are described in, for example, U.S. Pat. Nos. 5,545,806 and 5,569,825.
[0347] In order to identify small molecules and other agents useful in the present methods for treating an antibiotic resistant bacterial infection by modulating the activity and expression of a disease-related protein and biologically active fragments thereof can be used for screening therapeutic compounds in any of a variety of screening techniques. Fragments employed in such screening tests may be free in solution, affixed to a solid support, borne on a cell surface, or located intracellularly. The blocking or reduction of biological activity or the formation of binding complexes between the disease-related protein and the agent being tested can be measured by methods available in the art.
[0348] Other techniques for drug screening which provide for a high throughput screening of compounds having suitable binding affinity to a protein, or to another target polypeptide useful in modulating, regulating, or inhibiting the expression and/or activity of a disease, are known in the art. For example, microarrays carrying test compounds can be prepared, used, and analyzed using methods available in the art. See, e.g., Shalon, D. et al., 1995, International Publication No. WO95/35505, Baldeschweiler et al., 1995. International Publication No. WO95/251116; Brennan et al., 1995. U.S. Pat. No. 5,474,796; Heller et al., 1997, U.S. Pat. No. 5,605,662.
[0349] To determine specific binding, various immunoassays may be employed for detecting, for example, human or primate antibodies bound to the cells. Thus, one may use labeled anti-hlg, e.g., anti-hlgM, hlgG or combinations thereof to detect specifically bound human antibody. Various labels can be used such as radioisotopes, enzymes, fluorescers, chemiluminescers, particles, etc. There are numerous commercially available kits providing labeled anti-hlg, which may be employed in accordance with the manufacturers protocol.
[0350] In one embodiment, a kit can comprise: (a) at least one reagent which is selected from the group consisting of (i) reagents that detect a transcription product of the gene coding for a protein marker as described herein (ii) reagents that detect a translation product of the gene coding for proteins, and/or reagents that detect a fragment or derivative or variant of said transcription or translation product; (b) instructions for diagnosing, or prognosticating a disease, or determining the propensity or predisposition of a subject to develop such a disease or of monitoring the effect of a treatment by determining a level, or an activity, or both said level and said activity, and/or expression of said transcription product and/or said translation product and/or of fragments, derivatives or variants of the foregoing, in a sample obtained from said subject; and comparing said level and/or said activity and/or expression of said transcription product and/or said translation product and/or fragments, derivatives or variants thereof to a reference value representing a known disease status (patient) and/or to a reference value representing a known health status (control) and/or to a reference value; and analyzing whether said level and/or said activity and/or expression is varied compared to a reference value representing a known health status, and/or is similar or equal to a reference value representing a known disease status or a reference value; and diagnosing or prognosticating a disease, or determining the propensity or predisposition of said subject to develop such a disease, wherein a varied or altered level, expression or activity, or both said level and said activity, of said transcription product and/or said translation product and/or said fragments, derivatives or variants thereof compared to a reference value representing a known health status (control) and/or wherein a level, or activity, or both said level and said activity, of said transcription product and/or said translation product and/or said fragments, derivatives or variants thereof is similar or equal to a reference value and/or to a reference value representing a known disease stage, indicates a diagnosis or prognosis of a disease, or an increased propensity or predisposition of developing such a disease, a high risk of developing signs and symptoms of a disease.
[0351] Reagents that selectively detect a transcription product and/or a translation product of the gene coding for proteins can be sequences of various length, fragments of sequences, antibodies, aptamers, siRNA, microRNA, and ribozymes. Such reagents may be used also to detect fragments, derivatives or variants thereof.
[0352] Purely by way of example, comparing measured levels of an antibiotic-resistant bacterial infection biomarker in a sample to corresponding control levels, or comparing measured bacterial levels to control bacterial levels determined in a healthy control subject, and determining that a subject suffers from an antibiotic-resistant bacterial infection or that a subject's an antibiotic-resistant bacterial infection is progressing, can include determinations based on comparative level differences of about between about 5-10%, or about 10-15%, or about 15-20%, or about 20-25%, or about 25-30%, or about 30-35%, or about 35-40%, or about 40-45%, or about 45-50%, or about 50-55%, or about 55-60%, or about 60-65%, or about 65-70%, or about 70-75%, or about 75-80%, or about 80-85%, or about 85-90%, or about 90-95%, or about 95-100%, or about 100-110%, or about 110-120%, or about 120-130%, or about 130-140%, or about 140-150%, or about 150-160%, or about 160-170%, or about 170-180%, or about 180-190%, or 190-200%, or 200-210%, or 210-220%, or 220-230%, or 230-240%, or 240-250%, or 250-260%, or about 260-270%, or about 270-280%, or about 280-290%, or about 290-300%, or differences of about between about 50% to about 0.5%, or about 45% to about 1%, or about 40% to about 1.5%, or about 35% to about 2.0%, or about 30% to about 2.5%, or about 25% to about 3.0%, or about 20% to about 3.5%, or about 15% to about 4.0%, or about 10% to about 5.0%, or about 9% to about 1.0%, or about 8% to about 2%, or about 7% to about 3%, or about 6% to about 5%, or about 5%, or about 4.5%, or about 4.0%, or about 3.5%, or about 3.0%, or about 2.5%, or about 2.0%, or about 1.5%, or about 1.0%.
[0353] Non-limiting examples of moieties that target ephrin B2 and/or ephrin B3 include the ephrin B2-targeting peptide sequences identified in
[0354] Synergistic, High Concentration Drug Loaded Protocell Compositions
[0355] The present disclosure provides nanoparticles functionalized with a hydrophobic group and loaded with a water-insoluble cargo and protocells comprising such nanoparticles encapsulated by a lipid bilayer. The hydrophobic groups on and within the nanoparticles provide a favorable electrostatic environment for high-capacity loading of water-insoluble cargos, such as small-molecule drugs. In some embodiments, the nanoparticles or protocells further comprise a cell targeting species, which allows targeted delivery of the water-insoluble cargo.
[0356] Further provided herein are protocells comprising a cellular barrier penetrating moiety. Cellular barriers, such as the blood-brain barrier or nasal epithelium, limit the ability of orally, intranasally, or intravenously administered therapeutic agents from reaching targeted cells, resulting in subtherapeutic concentrations. By loading therapeutic agents into a protocell comprising a cellular barrier penetrating moiety, as described herein, therapeutic agents penetrate cellular barriers to deliver the cargo to the desired targeted cells. One example of a cellular barrier penetrating moiety is glutathione. For example, in some embodiments, a protocell comprising a cellular barrier penetrating moiety penetrates the blood-brain barrier for delivery to a cell within the central nervous system (CNS).
[0357] The following terms shall be used throughout the specification to describe the present invention. Where a term is not specifically defined herein, that term shall be understood to be used in a manner consistent with its use by those of ordinary skill in the art.
[0358] The examples herein provide various methodologies for obtaining protocells which are useful in the present invention. Useful general techniques include those described in Liu, et al., Chem. Comm., 5100-5102 (2009), Liu, et al., J. Amer. Chem. Soc., 131, 1354-1355 (2009), Liu, et al., J. Amer. Chem. Soc., 131, 7567-7569 (2009) Lu, et al., Nature, 398, 223-226 (1999), Ashley, et al., Nature Materials, 2011. May; 10(5):389-97, Lu, et al., Nature, 398, 223-226 (1999), and Caroll, et al., Langmuir, 25, 13540-13544 (2009).
[0359] Nanostructures include a core-shell structure which comprises a porous particle core surrounded by a shell of lipid for example a bilayer, but possibly a monolayer or multilayer (see Liu, et al., J. Amer. Chem. Soc., 131, 7567-7569 (2009)). The porous particle core can include, for example, a porous nanoparticle made of an inorganic and/or organic material as set forth above surrounded by a lipid bilayer.
[0360] The porous particle core of the protocells can be loaded with various desired species (cargo), including small molecules (e.g., anti-cancer, antibacterial and antiviral agents), large molecules (e.g., including macromolecules such as miRNA, siRNA or shRNA or a polypeptide which may include an anti-cancer, antibacterial and antiviral agent polypeptide or a reporter polypeptide (e.g., fluorescent green protein, among others), semiconductor quantum dots, or metallic nanoparticles, or metal oxide nanoparticles or combinations thereof). Protocefs can also be loaded with super-coiled plasmid DNA, which can be used to deliver a therapeutic and/or diagnostic peptide(s) or a small hairpin RNAlshRNA or small interfering RNA/siRNA, which can be used to inhibit expression of proteins associated with antibiotic resistance.
[0361] In some embodiments, protocells are comprised of a spherical mesoporous silica nanoparticlde (MSNP) core encased within a supported lipid bilayer (SLB). MSNPs have an extremely high surface area (>1200 m.sup.2/g), which enables high concentrations of various therapeutic and diagnostic agents to be adsorbed within the core by simple immersion in a solution of the cargo(s) of interest. Furthermore, since the aerosol-assisted evaporation-induced self-assembly (EISA) process we pioneered to synthesize MSNPs is compatible with a wide range of structure-directing surfactants and amenable to post-synthesis processing, the overall size can be varied from 20-nm to >10-m, the pore size can be varied from 2.5-nm to 50-nm, and the naturally negatively-charged pore walls can be modified with a variety of functional moieties, enabling facile encapsulation of physicochemically disparate molecules, including acidic, basic, and hydrophobic drugs, proteins, small interfering RNA, minicircle DNA vectors, plasmids, and diagnostic agents like quantum dots and iron oxide nanoparticles.
[0362] Protocells have a loading capacity of up to 60 wt % for small molecule drugs, which is 10-fold higher than other MSNP-based delivery vehicles and 1000-fold higher than similarly-sized liposomes. Release rates can be tailored by controlling the core's degree of silica condensation and, therefore, its dissolution rate under physiological conditions; thermal calcination maximizes condensation and results in particles with sustained release profiles (7-10% release per day for up to 2 weeks), while use of acidified ethanol to extract surfactants enhances particle solubility and results in burst release of encapsulated drugs (100% release within 12 hours). Liposome fusion to cargo-loaded MSNPs results in the formation of a coherent SLB that provides a stable, fluid, biocompatible interface for display of functional molecules, such as polyethylene glycol (PEG) and targeting ligands.
[0363] Protocells stably encapsulate small molecule drugs for up to 4 weeks when dispersed in complex biological fluids (e.g., complete growth medium and blood), regardless of whether the SLB is composed of lipids that are fluid or non-fluid at body temperature; in contrast, liposomes rapidly leak their encapsulated drugs, even when their bilayers are composed of fully saturated lipids, which have a high packing density and should, therefore, limit diffusion of drugs across the bilayer. The fluid, yet stable SLB enables us to achieve exquisitely high targeting specificities at low ligand densities, which, in turn, reduces immunogenicity and non-specific interactions; we have shown that protocells modified with an average of just 6 targeting peptides per particle have a 10,000-fold higher affinity for target cells than for non-target cells when the SLB is composed of the fluid, zwitterionic lipid, 1, 2-dioleoyl-sn-glycero-3-phosphocholine (DOPC).
[0364] Protocells are highly biocompatible and can be engineered for both broad distribution and persistence within target tissues. Balb/c mice injected intravenously (i.v.) with 200 mg/kg doses of PEGylated protocells three times each week for three weeks show no signs of gross or histopathological toxicity. Given their high loading capacity, this result indicates that protocells can deliver at least 900 mg/kg of therapeutic molecules with either burst or sustained release kinetics. Furthermore, PEGylated protocells 20-200 nm in diameter remain broadly distributed for 2-7 days when injected i.v., which provides a sufficient period of time for targeted protocells to accumulate within target tissues, where they can persist for up to 4 weeks with no adverse effects. Additionally, we and others have demonstrated that MSNPs are biodegradable and ultimately excreted in the urine and feces as silicic acid. Finally, we have shown that protocells modified with up to 10 wt % of targeting ligands induce neither IgG nor IgM responses when injected in C57Bl/6 mice at a total dose of 400 mg/kg. Depending upon the biodistribution required for a specific application, we can control the MSNP size and shape (spherical, disk-shaped, and rod-shaped(9) and the SLB charge and surface modification(s), making the protocell a highly modular, flexible nanoparticle delivery system.
[0365] Conventionally, a mesoporous nanoparticle has pores whose diameters range in size from about 2 nm to about 50 nm, a microporous nanoparticle has pores whose diameters are less than about 2 nm (often about 0.001 to about 2 nm) and a macroporous nanoparticle has pores whose diameters are from about 50 nm to about 100 nm. MSNPs can have both mesoporous, microporous and macroporous pores, but often have pores whose diameters range in size from about 2 nm to about 50 nm.
[0366] A nanoparticle may have a variety of shapes and cross-sectional geometries that may depend, in part, upon the process used to produce the particles. In one embodiment, a nanoparticle may have a shape that is a torus (toroidal). A nanoparticle may include particles having two or more of the aforementioned shapes. In one embodiment, a cross-sectional geometry of the particle may be one or more of toroidal, circular, ellipsoidal, triangular, rectangular, or polygonal. In one embodiment, a nanoparticle may consist essentially of non-spherical particles. For example, such particles may have the form of ellipsoids, which may have all three principal axes of differing lengths, or may be oblate or prelate ellipsoids of revolution. Non-spherical nanoparticles alternatively may be laminar in form, wherein laminar refers to particles in which the maximum dimension along one axis is substantially less than the maximum dimension along each of the other two axes. Non-spherical nanoparticles may also have the shape of frusta of pyramids or cones, or of elongated rods. In one embodiment, the nanoparticles may be irregular in shape. In one embodiment, a plurality of nanoparticles may consist essentially of spherical nanoparticles.
[0367] The MSNP size distribution depends on the application, but is principally monodisperse (e.g., a uniform sized population varying no more than about 5-20% in diameter, as otherwise described herein). The term monodisperse is used as a standard definition established by the National Institute of Standards and Technology (NIST) (Particle Size Characterization, Special Publication 960-1, January 2001) to describe a distribution of particle size within a population of particles, in this case nanoparticles, which particle distribution may be considered monodisperse if at least 90% of the distribution lies within 5% of the median size. See Takeuchi, et al., Advanced Materials, 2005, 17, No. 8, 1067-1072.
[0368] In certain embodiments, mesoporous silica nanoparticles can be range, e.g., from around 5 nm to around 500 nm (for example, about 50 nm to about 500 nm) in size, including all integers and ranges there between. The size is measured as the longest axis of the particle. In various embodiments, the particles are from around 10 nm to around 500 nm and from around 10 nm to around 100 nm in size. The mesoporous silica nanoparticles have a porous structure. The pores can be from around 1 to around 20 nm in diameter, including all integers and ranges there between. In one embodiment, the pores are from around 1 to around 10 nm in diameter. In one embodiment, around 90% of the pores are from around 1 to around 20 nm in diameter. In another embodiment, around 95% of the pores are around 1 to around 20 nm in diameter.
[0369] Exemplary MSNPs: are monodisperse and range in size from about 25 nm to about 300 nm; exhibit stability (colloidal stability); have single cell binding specification to the substantial exclusion of non-targeted cells; are neutral or cationic for specific targeting (for example, cationic); are optionally modified with agents such as PEI, NMe.sub.3.sup.+, dye, crosslinker, ligands (ligands provide neutral charge); and optionally, are used in combination with a cargo to be delivered to a targeted cell.
[0370] In certain embodiments, the MSNPs are monodisperse and range in size from about 25 nm to about 300 nm. The sizes used for example include 50 nm (+/10 nm) and 150 nm (+/15 nm), within a narrow monodisperse range, but may be more narrow in range. A broad range of particles is not used because such a population is difficult to control and to target specifically.
[0371] Illustrative examples of a cationic surfactant include, but are not limited to, cetyl trimethylammonium bromide (CTAB), dodecylethyldimethylammonium bromide, cetylpyridinium chloride (CPC), polyethoxylated tallow amine (POEA), hexadecyitrimethylammonium p-toluenesulfonate, benzalkonium chloride (BAC), or benzethonium chloride (BZT).
[0372] Poloxamers such as F127 are difunctional block copolymer surfactants terminating in primary hydroxyl groups. They are composed of a central hydrophobic chain of polyoxypropylene (poly(propylene oxide)) flanked by two hydrophilic chains of polyoxyethylene (poly(ethylene oxide)). Because the lengths of the polymer blocks can be customized, many different poloxamers exist having slightly different properties. For the generic term poloxamer, these copolymers are commonly named with the letter P (for poloxamer) followed by three digits, the first two digits.times.100 give the approximate molecular mass of the polyoxypropylene core, and the last digit.times.10 gives the percentage polyoxyethylene content (e.g., P407=Poloxamer with a polyoxypropylene molecular mass of 4,000 g/mol and a 70% polyoxyethylene content). For the Pluronic tradename, coding of these copolymers starts with a letter to define it's physical form at room temperature (L=liquid, P=paste, F=flake (solid)) followed by two or three digits, the first digit(s) refer to the molecular mass of the polyoxypropylene core (determined from BASF's Pluronic grid) and the last digit.times.10 gives the percentage polyoxyethylene content (e.g., F127 is a Pluronic with a polyoxypropylene molecular mass of 4,000 g/mol and a 70% polyoxyethylene content). In the example given, poloxamer 407 (P407) is Pluronic F127.
[0373] Exemplary ligands which may be used to target cells include peptides, affibodies and antibodies (including monoclonal and/or polyclonal antibodies). In certain embodiments, targeting ligands selected from the group consisting of Fc from human IgG (which binds to Fc receptors on macrophages and dendritic cells), human complement C3 (which binds to CR1 on macrophages and dendritic cells), ephrin B2 (which binds to EphB4 receptors on alveolar type II epithelial cells), and the SP94 peptide (which binds to unknown receptor(s) on hepatocyte-derived cells). Targeting ligands in certain aspects target T-Cell for therapy.
[0374] The charge is controlled based on what is to be accomplished (via PEI, NMe.sub.3.sup.+, dye, crosslinker, ligands, etc.), but for targeting the charge is for example cationic. Charge also changes throughout the process of formation. Initially the targeted particles are cationic and are often delivered as cationically charged nanoparticles, however post modification with ligands they are closer to neutral. The ligands which find use in the present invention include peptides, affibodies and antibodies, among others. These ligands are site specific and are useful for targeting specific cells which express peptides to which the ligand may bind selectively to targeted cells.
[0375] MSNPs may be used to deliver cargo to a targeted cell, including, for example, cargo component selected from the group consisting of at least one polynucleotide, such as double stranded linear DNA, minicircle DNA, naked DNA or plasmid DNA, messenger RNA, small interfering RNA, small hairpin RNA, microRNA, a polypeptide, a protein, a drug (in particular, an antibiotic drug), an imaging agent, or a mixture thereof. The MSNPs pursuant to the present invention are effective for accommodating cargo which are long and thin (e.g., naked) in three-dimensional structure, such as polynucleotides (e.g., various DNA and RNA) and polypeptides.
[0376] In protocells, a PEGylated lipid bi- or multilayer encapsulates a population of MSNPs as described herein and comprises (1) a PEGylated lipid which is optionally-thiolated (2) at least one additional lipid and, optionally (3) at least one targeting ligand which is conjugated to the outer surface of the lipid bi- or multilayer and which is specific against one or more receptors of a cell, e.g., a cancer cell.
[0377] Protocells are highly flexible and modular. High concentrations of physiochemically-disparate molecules can be loaded into the protocells and their therapeutic and/or diagnostic agent release rates can be optimized without altering the protocell's size, size distribution, stability, or synthesis strategy. Properties of the supported lipid bi- or multilayer and mesoporous silica nanoparticle core can also be modulated independently, thereby optimizing properties as surface charge, colloidal stability, and targeting specificity independently from overall size, type of cargo(s), loading capacity, and release rate.
[0378] Prophylactic administration is effective to reduce or decrease the likelihood of the subsequent occurrence of disease in the mammal, or decrease the severity of disease (inhibition) that subsequently occurs, especially including metastasis of cancer. Alternatively, compounds can, for example, be administered therapeutically to a mammal that is already afflicted by disease. In one embodiment of therapeutic administration, administration of the present compounds is effective to eliminate the disease and produce a remission or substantially eliminate the likelihood of metastasis of a cancer. Administration of the compounds is effective to decrease the severity of the disease or lengthen the lifespan of the mammal so afflicted, as in the case of cancer, or inhibit or even eliminate the causative agent of the disease, as in the case of hepatitis B virus (HBV) and/or hepatitis C virus infections (HCV) infections.
[0379] MSNPs and protocells can also be used to treat a wide variety of bacterial infections including, but not limited to, infections caused by bacteria selected from the group consisting of F. tularensis, B. pseudomallei, Mycobacterium, Staphylococcus, streptococcaceae, neisseriaceae, cocci, enterobacteriaceae, pseudomonadaceae, vibrionaceae, campylobacter, pasterellaceae, bordetella, francisella, brucella, legionellaceae, bacteroidaceae, gram-negative bacilli, clostridium, corynebacterium, propionibacterium, gram-positive bacilli, anthrax, actinomyces, nocardia, mycobacterium, treponema, borrelia, leptospira, mycoplasma, ureaplasma, rickettsia, chlamydiae and P. aeruginosa.
[0380] Antibiotic MSNPs and protocels can contain one or more antibiotics, e.g., Antibiotics include, but are not limited to, compositions selected from the group consisting of Gentamian, Kanamycin, Neomycin, Netilmicin, Tobramycin, Paromomycin, Spectinomycin, Geldanamycin, Herbimycin, Rifaximin, Streptomycin, Ertapenem, Doripenem, Imipenem/Cilastatin, Meropenem, Cefadroxil, Cefazolin, Cephalothin, Cephalexin, Cefador, Cefamandole, Cefoxitin, Cefprozil, Cefuroxime, Cefixime, Cefdinir, Cefditoren, Cefoperazone Cefotaxime, Cefpodoxime, Ceflazidime, Ceftibuten, Ceftizoxime Ceftriaxone, Cefepime, Ceftaroline fosamil, Ceflobiprole, Teicoplanin, Vancomyan, Telavancin, Daptomycin, Oritavancin, WAP-8294A, Azithromycin, Clarithromycin, Dirithromycin, Erythromycin, Roxithromyan, Telithromycin, Spiramycin, Clindamycin, Lincomycin, Aztreonam, Furazolidone, Nitrofurantoin, Oxazolidinones, Linezolid, Posizolid, Radezolid, Torezolid, Amoxicillin, Ampicillin, Azlocillin, Carbenicillin, Cloxacillin Dicloxacillin, Fludoxacillin, Mezlocillin, Methicillin, Nafcillin, Oxacillin, Penicillin G, Penicillin V, Piperacillin, Temocillin, Ticarcillin, Amoxicillin/clavulanate, Ampicillin/sulbactam, Piperacillin/tazobactam, Ticarcilin/lclavulanate, Bacitracin, Colistin, Polymyxin B, Ciprofloxacin, Enoxacin, Gatifloxacin, Gemifloxacin, Levofloxacin, Lomefloxacin, Moxifloxacin, Nalidixic acid, Norfloxacin, Ofloxacin, Trovafloxacin, Grepafloxacin, Sparfloxacin, Mafenide, Sulfacetamide, Sulfadiazine, Sulfadimethoxine, Sulfamethizole, Sulfamethoxazole, Sulfasalazine, Sulfisoxazole, Trimethoprim-Sulfamethoxazole, Sulfonamidochrysoidine, Demeclocycline, Doxycydine, Vibramycin Minocycline, Tigecycline, Oxytetracydine, Tetracycline, Clofazimine, Capreomycin, Cycloserine, Ethambutol, Rifampicin, Rifabutin, Rifapentine, Arsphenamine, Chloramphenicol, Fosfomycin, Fusidic acid, Metronidazole, Mupirocin, Platensimycin, Quinupristin/Dalfopristin, Thiamphenicol, Tigecycline and Tinidazole and combinations thereof.
[0381] The term anticancer agent shall include any chemotherapeutic agent. In some embodiments, such an agent is selected from the group consisting of microtubule-stabilizing agents, microtubule-disruptor agents, alkylating agents, antimetabolites, epipodophyllotoxins, antineoplastic enzymes, topoisomerase inhibitors, inhibitors of cell cycle progression, and platinum coordination complexes. In some embodiments, the anticancer agent is selected from the group consisting of everolimus, trabectedin, abraxane, TLK 286, AV-299, DN-101, pazopanib, GSK690693. RTA 744, ON 0910.Na, AZD 6244 (ARRY-142886), AMN-107. TKI-258, GSK461364, AZD 1152, enzastaurin, vandetanib. ARQ-197, MK-0457. MLN8054. PHA-739358, R-763, AT-9263, a FLT-3 inhibitor, a VEGFR inhibitor, an EGFR TK inhibitor, an aurora kinase inhibitor, a PIK-1 modulator, a BcI-2 inhibitor, an HDAC inhibitor, a c-MET inhibitor, a PARP inhibitor, a Cdk inhibitor, an EGFR TK inhibitor, an IGFR-TK inhibitor, an anti-HGF antibody, a PI3 kinase inhibitors, an AKT inhibitor, a JAK/STAT inhibitor, a checkpoint-1 or 2 inhibitor, a focal adhesion kinase inhibitor, a Map kinase kinase (mek) inhibitor, a VEGF trap antibody, pemetrexed, erlotinib, dasatanib, nilotinib, decatanib, panitumumab, amrubicin, oregovomab, Lep-etu, nolatrexed, azd2171, batabulin, ofatumumab, zanolimumab, edotecarin, tetrandrine, rubitecan, tesmilifene, oblimersen, ticilimumab, ipilimumab, gossypol, Bio 111, 131-I-TM-601, ALT-110, BIO 140, CC 8490, cilengitide, gimatecan, IL13-PE38QQR, INO 1001, IPdR, KRX-0402, lucanthone, LY 317615, neuradiab, vitespen, Rta 744, Sdx 102, talampanel, atrasentan, Xr 311, romidepsin, ADS-100380, sunitinib, 5-fluorouracil, vorinostat, etoposide, gemcitabine, doxorubicin, liposomal doxorubicin, 5-deoxy-5-fluorouridine, vincristine, temozolomide, ZK-304709, seliciclib, PD0325901, AZD-6244, capecitabine, L-glutamic acid, N-[4-[2-(2-amino-4,7-dihydro-4-oxo-1H-pyrrolo[2,3-d]pyrimidin-5-yl)ethyl]benzoyl]-, disodium salt, heptahydrate, camptothecin, PEG-labeled irinotecan, tamoxifen, toremifene citrate, anastrozole, exemestane, letrozole, DES(diethylstilbestrol), estradiol, estrogen, conjugated estrogen, bevacizumab, IMC-1C11, CHIR-258, 3-[5-(methylsulfonylpiperadinemethyl)-indolyl]-quinolone, vatalanib, AG-013736, AVE-0005, the acetate salt of [D-Ser(But)6, Azgly10] (pyro-Glu-His-Trp-Ser-Tyr-D-Ser(But)-Leu-Arg-Pro-Azgly-NH.sub.2 acetate [C.sub.59H.sub.84N.sub.18O.sub.14(C.sub.2H.sub.4O.sub.2)x where x=1 to 2.4]), goserelin acetate, leuprolide acetate, triptorelin pamoate, medroxyprogesterone acetate, hydroxyprogesterone caproate, megestrol acetate, raloxifene, bicalutamide, flutamide, nilutamide, megestrol acetate, CP-724714; TAK-165, HKI-272, erlotinib, lapatinib, canertinib, ABX-EGF antibody, erbitux, EKB-569, PKI-166, GW-572016, lonafamib, BMS-214662, tipifamib, amifostine. NVP-LAQ824, suberoyl anilide hydroxamic acid, valproic acid, trichostatin A, FK-228, SU11248, sorafenib, KRN951, aminoglutethimide, amsacrine, anagrelide, L-asparaginase, Bacillus Calmette-Guerin (BCG) vaccine, bleomycin, buserelin, busulfan, carboplatin, carmustine, chlorambucil, cisplatin, cladribine, dodronate, cyproterone, cytarabine, dacarbazine, dactinomycin, daunorubicin, diethylstilbestrol, epirubicin, fludarabine, fludrocortisone, fluoxymesterone, flutamide, gemcitabine, hydroxyurea, idarubicin, ifosfamide, imatinib, leuprolide, levamisole, lomustine, mechlorethamine, melphalan, 6-mercaptopurine, mesna, methotrexate, mitomycin, mitotane, mitoxantrone, nilutamide, octreotide, oxaliplatin, pamidronate, pentostatin, plicamycin, porfimer, procarbazine, raltitrexed, rituximab, streptozocin, teniposide, testosterone, thalidomide, thioguanine, thiotepa, tretinoin, vindesine, 13-cis-retinoic acid, phenylalanine mustard, uracil mustard, estramustine, altretamine, floxuridine, 5-deoxyuridine, cytosine arabinoside, 6-mercaptopurine, deoxycoformyan, calcitriol, valrubicin, mithramycin, vinblastine, vinorelbine, topotecan, razoxin, marimastat, COL-3, neovastat, BMS-275291, squalamine, endostatin, SU5416, SU6668, EMD121974, interleukin-12, IM862, angiostatin, vitaxin, droloxifene, idoxifene, spironolactone, finasteride, cimetidine, trastuzumab, denileukin diftitox, gefitinib, bortezomib, paditaxel, cremophor-free paclitaxel, docetaxel, epithilone B, BMS-247550, BMS-310705, 4-hydroxytamoxifen, pipendoxifene, ERA-923, arzoxifene, fulvestrant, acolbifene, lasofoxifene, TSE-424, HMR-3339, ZK186619, topotecan, PTK787/ZK 222584, VX-745, PD 184352, rapamycin, 40-O-(2-hydroxyethyl)-rapamycin, temsirolimus, AP-23573, RAD001, ABT-578, BC-210, LY294002, LY292223, LY292696. LY293684. LY293646, wortmannin, ZM336372, L-779,450, PEGfilgrastim, darbepoetin, erythropoietin, granulocyte colony-stimulating factor, zolendronate, prednisone, cetuximab, granulocyte macrophage colony-stimulating factor, histrelin, pegylated interferon alfa-2a, interferon alfa-2a, pegylated interferon alfa-2b, interferon alfa-2b, azacitidine, PEG-L-asparaginase, lenalidomide, gemtuzumab, hydrocortisone, interleukin-11, dexrazoxane, alemtuzumab, al-transretinoic acid, ketoconazole, interleukin-2, megestrol, immune globulin, nitrogen mustard, methylprednisolone, ibritumomab tiuxetan, androgens, decitabine, hexamethylmelamine, bexarotene, tositumomab, arsenic trioxide, cortisone, etidronate, mitotane, cydosporine, liposomal daunorubicin, Edwina-asparaginase, strontium 89, casopitant, netupitant, an NK-1 receptor antagonists, palonosetron, aprepitant, diphenhydramine, hydroxyzine, metoclopramide, lorazepam, alprazolam, haloperidol, droperidol, dronabinol, dexamethasone, methylprednisolone, prochlorperazine, granisetron, ondansetron, dolasetron, tropisetron, pegfilgrastim, erythropoietin, epoetin alfa and darbepoetin alfa, among others.
[0382] MSNPs and protocells can comprise anti-cancer agents selected from the group consisting of antimetabolites, inhibitors of topoisomerase I and II, alkylating agents and microtubule inhibitors, adriamycin; aldesleukin; alemtuzumab; alitretinoin; allopurinol; altretamine; amifostine; anastrozole; arsenic trioxide; Asparaginase; BCG Live; bexarotene capsules; bexarotene gel; bleomycin; busulfan intravenous; busulfan oral; calusterone; capecitabine; carboplatin; carmustine; carmustine with Polifeprosan 20 Implant; celecoxib; chlorambucil; cisplatin; dadribine; cyclophosphamide; cytarabine; dacarbazine; dactinomycin; actinomycn D; Darbepoetin alfa: daunorubicin liposomal; daunorubicin, daunomycin; Denileukin diftitox, dexrazoxane; docetaxel; doxorubicin; Dromostanolone propionate; Elliott's B Solution; epirubicin; Epoetin alfa estramustine; etoposide phosphate; etoposide (VP-16); exemestane; Filgrastim; floxuridine (intraarterial); fludarabine; fluorouracil (5-FU); fulvestrant; gemcitabine, gemtuzumab ozogamicin; goserelin acetate; hydroxyurea; Ibritumomab Tiuxetan; idarubicin; ifosfamide; imatinib mesylate; Interferon alfa-2a; Interferon alfa-2b; irinotecan; letrozole; leucovorin; levamisole; lomustine (CCNU); mechlorethamine (nitrogen mustard); megestrol acetate: melphalan (L-PAM); mercaptopurine (6-MP); mesna; methotrexate; methoxsalen; mitomycin C; mitotane; mitoxantrone; nandrolone phenpropionate; Nofetumomab; LOddC; Oprelvekin; oxaliplatin; paclitaxel; pamidronate; pegademase; Pegaspargase; Pegfilgrastim; pentostatin; pipobroman; plicamycin; mithramycin; porfimer sodium; procarbazine; quinacrine; Rasburicase; Rituximab: Sargramostim; streptozocin; talbuvidine (LDT); talc; tamoxifen; temozolomide; teniposide (VM-26); testolactone: thioguanine (6-TG); thiotepa; topotecan; toremifene; Tositumomab; Trastuzumab; tretinoin (ATRA); uracil mustard; valrubicin; valtorcitabine (monovalyl-LDC); vinblastine; vinorelbine; zoledronate; and mixtures thereof.
[0383] In certain embodiments, MSNPs and protocells comprise anti-cancer drugs selected from the group consisting of doxorubicin, melphalan, bevacizumab, dactinomycin, cyclophosphamide, doxorubicin liposomal, amifostine, etoposide, gemcitabine, altretamine, topotecan, cyclophosphamide, paclitaxel, carboplatin, cisplatin, and taxol.
[0384] MSNPs and protocells may include one or more antiviral agents to treat viral infections, especially including HIV infections, HBV infections and/or HCV infections. Exemplary anti-HIV agents include, for example, nucleoside reverse transcriptase inhibitors (NRTI), non-nucleoside reverse transcriptase inhibitors (NNRTI), protease inhibitors, fusion inhibitors, among others, exemplary compounds of which may include, for example, 3TC (Lamivudine), AZT (Zidovudine), ()-FTC, ddl (Didanosine), ddC (zalcitabine), abacavir (ABC), tenofovir (PMPA), D-D4FC (Reverset), D4T (Stavudine), Racivir, L-FddC, L-FD4C, NVP (Nevirapine), DLV (Delavirdine), EFV (Efavirenz), SQVM (Saquinavir mesylate). RTV (Ritonavir), IDV (Indinavir), SQV (Saquinavir), NFV (Nelfinavir), APV (Amprenavir), LPV (Lopinavir), fusion inhibitors such as T20, among others, fuseon and mixtures thereof, including anti-HIV compounds presently in clinical trials or in development. Exemplary anti-HBV agents include, for example, hepsera (adefovir dipivoxil), lamivudine, entecavir, telbivudine, tenofovir, emtricitabine, clevudine, valtorcitabine, amdoxovir, pradefovir, racivir, BAM 205, nitazoxanide, UT 231-B, Bay 41-4109, EHT899, zadaxin (thymosin alpha-1) and mixtures thereof. Anti-HCV agents include, for example, interferon, pegylated interferon, ribavirin, NM 283, VX-950 (telaprevir), SCH 50304, TMC435, VX-500, BX-813, SCH503034, R1626, ITMN-191 (R7227), R7128, PF-868554, TT033, CGH-759, GI 5005, MK-7009, SIRNA-034, MK-0608, A-837093, GS 9190, ACH-1095, GSK625433, TG4040 (MVA-HCV), A-831. F351, NS5A, NS4B, ANA598, A-689, GNI-104, IDX102, ADX184, GL59728, GL60667, PSI-7851, TLR9 Agonist, PHX1766, SP-30 and mixtures thereof.
[0385] Other illustrative therapeutic uses of the nanoparticles and protocells include embodiments in which: (a) the nanoparticle is loaded with the naked siRNA TD101 and the nanoparticle or protocell comprising the nanoparticle is useful in the treatment of Pachyonychia Congenita; or (b) the nanoparticle is loaded with the naked siRNA 15NP and the nanoparticle or protocell comprising the nanoparticle is useful in the treatment of delayed graft function associated with kidney transplant; or (c) the nanoparticle is loaded with the naked siRNA SYL040012 and the nanoparticle or protocel comprising the nanoparticle is useful in the treatment of glaucoma and/or ocular hypertension; or (d) the nanoparticle is loaded with the naked siRNA SYL1001 and the nanoparticle or protocell comprising the nanoparticle is useful in the treatment of dry eye syndrome; or (e) the nanoparticle is loaded with the naked siRNA Bevasiranib and the nanoparticle or protocell comprising the nanoparticle is useful in the treatment of Wet AMD or Diabetic AMD; or (f) the nanoparticle is loaded with the naked siRNA QPI-1007 and the nanoparticle or protocell comprising the nanoparticle is useful in the treatment of chronic optic nerve atrophy; or (g) the nanoparticle is loaded with the naked siRNA Sima-027/AGN211745 and the nanoparticle or protocell comprising the nanoparticle is useful in the treatment of AMD and CNV; or (h) the nanoparticle is loaded with the naked siRNA PF-655 and the nanoparticle or protocell comprising the nanoparticle is useful in the treatment of AMD/DME.
[0386] Other illustrative therapeutic uses of the nanoparticles and protocells include embodiments in which the nanoparticle is loaded with the siRNA siG12D and the protocell is useful in the treatment of pancreatic cancer. Other illustrative therapeutic uses of the nanoparticles and protocells include embodiments in which the nanoparticle is loaded with the siRNA TKM-PLK1 (PLK1 SNALP, TKM-080301) and the protocell is useful in the treatment of a solid tumor and primary and secondary liver cancer. Other illustrative therapeutic uses of the nanoparticles and protocells include embodiments in which the nanoparticle is loaded with siRNA (e.g., siRNA-EphA2-DOPC), and the protocell is adapted for the treatment of a solid tumor.
[0387] Other illustrative therapeutic uses of the nanoparticles and protocells include embodiments in which: (a) the nanoparticle is loaded with the aptamer C2 (2F RNA) and the protocell is useful in the treatment of leukemia cancer or a skin cancer; (b) the nanoparticle is loaded with the aptamer EpDT3 (2F RNA) and the protocell is useful in the treatment of colon cancer or breast cancer; (c) the nanoparticle is loaded with the aptamer PSM-A10 (2F RNA) and the protocell is useful in the treatment of prostate cancer: (d) the nanoparticle is loaded with the aptamer S6 (2F RNA) and the protocell is useful in the treatment of breast cancer, (e) the nanoparticle is loaded with the aptamer C1 (2F RNA) and the protocell is useful in the treatment of breast cancer; (f) the nanoparticle is loaded with the aptamer CL4 (2F RNA) and the protocell is useful in the treatment of breast cancer; (g) the nanoparticle is loaded with the aptamer YJ1 (2F RNA) and the protocell is useful in the treatment of metastatic colon cancer; (h) the nanoparticle is loaded with the aptamer Aptamer 14 (2F RNA) and the protocell is useful in the treatment of leukemia; (i) the nanoparticle is loaded with the aptamer C10 (DNA) and the protocell is useful in the treatment of Burkitt like lymphoma; (j) the nanoparticle is loaded with the aptamer Sgc8 (DNA) and the protocel is useful in the treatment of acute lymphoblastic leukemia; or (k) the nanoparticle is loaded with the aptamer TA6 (DNA) and the protocel is useful in the treatment of breast cancer, lymphoma and melanoma.
[0388] Typically pharmaceutical formulations and protocells can be loaded with cargo to a capacity up to about 10, 20, 30, 40, 50, 60, 70, 80 or about 90 weight % or more (or from about 0.01% to about 70%, about 0.02% to about 60%, about 0.2 to about 55%, about 0.5% to about 45%, about 1% to about 35%, about 1.5% to about 25%, about 0.1% to about 10%, about 0.01% to about 5%): defined as (cargo weight/weight of loaded protocell)100. The optimal loading of cargo is often about 0.01 to 60% but this depends on the drug or drug combination which is incorporated as cargo into the MSNPs. This is generally expressed in M per 10.sup.10 particles where we have values ranging from 2000-100 M per 10.sup.10 particles. For example, MSNPs exhibit release of cargo at pH about 5.5, which is that of the endosome, but are stable at physiological pH of 7 or higher (e.g., 7.4).
[0389] The surface area of the internal space for loading is the pore volume whose optimal value ranges from about 1.1 to 0.5 cubic centimeters per gram (cclg). Note that in the MSNPs according to one embodiment, the surface area is mainly internal as opposed to the external geometric surface area of the nanoparticle.
[0390] The lipid bi- or multilayer supported on the porous particle according to one embodiment has a lower melting transition temperature, i.e. is more fluid than a lipid bi- or multilayer supported on a non-porous support or the lipid bi- or multilayer in a liposome. This is sometimes important in achieving high affinity binding of immunogenic peptides or targeting ligands at low peptide densities, as it is the bilayer fluidity that allows lateral diffusion and recruitment of peptides by target cel surface receptors. One embodiment provides for peptides to cluster, which facilitates binding to a complementary target.
[0391] The lipid bi- or multilayer may vary significantly in composition. Ordinarily, any lipid or polymer which may be used in liposomes may also be used in MSNPs. For example, lipids are as otherwise described herein.
[0392] In some embodiments, the lipid bi- or multilayer of the protocells can provide biocompatibility and can be modified to possess targeting species including, for example, antigens, targeting peptides, fusogenic peptides, antibodies, aptamers, and PEG (polyethylene glycol) to allow, for example, further stability of the protocells and/or a targeted delivery into a cell to maximize an immunogenic response. PEG, when included in lipid bilayers, can vary widely in molecular weight (although PEG ranging from about 10 to about 100 units of ethylene glycol, about 15 to about 50 units, about 15 to about 20 units, about 15 to about 25 units, about 16 to about 18 units, etc., may be used) and the PEG component which is generally conjugated to phospholipid through an amine group comprises about 1% to about 20%, for example about 5% to about 15%, about 10% by weight of the lipids which are included in the lipid bi- or multilayer. The PEG component is generally conjugated to an amine-containing lipid such as DOPE or DPPE or other lipid, but in alternative embodiments may also be incorporated into the MSNPs, through inclusion of a PEG containing silane.
[0393] Numerous lipids which are used in liposome delivery systems may be used to form the lipid bi- or multilayer on nanoparticles. Virtually any lipid which is used to form a liposome may be used in the lipid bi- or multilayer which surrounds the nanoparticles according to an embodiment. For example, lipids for use in the present invention include, for example, 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC), 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC), 1,2-dioleoyl-sn-glycero-3-[phosphor-L-serine] (DOPS), 1,2-dioleoyl-3-trimethylammonium-propane (18:1 DOTAP), 1,2-dioleoyl-sn-glycero-3-phospho-(1-rac-glycerol) (DOPG), 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE), 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine (DPPE), 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene glycol)-2000] (18:1 PEG-2000 PE), 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene glycol)-2000] (16:0 PEG-2000 PE), 1-oleoyl-2-[12-[(7-nitro-2-1,3-benzoxadiazol-4-yl)amino]lauroyl]-sn-glycero-3-phosphocholine (18:1-12:0 NBD PC), 1-palmitoyl-2-{12-[(7-nitro-2-1,3-benzoxadiazol-4-yl)amino]lauroyl}-sn-glycero-3-phosphocholine (16:0-12:0 NBD PC), cholesterol and mixtures/combinations thereof. Cholesterol, not technically a lipid, but presented as a lipid for purposes of an embodiment given the fact that cholesterol may be an important component of the lipid bilayer of protocels according to an embodiment. Often cholesterol is incorporated into lipid bilayers of protocells in order to enhance structural integrity of the bilayer. These lipids are all readily available commercially from Avanti Polar Lipids, Inc. (Alabaster, Ala., USA). DOPE and DPPE are particularly useful for conjugating (through an appropriate crosslinker) PEG, peptides, polypeptides, including immunogenic peptides, proteins and antibodies, RNA and DNA through the amine group on the lipid.
[0394] MSNPs and protocells can be PEGylated with a variety of polyethylene glycol-containing compositions as described herein. PEG molecules can have a variety of lengths and molecular weights and include, but are not limited to, PEG 200, PEG 1000, PEG 1500, PEG 4600, PEG 10,000, PEG-peptide conjugates or combinations thereof.
[0395] Additional reporters include polypeptide reporters which may be expressed by plasmids (such as histone-packaged supercoiled DNA plasmids) and include polypeptide reporters such as fluorescent green protein and fluorescent red protein. Reporters pursuant to the present invention are utilized principally in diagnostic applications including diagnosing the existence or progression of a viral infection in a patient and or the progress of therapy in a patient or subject.
[0396] Pharmaceutical compositions comprise an effective population of MSNPs and/or protocells as otherwise described herein formulated to effect an intended result (e.g., immunogenic result, therapeutic result and/or diagnostic analysis, including the monitoring of therapy) formulated in combination with a pharmaceutically acceptable carrier, additive, or excipient. The MSNPs and/or protocells within the population of the composition may be the same or different depending upon the desired result to be obtained. Pharmaceutical compositions may also comprise an additional bioactive agent or drug, such as an antiviral agent.
[0397] Generally, dosages and routes of administration of the compound are determined according to the size and condition of the subject, according to standard pharmaceutical practices. Dose levels employed can vary widely, and can readily be determined by those of skill in the art. Typically, amounts in the milligram up to gram quantities are employed. The composition may be administered to a subject by various routes, e.g., orally, transdermally, perineurally or parenterally, that is, by intravenous, subcutaneous, intraperitoneal, intrathecal or intramuscular injection, among others, including buccal, rectal and transdermal administration. Subjects contemplated for treatment according to the method include humans, companion animals, laboratory animals, and the like. The invention contemplates immediate and/or sustained/controlled release compositions, including compositions which comprise both immediate and sustained release formulations. This is particularly true when different populations of MSNPs and/or protocells are used in the pharmaceutical compositions or when additional bioactive agent(s) are used in combination with one or more populations of protocels as otherwise described herein.
[0398] Formulations containing the compounds may take the form of liquid, solid, semi-solid or lyophilized powder forms, such as, for example, solutions, suspensions, emulsions, sustained-release formulations, tablets, capsules, powders, suppositories, creams, ointments, lotions, aerosols, patches or the like, for example in unit dosage forms suitable for simple administration of precise dosages.
[0399] Pharmaceutical compositions typically include a conventional pharmaceutical carrier or excipient and may additionally include other medicinal agents, carriers, adjuvants, additives and the like. For example, the composition is about 0.1% to about 85%, about 0.5% to about 75% by weight of a compound or compounds, with the remainder consisting essentially of suitable pharmaceutical excipients.
[0400] An injectable composition for parenteral administration (e.g., intravenous, intramuscular or intrathecal) will typically contain the compound in a suitable i.v. solution, such as sterile physiological salt solution. The composition may also be formulated as a suspension in an aqueous emulsion.
[0401] Liquid compositions can be prepared by dissolving or dispersing the population of MSNPs and/or protocells (about 0.5% to about 20% by weight or more), and optional pharmaceutical adjuvants, in a carrier, such as, for example, aqueous saline, aqueous dextrose, glycerol, or ethanol, to form a solution or suspension. For use in an oral liquid preparation, the composition may be prepared as a solution, suspension, emulsion, or syrup, being supplied either in liquid form or a dried form suitable for hydration in water or normal saline.
[0402] For oral administration, such excipients include pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, talcum, cellulose, glucose, gelatin, sucrose, magnesium carbonate, and the like. If desired, the composition may also contain minor amounts of non-toxic auxiliary substances such as wetting agents, emulsifying agents, or buffers.
[0403] When the composition is employed in the form of solid preparations for oral administration, the preparations may be tablets, granules, powders, capsules or the like. In a tablet formulation, the composition is typically formulated with additives, e.g., an exapient such as a saccharide or cellulose preparation, a binder such as starch paste or methyl cellulose, a filler, a disintegrator, and other additives typically used in the manufacture of medical preparations.
[0404] Methods for preparing such dosage forms are known or is apparent to those skilled in the art; for example, see Remington's Pharmaceutical Sciences (17th Ed., Mack Pub. Co., 1985). The composition to be administered will contain a quantity of the selected compound in a pharmaceutically effective amount for therapeutic use in a biological system, including a patient or subject.
[0405] Methods of treating patients or subjects in need for a particular disease state or infection comprise administration an effective amount of a pharmaceutical composition comprising therapeutic MSNPs and/or protocells and optionally at least one additional bioactive (e.g., antiviral) agent.
[0406] Intranasal (IN) delivery of broad-spectrum small molecule, nucleic acid, and antibody-based antivirals to central nervous system (CNS) tissues and cells infected with encephalitic New World alphaviruses (e.g., Venezuelan (VEEV), eastern (EEEV), and western (WEEV) equine encephalitis viruses) illustrates in one embodiment treatment modality.
[0407] Diagnostic methods comprise administering to a patient in need an effective amount of a population of diagnostic MSNPs and/or protocells (e.g., MSNPs and/or protocells which comprise a target species, such as a targeting peptide which binds selectively to viraly-infected cells and a reporter component to indicate the binding of the protocells) whereupon the binding of the MSNPs and/or protocells to cells as evidenced by the reporter component (moiety) will enable a diagnosis of the existence of a disease state in the patient.
[0408] An alternative of the diagnostic method may be used to monitor the therapy of a disease state in a patient, the method comprising administering to a patient an effective population of diagnostic MSNPs and/or protocells (e.g., MSNPs and/or protocells which comprise a target species, such as a targeting peptide which binds selectively to target cells and a reporter component to indicate the binding of the protocels to virally-infected cells if such cells are present) to a patient or subject prior to treatment, determining the level of binding of diagnostic protocells to target cells in said patient and during and/or after therapy, determining the level of binding of diagnostic protocells to target cells in said patient, whereupon the difference in binding before the start of therapy in the patient and during and/or after therapy wil evidence the effectiveness of therapy in the patient, including whether the patient has completed therapy or whether the disease state has been inhibited or eliminated.
[0409] There may be employed conventional molecular biology, microbiology, and recombinant DNA techniques within the skill of the art. Such techniques are explained fully in the literature. See, e.g., Sambrook et al, 2001, Molecular Cloning: A Laboratory Manual; Ausubel, ed., 1994. Current Protocols in Molecular Biology Volumes I-III; Celis, ed., 1994, Cell Biology: A Laboratory Handbook Volumes I-III; Coligan, ed., 1994, Current Protocols in Immunology Volumes I-III; Gait ed., 1984, Oligonucleotide Synthesis; Hames & Higgins eds., 1985, Nucleic Acid Hybridization; Hames & Higgins, eds., 1984, Transcription And Translation; Freshney, ed., 1986, Animal Cell Culture; IRL.
[0410] Any number of histone proteins, as well as other means to package the DNA into a smaller volume such as normally cationic nanoparticles, lipids, or proteins, may be used to package the supercoiled plasmid DNA histone-packaged supercoiled plasmid DNA, but in therapeutic aspects which relate to treating human patients, the use of human histone proteins are for example used. In certain aspects, a combination of human histone proteins H1. H2A, H2B, H3 and H4 in one embodiment ratio of 1:2:2:2:2, although other histone proteins may be used in other, similar ratios, as is known in the art or may be readily practiced pursuant to the teachings. The DNA may also be double stranded linear DNA, instead of plasmid DNA, which also may be optionally supercoiled and/or packaged with histones or other packaging components.
[0411] Other histone proteins which may be used in this aspect include, for example, H1F, H1F0, H1FNT, H1FOO, H1FX H1H1 HIST1H1A, HIST1H1B, HIST1H1C, HIST1H1D, HIST1H1E, HIST1H1T, H2AF, H2AFB1, H2AFB2, H2AFB3, H2AFJ, H2AFV, H2AFX, H2AFY, H2AFY2, H2AFZ, H2A1, HIST1H2AA, HIST1H2AB, HIST1H2AC, HIST1H2AD, HIST1H2AE, HIST1H2AG, HIST1H2AI, HIST1H2AJ, HIST1H2AK, HIST1H2AL, HIST1H2AM, H2A2, HIST2H2AA3, HIST2H2AC, H2BF, H2BFM, HSBFS, HSBFWT, H2B1, HIST1H2BA, HIST1HSBB, HIST1HSBC, HIST1HSBD, HIST1H2BE, HIST1H2BF, HIST1H2BG, HIST1H2BH, HIST1H2BI, HIST1H2BJ, HIST1H2BK, HIST1H2BL, HIST1H2BM, HIST1H2BN, HIST1H2BO, H2B2, HIST2H2BE, H3A1, HIST1H3A, HIST1H3B, HIST1H3C, HIST1H3D, HIST1H3E, HIST1H3F, HIST1H3G, HIST1H3H, HIST1H31, HIST1H3J, H3A2, HIST2H3C, H3A3, HIST3H3, H41, HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, HIST1H4E, HIST1H4F, HIST1H4G, HIST1H4H, HIST1H41, HIST1H4J, HIST1H4K, HIST1H4L, H44 and HIST4H4.
[0412] Proteins gain entry into the nucleus through the nuclear envelope. The nuclear envelope consists of concentric membranes, the outer and the inner membrane. These are the gateways to the nucleus. The envelope consists of pores or large nuclear complexes. A protein translated with a NLS will bind strongly to importin (aka karyopherin), and together, the complex will move through the nuclear pore. Any number of nuclear localization sequences may be used to introduce histone-packaged plasmid DNA into the nucleus of a cell. Exemplary nuclear localization sequences include H2N-GNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGC-COOH, RRMKWKK, PKKKRKV, and KR[PAATKKAGQA]KKKK (SEQ ID NOs:24-27), the NLS of nucleoplasmin, a prototypical bipartite signal comprising two clusters of basic amino acids, separated by a spacer of about 10 amino acids. Numerous other nuclear localization sequences are well known in the art. See LaCasse at al., (1995); Weis, (1998); and Murat Cokol at al. et al., (2000).
[0413] A peptide nucleic acid can consist of repeating N-(2-aminoethyl)-glycine units linked by amide bonds. The purine (A, G) and pyrimidine (C, T) bases are attached to the backbone through methylene carbonyl linkages. Unlike DNA or DNA analogs. PNAs do not contain any (pentose) sugar moieties or phosphate groups. Surprisingly, PNA's in many respects mimic the behavior of DNA, and in some applications demonstrate superior properties. By convention, PNAs are depicted like peptides, with the N-terminus at the (left) position and the C-terminus at the right. Besides the obvious structural difference, PNA is set apart from DNA in that the backbone of PNA is acyclic, achiral and neutral. PNAs can bind to complementary nucleic acids in both antiparallel and parallel orientation. However, the antiparallel orientation is strongly in one embodiment, and the parallel duplex has been shown to have a different structure. Nielsen, et al., An Introduction to Peptide Nucleic Acid, Current Issues Molec. Biol. (1999) 1(2): 89-104.
[0414] A level and/or an activity and/or expression of a translation product of a gene and/or of a fragment, or derivative, or variant of said translation product, and/or the level or activity of said translation product, and/or of a fragment, or derivative, or variant thereof, can be detected using an immunoassay, an activity assay, and/or a binding assay. These assays can measure the amount of binding between said protein molecule and an anti-protein antibody by the use of enzymatic, chromodynamic, radioactive, magnetic, or luminescent labels which are attached to either the anti-protein antibody or a secondary antibody which binds the anti-protein antibody. In addition, other high affinity ligands may be used. Immunoassays which can be used include e.g., ELISAs, Western blots and other techniques known to those of ordinary skill in the art (see Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1999 and Edwards R, Immunodiagnostics: A Practical Approach, Oxford University Press, Oxford; England, 1999). All these detection techniques may also be employed in the format of microarrays, protein-arrays, antibody microarrays, tissue microarrays, electronic biochip or protein-chip based technologies (see Schena M., Microarray Biochip Technology, Eaton Publishing. Natick, Mass., 2000).
[0415] Certain diagnostic and screening methods utilize an antibody, for example, a monoclonal antibody, capable of specifically binding to a protein as described herein or active fragments thereof. The method of utilizing an antibody to measure the levels of protein allows for non-invasive diagnosis of the pathological states of kidney diseases. In one embodiment, the antibody is human or is humanized. In one embodiment, antibodies may be used, for example, in standard radioimmunoassays or enzyme-linked immunosorbent assays or other assays which utilize antibodies for measurement of levels of protein in sample. In a particular embodiment, the antibodies are used to detect and to measure the levels of protein present in a sample.
[0416] Humanized antibodies are antibodies, or antibody fragments, that have the same binding specificity as a parent antibody, (i.e., typically of mouse origin) and increased human characteristics. Humanized antibodies may be obtained, for example, by chain shuffling or by using phage display technology. For example, a polypeptide comprising a heavy or light chain variable domain of a non-human antibody specific for a disease related protein is combined with a repertoire of human complementary (light or heavy) chain variable domains. Hybrid pairings specific for the antigen of interest are selected. Human chains from the selected pairings may then be combined with a repertoire of human complementary variable domains (heavy or light) and humanized antibody polypeptide dimers can be selected for binding specificity for an antigen. Techniques described for generation of humanized antibodies that can be used in the method are disclosed in, for example, U.S. Pat. Nos. 5,565,332; 5,585,089; 5,694,761; and 5.693,762. Furthermore, techniques described for the production of human antibodies in transgenic mice are described in, for example, U.S. Pat. Nos. 5,545,806 and 5,569,825.
[0417] In order to identify small molecules and other agents useful in the methods for treating a viral infection by modulating the activity and expression of a disease-related protein and biologically active fragments thereof can be used for screening therapeutic compounds in any of a variety of screening techniques. Fragments employed in such screening tests may be free in solution, affixed to a solid support, borne on a cell surface, or located intracellularly. The blocking or reduction of biological activity or the formation of binding complexes between the disease-related protein and the agent being tested can be measured by methods available in the art.
[0418] Other techniques for drug screening which provide for a high throughput screening of compounds having suitable binding affinity to a protein, or to another target polypeptide useful in modulating, regulating, or inhibiting the expression and/or activity of a disease, are known in the art. For example, microarrays carrying test compounds can be prepared, used, and analyzed using methods available in the art. See, e.g., Shalon, D. et al., 1995, International Publication No. WO95/35505, Baldeschweiler et al., 1995. International Publication No. WO95/251116; Brennan et al., 1995. U.S. Pat. No. 5,474,796; Heller et al., 1997, U.S. Pat. No. 5,605,662.
[0419] To determine specific binding, various immunoassays may be employed for detecting, for example, human or primate antibodies bound to the cells. Thus, one may use labeled anti-hlg, e.g., anti-hlgM, hlgG or combinations thereof to detect specifically bound human antibody. Various labels can be used such as radioisotopes, enzymes, fluorescers, chemiluminescers, particles, etc. There are numerous commercially available kits providing labeled anti-hlg, which may be employed in accordance with the manufacturers protocol.
[0420] In one embodiment, a kit can comprise: (a) at least one reagent which is selected from the group consisting of (i) reagents that detect a transcription product of the gene coding for a protein marker as described herein (ii) reagents that detect a translation product of the gene coding for proteins, and/or reagents that detect a fragment or derivative or variant of said transcription or translation product; (b) instructions for diagnosing, or prognosticating a disease, or determining the propensity or predisposition of a subject to develop such a disease or of monitoring the effect of a treatment by determining a level, or an activity, or both said level and said activity, and/or expression of said transcription product and/or said translation product and/or of fragments, derivatives or variants of the foregoing, in a sample obtained from said subject; and comparing said level and/or said activity and/or expression of said transcription product and/or said translation product and/or fragments, derivatives or variants thereof to a reference value representing a known disease status (patient) and/or to a reference value representing a known health status (control) and/or to a reference value; and analyzing whether said level and/or said activity and/or expression is varied compared to a reference value representing a known health status, and/or is similar or equal to a reference value representing a known disease status or a reference value; and diagnosing or prognosticating a disease, or determining the propensity or predisposition of said subject to develop such a disease, wherein a varied or altered level, expression or activity, or both said level and said activity, of said transcription product and/or said translation product and/or said fragments, derivatives or variants thereof compared to a reference value representing a known health status (control) and/or wherein a level, or activity, or both said level and said activity, of said transcription product and/or said translation product and/or said fragments, derivatives or variants thereof is similar or equal to a reference value and/or to a reference value representing a known disease stage, indicates a diagnosis or prognosis of a disease, or an increased propensity or predisposition of developing such a disease, a high risk of developing signs and symptoms of a disease.
[0421] Reagents that selectively detect a transcription product and/or a translation product of the gene coding for proteins can be sequences of various length, fragments of sequences, antibodies, aptamers, siRNA, microRNA, and ribozymes. Such reagents may be used also to detect fragments, derivatives or variants thereof.
[0422] Purely by way of example, comparing measured levels of a cancer, bacterial infection or viral infection biomarker (e.g., viral titer) in a sample to corresponding control levels, or comparing measured viral marker levels to control cancer, bacterial infection or viral marker levels determined in a healthy control subject, and determining that a subject suffers from a cancer, bacterial infection or viral infection or that a subject's cancer, bacterial infection or viral infection is progressing, can include determinations based on comparative level differences of about between about 5-10%, or about 10-15%, or about 15-20%, or about 20-25%, or about 25-30%, or about 30-35%, or about 35-40%, or about 40-45%, or about 45-50%, or about 50-55%, or about 55-60%, or about 60-65%, or about 65-70%, or about 70-75%, or about 75-80%, or about 80-85%, or about 85-90%, or about 90-95%, or about 95-100%, or about 100-110%, or about 110-120%, or about 120-130%, or about 130-140%, or about 140-150%, or about 150-160%, or about 160-170%, or about 170-180%, or about 180-190%, or 190-200%, or 200-210%, or 210-220%, or 220-230%, or 230-240%, or 240-250%, or 250-260%, or about 260-270%, or about 270-280%, or about 280-290%, or about 290-300%, or differences of about between about 50% to about 0.5%, or about 45% to about 1%, or about 40% to about 1.5%, or about 35% to about 2.0%, or about 30% to about 2.5%, or about 25% to about 3.0%, or about 20% to about 3.5%, or about 15% to about 4.0%, or about 10% to about 5.0%, or about 9% to about 1.0%, or about 8% to about 2%, or about 7% to about 3%, or about 6% to about 5%, or about 5%, or about 4.5%, or about 4.0%, or about 3.5%, or about 3.0%, or about 2.5%, or about 2.0%, or about 1.5%, or about 1.0%.
[0423] Protocells described herein are efficiently internalized by host cells, escape intracellular vesicles, and release encapsulated cargos in the cytosol of host cells. A number of factors govern cellular uptake and processing of nanoparticles, including their size, shape, surface charge, and degree of hydrophobicity. Additionally, a variety of molecules, including peptides, proteins, aptamers, and antibodies, can be employed to trigger active uptake by a plethora of specific cells. Incorporation of targeting and endosomolytic peptides that trigger endocytosis and endosomal escape on the protocell SLB enables cell-specific delivery and cytosolic dispersion of encapsulated cargos. SLB fluidity can be tuned to enable exquisite specific affinities for target cells at extremely low targeting ligand densities. In some embodiments, protocells have a sub-nanomolar specific affinity for a target cell. In some embodiments, the sub-nanomolar specific affinity requires about 6 targeting peptides per protocell. The SLB charge can be modulated to reduce non-specific interactions, resulting in protocells that are internalized by target cells 10,000-times more efficiently than non-target cells.
[0424] Endosomal escape of protocell-encapsulated cargo maximizes efficacy of the protocell delivery vehicles. Therefore, in some embodiments, the SLBs of protocell are modified with fusogenic peptides (e.g., R8 and H5WYG) that rupture the membranes of acidic intracellular vesicles via the proton sponge mechanism.
[0425] To confirm the safety of the protocells, the biocompatibility, biodegradability, and immunogenicity of the protocells after repeat intraperitoneal (IP) or subcutaneous (SC) injections in Balb/c and C57Bl/6 mice was evaluated. Balb/c mice injected IP with 200 mg/kg doses of DOPC protocells three times each week for 4 weeks showed no signs of gross or histopathological toxicity (see
[0426] The Biodistribution of Protocells can be Controlled by Tuning Their Hydrodynamic Size and Surface Modification with Targeting Ligands.
[0427] Liposomes and multilamellar vesicles, despite being more elastic that protocells, have biodistributions that are largely governed by their overall size and size distributions, an observation that holds true for protocells as well. The sizes of liposomes and multilamellar vesicles are difficult to control and subject to slight variations in lipid content, buffer pH and ionic strength, and chemical properties of cargo molecules, however. In contrast, the diameter of protocells is governed by the size of the MSNP, which, as we have previously described, is easy to precisely modulate. As demonstrated by
[0428] For example, modifying protocels with CD47, a molecule expressed by erythrocytes that innate immune cells recognize as self, substantially enhances their circulation half-life (see
[0429] A protocell comprises a nanoparticle core surrounded by a lipid bilayer. In some embodiments, the protocell comprises CD47 conjugated to the lipid bilayer. In some embodiments, the protocell comprises aminopeptidase P antibody conjugated to the lipid bilayer. In some embodiments, the protocell comprises Fc form conjugated to the lipid bilayer. In some embodiments, the Fc is Fc from IgG.
[0430] Protocels and nanoparticles Functionalized with Hydrophobic Groups and Loaded with Water-Insoluble Cargos.
[0431] In some embodiments, the nanoparticles described herein have an enhanced ability to bind water-insoluble cargos. In some embodiments, the water-insoluble cargo has a water solubility of less than about 5 mg/mL. In some embodiments, the water-insoluble cargo has a water solubility of less than about 0.5 mg/mL. In some embodiments, the water-insoluble cargo is a drug, for example an anticancer drug, an antiviral drug, or an antibiotic. In some embodiments, the weight ratio of cargo to silica is about 0.10 to about 0.75. In some embodiments, the nanoparticle comprises silica or metal oxide and is functionalized with a hydrophobic group and loaded with a water-insoluble cargo. In some embodiments, the nanoparticle is porous.
[0432] In some embodiments, the nanoparticles functionalized with a hydrophobic group as described herein comprise pores with a diameter of about 0.001 nm to about 100 nm, about 0.01 nm to about 50 nm, about 0.1 to about 100 nm, about 0.1 nm to about 35 nm, or about 0.2 nm to about 25 nm. In some embodiments, the nanoparticles functionalized with a hydrophobic group have a multimodal pore size distribution. In some embodiments, the nanoparticles functionalized with a hydrophobic group have a monomodal pore size distribution.
[0433] In some embodiments, the nanoparticles functionalized with a hydrophobic group as described herein have a diameter of about 5 nm to about 500 nm, about 10 nm to about 500 nm, about 25 nm to about 500 nm, about 50 nm to about 500 nm, about 50 nm to about 300 nm, or about 50 nm to about 150 nm. In some embodiments of the nanoparticles functionalized with a hydrophobic group, the nanoparticles have a pore volume fraction of about 25% to about 75%.
[0434] In some embodiments of the nanoparticles functionalized with a hydrophobic group as described herein, the hydrophobic group is a phenyl group or a methyl group. In some embodiments of the nanoparticles functionalized with a hydrophobic group, the nanoparticles are functionalized with a hydrophobic organosiloxane, for example hexamethyldisilazane (HDMS), sodium bis(trimethylsilyl)amide (NaHDMS), potassium bis(trimethylsilyl)amide(KHDMS), or phenyltriethoxysilane (PTS).
[0435] In some embodiments of the nanoparticles functionalized with a hydrophobic group as described herein, the nanoparticles have a surface area of about 50 m.sup.2/g to about 1500 m.sup.2/g, or about 100 m.sup.2/g to about 1300 m.sup.2/g.
[0436] In some embodiments of the nanoparticles functionalized with a hydrophobic group as described herein, the nanoparticle has a Zeta () potential of about 40 mV to about 0 mV. In some embodiments of the nanoparticles functionalized with a hydrophobic group, the nanoparticle is spherical or toroidal.
[0437] As described in further detail below and illustrated in
[0438] In some embodiments of the nanoparticles functionalized with a hydrophobic group as described herein, the nanoparticle is PEGylated by covalently attaching a PEG molecule to the surface of the nanoparticle. In some embodiments of the nanoparticles functionalized with a hydrophobic group as described herein, the nanoparticle is not PEGylated.
[0439] In some embodiments, a nanoparticle composition comprises a plurality of nanoparticles as described herein. In some embodiments, a nanoparticle composition comprises a plurality of nanoparticles functionalized with a hydrophobic group. In some embodiments of the nanoparticle composition, the nanoparticles are monodisperse. In some embodiments of the nanoparticle composition, the nanoparticles are polydisperse. In some embodiments of the nanoparticle composition, the average diameter of the nanoparticles about 25 nm to about 300 nm, or about 50 nm to about 150 nm.
[0440] In any embodiment of the nanoparticles functionalized with a hydrophobic group as described herein, the nanoparticles are coated with a lipid bilayer or a lipid multilayer. In some embodiments of a protocel as described herein, the protocell comprises a nanoparticle functionalized with a hydrophobic group as described herein coated with a lipid bilayer or multilayer.
[0441] In some embodiments of a protocell comprising a core functionalized with a hydrophobic group as described herein, the lipid bilayer or multilayer comprises 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC), 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC), 1,2-dioleoyl-sn-glycero-3-[phosphor-L-serine] (DOPS), 1,2-dioleoyl-3-trimethylammonium-propane (18:1 DOTAP), 1,2-dioleoyl-sn-glycero-3-phospho-(1-rac-glycerol) (DOPG), 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE), 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine (DPPE), 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene glycol)-2000] (18:1 PEG-2000 PE), 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene glycol)-2000] (16:0 PEG-2000 PE), 1-oleoyl-2-[12-[(7-nitro-2-1,3-benzoxadiazol-4-yl)amino]auroyl]-sn-glycero-3-phosphocholine (18:1-12:0 NBD PC), 1-palmitoyl-2-{12-[(7-nitro-2-1,3-benzoxadiazol-4-yl)amino]lauroyl}-sn-glycero-3-phosphocholine (16:0-12:0 NBD PC), or cholesterol. In some embodiments of a protocell comprising a core functionalized with a hydrophobic group as described herein, the lipid bilayer or multilayer comprises DOTAP, DOPG, DPPC, DOPE, or DOPC. In some embodiments of a protocell comprising a core functionalized with a hydrophobic group, the lipid bilayer or multilayer comprises DOPC and DOPE. In some embodiments of a protocell comprising a core functionalized with a hydrophobic group, the lipid bilayer or multilayer comprises DOPC and DOPG. In some embodiments of a protocell comprising a core functionalized with a hydrophobic group, the lipid bilayer or multilayer comprises cholesterol. In some embodiments of a protocell comprising a core functionalized with a hydrophobic group, the lipid bilayer or multilayer comprises DOPE, cholesterol, PEG-2000 PE (18:1), and an additional lipid selected from the group consisting of DOPC and DPPC.
[0442] In some embodiments of a protocell comprising a core functionalized with a hydrophobic group as described herein, the lipid bilayer or multilayer comprises a cell targeting species. The targeting species allows a protocell to be specifically directed to a targeted cell. Upon binding the targeted cell via the targeting species, the protocell is internalized by the cell. In some embodiments, the cell targeting species is a peptide, an antibody, an antibody fragment, an aptamer, an affibody, a carbohydrate, or functionalized cholesterol. In some embodiments, the targeting species is mannosylated cholesterol. In some embodiments of a protocell comprising a core functionalized with a hydrophobic group and a targeting species, the targeting species targets cancer cells.
[0443] In some embodiments of a protocell comprising a core functionalized with a hydrophobic group as described herein, the lipid bilayer or multilayer comprises a fusogenic peptide. Upon binding of the protocell to a targeted cell, the protocell is internalized by the targeted cell by endocytosis. Immediately after being internalized by a targeted cell, the protocell is located in the cellular endosome. The fusogenic peptide promotes endosomal escape, allowing the cargo to be released into the targeted cell.
[0444] In some embodiments of a protocell comprising a core functionalized with a hydrophobic group as described herein, the lipid bilayer or multilayer comprises PEG. In some embodiments, the targeting species or the fusogenic peptide is conjugated to the lipid bilayer via a PEG linkage. In some embodiments of a protocell comprising a core functionalized with a hydrophobic group, the lipid bilayer or multilayer does not comprise PEG.
[0445] In some embodiments of a protocell comprising a core functionalized with a hydrophobic group as described herein, the protocell has a diameter of about 50 nm to about 300 nm, or about 50 nm to about 150 nm. In some embodiments of a protocell comprising a core functionalized with a hydrophobic group, the protocell has a zeta potential of about 50 mV to about +50 mV.
[0446] In some embodiments of a protocell comprising a core functionalized with a hydrophobic group as described herein, the lipid bilayer is modified with glutathione. In some embodiments of a protocell comprising a core functionalized with a hydrophobic group as described herein, the protocell traverses a cellular barrier, such as the blood-brain barrier (BBB) or a nasal epithelium.
[0447] In some embodiments of a protocell comprising a core functionalized with a hydrophobic group as described herein, the lipid bilayer is conjugated to CD47. In some embodiments of a protocel comprising a core functionalized with a hydrophobic group, the lipid bilayer is conjugated to aminopeptidase P antibody. In some embodiments of a protocell comprising a core functionalized with a hydrophobic group, the protocell releases about 30% to about 100% of its cargo after three hours at pH 5. In some embodiments of a protocell comprising a core functionalized with a hydrophobic group, the protocell releases about 60% to about 100% of its cargo after six hours at pH 5. In some embodiments of a protocel comprising a core functionalized with a hydrophobic group, the protocel releases substantially all of its cargo after about twelve hours at about physiological pH. In some embodiments of a protocell comprising a core functionalized with a hydrophobic group, the protocell releases its cargo through sustained release at a rate of about 7 wt % to about 10 wt % cargo per day over a period of about ten days.
[0448] In some embodiments of a protocell comprising a core functionalized with a hydrophobic group as described herein, the lipid bilayer is conjugated to CD47. In some embodiments of a protocell comprising a core functionalized with a hydrophobic group, the lipid bilayer is conjugated to aminopeptidase P antibody.
[0449] In some embodiments of a protocell comprising a core functionalized with a hydrophobic group, the protocells do not stimulate an immune response after administration. In some embodiments of a protocell comprising a core functionalized with a hydrophobic group, the protocells do not stimulate an IgG or IgM response after administration.
[0450] Protocels that Traverse a Cellular Barrier
[0451] Many drug compounds demonstrate high potential in in vitro studies, but ultimately fail in vivo because of an inability to traverse a cellular barrier, such as the blood-brain barrier. For example, ribavirin does not readily cross the blood brain barrier when administered intravenously or orally, resulting in subtherapeutic concentration in the central nervous system (CNS). Therefore, there is a great need for nanoparticle delivery vehicles that are able to encapsulate multiple types of physicochemicaly disparate drugs in high concentrations, remain stable in blood and other complex biological fluids, and effectively penetrate the blood-brain barrier to target select cells in the CNS, and controllably release the encapsulated drugs into the cytosol of the targeted cells.
[0452] In some embodiments, protocells described herein traverse a cellular barrier, for example an endothelial cell barrier (such as the blood-brain barrier) or an epithelial cell barrier (such as the nasal epithelium). By traversing these cellular barriers, protocells accumulate in the central nervous system (CNS) in an increased concentration, thereby facilitating delivery of the protocel cargo to neurons or other CNS cells.
[0453] In some embodiments, the protocells comprise a silica or metal oxide nanoparticle core coated with a lipid bilayer or multilayer, the lipid bilayer or multilayer comprises a cellular barrier penetrating moiety. In some embodiments, the cellular barrier penetrating moiety is conjugated to the lipid bilayer or multilayer, for example via a PEG linkage. In some embodiments, the cellular barrier penetrating moiety is an endothelial cell barrier penetrating moiety. In some embodiments, the cellular barrier penetrating moiety is an epithelial cell barrier penetrating moiety. In some embodiments, the cellular barrier penetrating moiety is glutathione. In some embodiments, the cellular barrier penetrating moiety is L-dihydroxyphenylalanine (L-DOPA). In some embodiments, the cellular barrier penetrating moiety is an RGD (Arg-Gly-Asp) peptide or a peptide comprising an RGD sequence. The cellular barrier penetrating moieties attached to the lipid bilayer of the protocells enhance cellular transcytosis, increasing CNS penetration of the protocells.
[0454] In some embodiments of a protocell comprising a cellular barrier penetrating moiety as described herein, the nanoparticle core of the protocell is porous. In some embodiments of a protocell comprising a cellular barrier penetrating moiety, the nanoparticle core comprises pores with a diameter of about 1 nm to about 100 nm, about 1 nm to about 50 nm, about 1 nm to about 35 nm, or about 2 nm to about 25 nm. In some embodiments of a protocell comprising a cellular barrier penetrating moiety, the nanoparticle core has a monomodal pore size distribution. In some embodiments of a protocel comprising a cellular barrier penetrating moiety, the nanoparticle core has a multimodal pore size distribution. In some embodiments of a protocell comprising a cellular barrier penetrating moiety, the nanoparticle core has a pore volume fraction of about 25% to about 75%. In some embodiments of a protocell comprising a cellular barrier penetrating moiety, the nanoparticle core has a surface area of about 50 m.sup.2/g to about 1500 m.sup.2/g, or about 100 m.sup.2/g to about 1300 m.sup.2/g.
[0455] In some embodiments of a protocell comprising a cellular barrier penetrating moiety as described herein, the nanoparticle core has a diameter of about 5 nm to about 500 nm, about 25 nm to about 500 nm, about 50 nm to about 500 nm, about 50 nm to about 300 nm, or about 50 nm to about 150 nm.
[0456] In some embodiments of a protocell comprising a cellular barrier penetrating moiety as described herein, the nanoparticle core has a zeta () potential of about 50 mV to about +50 mV. In some embodiments of a protocell comprising a cellular barrier penetrating moiety as described herein, the nanoparticle core has a zeta () potential of about 40 mV to about 0 mV. In some embodiments of a protocell comprising a cellular barrier penetrating moiety, the nanoparticle core has a zeta (Q potential of about 0 mV to about +50 mV. In some embodiments of a protocell comprising a cellular barrier penetrating moiety, the protocell core has a zeta (0 potential of about 50 mV to about +50 mV.
[0457] In some embodiments of a protocell comprising a cellular barrier penetrating moiety as described herein, the nanoparticle core is loaded with a cargo. In some embodiments of a protocel comprising a cellular barrier penetrating moiety, the weight ratio of cargo to silica is about 0.10 to about 0.75. In some embodiments, the cargo is a small-molecule drug, such as an anticancer agent, an antiviral agent, or an antibiotic. In some embodiments, the cargo is a polynucleotide, such as DNA (for example, a plasmid or minicircle) or RNA (for example, mRNA, siRNA, or miRNA). In some embodiments, the cargo is a hydrophobic cargo. In some embodiments, the hydrophobic cargo has a water solubility of less than about 5 mg/ml, or less than about 0.5 mg/ml.
[0458] In some embodiments of a protocell comprising a cellular barrier penetrating moiety as described herein, the nanoparticle core is functionalized with a compound to adjust the zeta potential of the nanoparticle core. In some embodiments of a protocell comprising a cellular barrier penetrating moiety, the nanoparticle core is functionalized with a hydrophobic group. In some embodiments of a protocell comprising a cellular barrier penetrating moiety, the nanoparticle core is functionalized with a hydrophobic group and has a zeta potential of about 40 mV to about 0 mV. In some embodiments, the nanoparticle core is functionalized with a hydrophobic organosiloxane, such as hexamethyldisilazane (HDMS), sodium bis(trimethylsilyl)amide (NaHDMS), potassium bis(trimethylsilyl)amide (KHDMS), or phenyltriethoxysilane (PTS). In some embodiments of a protocel comprising a cellular barrier penetrating moiety as described herein, the nanoparticle core is functionalized with an amine-modified silane, such as a primary amine, a secondary amine a tertiary amine, each of which is functionalized with a silicon atom (2) a monoamine or a polyamine (3)N-(2-aminoethyl)-3-aminopropyltrimethoxysiane (AEPTMS) (4) 3-aminopropyltrimethoxysilane (APTMS) (5) 3-aminopropyltriethoxysilane (APTS) (6) an amino-functional trialkoxysilane, and (7) protonated secondary amines, protonated tertiary alkyl amines, protonated amidines, protonated guanidines, protonated pyridines, protonated pyrimidines, protonated pyrazines, protonated purines, protonated imidazoles, protonated pyrroles, and quatemary alkyl amines, or combinations thereof. In some embodiments of a protocell comprising a cellular barrier penetrating moiety as described herein, the nanoparticle core is functionalized with an amine-modified silane and has a zeta potential of about 0 mV to about +50 mV.
[0459] In some embodiments of a protocell comprising a cellular barrier penetrating moiety as described herein, the nanoparticle core is spherical or toroidal. In some embodiments of a protocell comprising a cellular barrier penetrating moiety, the nanoparticle is condensed by thermal calcination. In some embodiments of a protocell comprising a cellular barrier penetrating moiety, the surfactant has been removed from the nanoparticle core by an acidified C.sub.1-4 alcohol to reduce silica condensation.
[0460] In some embodiments of a protocell comprising a cellular barrier penetrating moiety as described herein, the nanoparticle is coated with a lipid bilayer. In some embodiments of a protocell comprising a cellular barrier penetrating moiety, the nanoparticle is coated with a lipid multilayer. In some embodiments of a protocell comprising a cellular barrier penetrating moiety as described herein, the lipid bilayer or lipid multilayer comprises lipids selected from the group consisting of 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC), 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC), 1,2-dioleoyl-sn-glycero-3-[phosphor-L-serine] (DOPS), 1,2-dioleoyl-3-trimethylammonium-propane (18:1 DOTAP), 1,2-dioleoyl-sn-glycero-3-phospho-(1-rac-glycerol) (DOPG), 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE), 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine (DPPE), 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene glycol)-2000] (18:1 PEG-2000 PE), 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene glycol)-2000] (16:0 PEG-2000 PE), 1-oleoyl-2-[12-[(7-nitro-2-1,3-benzoxadiazol-4-yl)amino]auroyl]-sn-glycero-3-phosphocholine (18:1-12:0 NBD PC), 1-palmitoyl-2-{12-[(7-nitro-2-1,3-benzoxadiazol-4-yl)amino]lauroyl}-sn-glycero-3-phosphocholine (16:0-12:0 NBD PC), and cholesterol. In some embodiments of a protocell comprising a cellular barrier penetrating moiety as described herein, the lipid bilayer or multilayer comprises DOTAP, DOPG, DPPC, DOPE, or DOPC. In some embodiments of a protocel comprising a cellular barrier penetrating moiety, the lipid bilayer or multilayer comprises DOPC and DOPE. In some embodiments of a protocell comprising a cellular barrier penetrating moiety, the lipid bilayer or multilayer comprises DOPC and DOPG. In some embodiments of a protocell comprising a cellular barrier penetrating moiety, the lipid bilayer or multilayer comprises cholesterol. In some embodiments of a protocell comprising a cellular barrier penetrating moiety, the lipid bilayer or multilayer comprises DOPE, cholesterol, PEG-2000 PE (18:1), and an additional lipid selected from the group consisting of DOPC and DPPC.
[0461] In some embodiments of a protocell comprising a cellular barrier penetrating moiety as described herein, the lipid bilayer or multilayer comprises a cell targeting species. The targeting species allows a protocell to be specifically directed to a targeted cell. Upon binding the targeted cell via the targeting species, the protocell is internalized by the cell. In some embodiments, the cell targeting species is a peptide, an antibody, an antibody fragment, an aptamer, an affibody, a carbohydrate, or functionalzed cholesterol. In some embodiments, the targeting species is mannosylated cholesterol. In some embodiments of a protocell comprising a cellular barrier penetrating moiety as described herein, the targeting species targets cancer cells. In some embodiments, protocells that are able to traverse a cellular barrier comprise a targeting species to target neurons. For example, in some embodiments, the targeting species comprises apolipoprotein E (ApoE), dihydrolipoic acid (DHLA), or a scFv against neural cell adhesion molecule 1 (NCAM1).
[0462] In some embodiments of a protocell comprising a cellular barrier penetrating moiety as described herein, the lipid bilayer or multilayer comprises a fusogenic peptide. Upon binding of the protocell to a targeted cell, the protocel is internalized by the targeted cell by endocytosis. Immediately after being internalized by a targeted cell, the protocell is located in the cellular endosome. The fusogenic peptide promotes endosomal escape, allowing the cargo to be released into the targeted cell.
[0463] In some embodiments of a protocell comprising a cellular barrier penetrating moiety as described herein, the lipid bilayer or multilayer comprises PEG. In some embodiments, the targeting species or the fusogenic peptide is conjugated to the lipid bilayer via a PEG linkage. In some embodiments of a protocell comprising a cellular barrier penetrating moiety as described herein, the lipid bilayer or multilayer does not comprise PEG.
[0464] In some embodiments of a protocell comprising a cellular barrier penetrating moiety as described herein, the protocell has a diameter of about 50 nm to about 300 nm, or about 50 nm to about 150 nm.
[0465] In some embodiments of a protocell comprising a cellular barrier penetrating moiety as described herein, the lipid bilayer is conjugated to CD47. In some embodiments of a protocell comprising a cellular barrier penetrating moiety as described herein, the lipid bilayer is conjugated to aminopeptidase P antibody. In some embodiments of a protocell comprising a cellular barrier penetrating moiety, the protocell releases about 30% to about 100% of its cargo after three hours at pH 5. In some embodiments of a protocell comprising a cellular barrier penetrating moiety, the protocell releases about 60% to about 100% of its cargo after six hours at pH 5. In some embodiments of a protocell comprising a cellular barrier penetrating moiety, the protocell releases substantially all of its cargo after about twelve hours at about physiological pH. In some embodiments of a protocell comprising a cellular barrier penetrating moiety, the protocell releases its cargo through sustained release at a rate of about 7 wt % to about 10 wt % cargo per day over a period of about ten days.
[0466] In some embodiments of a protocell comprising a cellular barrier penetrating moiety as described herein, the protocells do not stimulate an immune response after administration. In some embodiments of a protocel comprising a cellular barrier penetrating moiety, the protocells do not stimulate an IgG or IgM response after administration.
[0467] Exemplary Methods of Forming Protocells and Nanoparticles.
[0468] The nanoparticles as described herein are generally produced using aerosol-assisted evaporation-induced self-assembly (EISA) methods. In some embodiments, the EISA method comprises atomizing a nanoparticle precursor solution to produce droplets, and drying and heating the droplets to produce the nanoparticles. In some embodiments, the EISA method comprises forming an emulsion by combining an aqueous phase precursor solution and an oil phase precursor solution and heating the emulsion to produce the nanoparticles. To produce nanoparticles functionalized with hydrophobic groups, a hydrophobic siloxane is included in the any of the precursor solutions.
[0469] Cargo release rates can be controlled by altering the degree of silica condensation in the nanoparticle core. The cargo generally unloads during the dissolution of the nanoparticle core under physiological conditions, and the dissolution rate is determined by the degree of silica condensation. Thermal calcination of the nanoparticles maximizes condensation and results in particles with sustained release profiles (7-10% release per day for up to 2 weeks). In contrast, use of acidified ethanol to extract surfactants results in burst release of encapsulated cargos (100% release within 12 hours). Therefore, following the production of the nanoparticles, in some embodiments, the nanoparticles are thermally calcined. In some embodiments, surfactant is extracted from the nanoparticles using an acidified C.sub.1-4 alcohol.
[0470] In some embodiments, the EISA process for making nanoparticles comprises atomizing a nanoparticle precursor solution to generate droplets; and drying and heating the droplets, thereby evaporating solvent and increasing effective surfactant concentration. In some embodiments, the nanoparticle precursor solution comprises (1) a surfactant, (2) tetraethyl orthosilicate (TEOS) or tetramethyl orthosilicate (TMOS), (3) a C.sub.1-4 alcohol, such as ethanol, and (4) water. Optionally, a hydrophobic organosiloxane is included in the nanoparticle precursor solution. In some embodiments, following the formation of the nanoparticles, a cargo, such as a water-insoluble cargo, is added. In some embodiments, the surfactant in the nanoparticle precursor solution is below the critical micelle concentration of the surfactant.
[0471] In some embodiments, the surfactant comprises a cationic surfactant, such as a dodecylsulfate salt, a tetradecyl-trimethyl-ammonium salt, a hexadecyltrimethylammonium salt, an octadecyltrimethylammonium salt, a dodecylethyldimethylammonium salt, a cetylpyridinium salt, polyethoxylated tallow amine (POEA), hexadecyltrimethylammonium p-toluenesulfonate, a benzalkonium salt, a Brij surfactant, a poloxamer, and a benzethonium salt. Exemplary cationic surfactants includes benzethonium chloride, benzalkonium chloride, cetylpyndinium chloride, dodecylethyldimethylammonium bromide, octdadecyltrimethylammonium bromide, hexadecyltrimethylammonium bromide, tetradecyl-trimethyl-ammonium bromide, tetradecyl-trimethyl-ammonium chloride, sodium dodecylsulfate, lithium dodecylsulfate. Brij-56, Pluronic F108, and Pluronic P123. In some embodiments, the nanoparticle precursor solution further comprises urea, poly(propylene oxide) (PPO), poly(ethylene oxide) (PEO), polypropylene glycol acrylate (PPGA), or glycerol.
[0472] In another example of an EISA process, an emulsion is formed by combining a aqueous phase precursor solution and an oil phase precursor solution. Generally the oil phase and aqueous phase precursor solutions are combined at a volumetric ratio of about 1:2 to about 1:4 aqueous phase:oil phase. The aqueous phase precursor solution comprises (1) a first surfactant, (2) tetraethyl orthosilicate (TEOS) or tetramethyl orthosilicate (TMOS), (3) an acid, and (4) water. The oil phase precursor solution comprises a second surfactant and an oil, such as a C.sub.12-C.sub.20 alkane. Optionally, a hydrophobic organosiloxane is included in either the aqueous phase precursor solution or the oil phase precursor solution. The emulsion is then heated to generate the nanoparticles. Generally, the nanoparticles are separated from the remaining emulsion before being loaded with a cargo, such as a water-insoluble cargo. In some embodiments, the concentration of the first surfactant is above the critical micelle concentration of the surfactant in the aqueous phase precursor solution.
[0473] In some embodiments, the first surfactant is a cationic surfactant, such as sodium dodecylsulfate, lithium dodecylsulfate, a tetradecyl-trimethyl-ammonium salt, a hexadecyltrimethylammonium salt, an odadecyltrimethylammonium salt, a dodecylethyldimethylammonium salt, a cetylpyridinium salt, polyethoxylated tallow amine (POEA), hexadecyltrimethylammonium p-toluenesulfonate, a benzalkonium salt, or a benzethonium salt. Examples of the first surfactant include tetradecyl-trimethyl-ammonium bromide (C.sub.14TAB), tetradecyl-trimethyl-ammonium chloride, hexadecyltrimethylammonium bromide (C.sub.16TAB), octadecyitrimethylammonium bromide (C.sub.18TAB), dodecylethyldimethylammonium bromide (C.sub.12TAB), cetylpyridinium chloride (CPC), benzalkonium chloride (BAC), and benzethonium chloride (BZT). Generally, the second surfactant is a nonionic surfactant such as a poloxamer or a nonionic silicon-based surfactant. Exemplary second surfactants include a Brij surfactant, Pluronic F108, Pluronic P123, or ABIL EM 90.
[0474] In some embodiments, the optional hydrophobic organosiloxane is a methyl-containing organosiloxane or a phenyl-containing organosiloxane. Exemplary hydrophobic organosiloxanes include hexamethyldisilazane (HDMS), sodium bis(trimethylsilyl)amide (NaHDMS), potassium bis(trimethylsilyl)amide (KHDMS), or phenyltriethoxysilane (PTS).
[0475] After the nanoparticles are formed, for example by using the EISA methods described herein, the nanoparticles are loaded with a cargo before being surrounded by a lipid bilayer to form a protocell. Alternatively, the nanoparticle is simultaneously loaded with a cargo and surrounded by the lipid bilayer to form the protocell.
[0476] A nanoparticle composition as described herein comprises a plurality of nanoparticles. In some embodiments, the nanoparticle composition comprises a plurality of nanoparticle, wherein the nanoparticle comprise a silica or metal oxide, the nanoparticle being functionalized with a hydrophobic group and loaded with a water-insoluble cargo.
[0477] In some embodiments of a nanoparticle composition as described herein, the nanoparticle are monodisperse. In some embodiments of a nanoparticle composition as described herein, the nanoparticle are polydisperse. In some embodiments of a nanoparticle composition as described herein, the average diameter of the nanoparticle is about 25 nm to about 300 nm, or about 50 nm to about 150 nm.
[0478] A protocell composition as described herein comprises a plurality of protocells. In some embodiments, the protocell composition comprises a plurality of protocells, wherein the protocells comprise a silica or metal oxide nanoparticle core coated with a lipid bilayer or multilayer, wherein the lipid bilayer or multilayer comprises a cellular barrier penetrating moiety. In some embodiments, the protocell composition comprises a plurality of protocells, wherein the protocells comprise a silica or metal oxide nanoparticle core, the nanoparticle being functionalized with a hydrophobic group and loaded with a water-insoluble cargo, and a lipid bilayer surrounding the core.
[0479] In some embodiments of a protocell composition as described herein, the protocells are monodisperse. In some embodiments of a protocell composition as described herein, the protocells are polydisperse. In some embodiments of a protocell composition as described herein, the average diameter of the protocells is about 50 nm to about 300 nm, or about 50 nm to about 150 nm.
[0480] A pharmaceutical composition as described herein comprises a protocell composition as described herein or a nanoparticle composition as described herein. In some embodiments, the pharmaceutical composition comprises a pharmaceutically acceptable carrier, additive, or excipient. In some embodiments, the pharmaceutical composition is administered intranasally, intradermally, intramuscularly, intraosseously, intraperitoneally, intravenously, subcutaneously, or intrathecally.
[0481] In some embodiments, the pharmaceutical compositions described herein are used to treat a disease, such as cancer. In some embodiments, a method of treating a disease comprises administering to a patient a therapeutically effective amount of a pharmaceutical composition as described herein. In some embodiments, the disease is cancer. In some embodiments, the nanoparticles or protocells are loaded with an anticancer agent.
[0482] In some embodiments a kit comprises the pharmaceutical composition as described herein and instructions for use of the pharmaceutical composition. In some embodiments, an article of manufacture comprises a pharmaceutical composition as described herein in suitable packaging.
[0483] The invention is illustrated further in the following non-limiting Examples.
Example 1
Antiviral Protocells
[0484]
TABLE-US-00003 TABLE 1 Established design rules for the protocell platform. The MSNP and SLB properties that can be precisely controlled to tailor various protocell parameters are listed, along with the resulting biological effect(s). See Ashley et al. (2011) for further details. MSNP or SLB Property Protocell Parameter(s) Biological Effect(s) Size and Size Distribution Biodistribution, internalization Tailor the concentration of efficiency drugs(s) in specific organs, tissues, and/or cells MSNP Charge MSNP-SLB interactons Balance extracellular drug retention and intracellular drug release by optimizing SLB stability Pore Size Loading capacity, type(s) of Reduce dose by decreasing the cargo molecules that can be number of nanoparticles that loaded, release rates, SLB fluidity have to reach target site(s) in order to see an effect and/or by delivering drug cocktails Pore Chemistry Loading capacity, types(s) of Same as above cargo molecules that can be loaded Degree of Silica Framework Release rates, biodegradability Reduce the frequency and Condensation duration of treatment through optimized release profiles, enhance biocompatibility by ensuring nanoparticles and/or byproducts are benignly excreted SLB Charge Non-specific (vs. specific) uptake Maximize the concentration of drug(s) in target site(s) by decreasing non-specific interactions SLB Fluidity Mobility of targeting ligands, Maximize the concentration of specific binding affinities drug(s) in target site(s) by increasing specific interactions Thickness of Lipid Coating, Tailorable release rates under Balance extracellular drug Presence/Number of Intra- or various intracellular conditions retention and intracellular drug Interbilayer Bonds release by optimizing SLB stability Degree of PEGylation SLB stability, colloidal stability Maximize the concentrateion of drug(s) in target site(s) by minimizing unwanted cargo release; enhance biocompatibility by minimizing serum-induced aggregation Type and Density of Targeting Specific binding and uptake Maximize the concentration of Ligand(s) on SLB Surface drug(s) in target cell(s) to decrease dose and minimize off- target effects Incorporation of Cytosolic cargo delivery Tailor the concentration of Endo/Lyso/Phagosomolytic drug(s) in specific intracellular Peptides on the SLB locations .sup.As demonstrated by FIG. 9, DOPC protocells remain stable when dispersed in whole blood without being surface-modified with PEG; therefore, given the FDA's increasing concern about hypersensitivity reactions linked to repeat administration of PEG, it is important to note that PEGylation is not required to enhance the in vivo performance of protocells.
[0485] Table 1 lists the MSNP and SLB properties that can be controlled and how these properties can be used to tailor the in vitro and in vivo functionality of protocels. Below is a description how the design rules are applied to adapt protocells for high capacity loading and controlled release of various antivirals. In vitro data is provided that show protocells are able to selectively deliver smal molecule and nucleic acid-based antivirals to mammalian cells infected with a BSL-2 pseudotype of Nipah virus. Finally, in vivo data is provided that proves the protocells have tailorable biodistributions, cause neither gross nor histopathological toxicity, are readily degraded and excreted, and induce neither IgG nor IgM responses, even when modified with high densities of targeting peptides.
[0486] MSNPs with reproducible properties can be synthesized in a scalable fashion via Aerosol-Assisted Evaporation-Induced Self-Assembly (EISA). Aerosol-assisted evaporation-induced self-assembly.sup.16 is a robust, scalable process that we pioneered to synthesize spherical, well-ordered oxide nano- and microparticles with a variety of pore geometries and sizes (see
[0487] Aerosol-assisted EISA produces particles compatible with a variety of post-synthesis processing procedures, enabling the hydrodynamic size to be varied from 20-nm to >10-m and the pore walls to be modified with a wide range of functional moieties that facilitate high capacity loading of physicochemically disparate diagnostic and/or therapeutic molecules. Importantly, aerosol-assisted EISA produces MSNPs that can be easily dispersed in a variety of aqueous and organic solvents without any appreciable aggregation, which enables us to load drugs that have high and low solubility in water. Our MSNPs are also easily encapsulated within anionic, cationic, and electrically-neutral SLBs via simple liposome fusion. In contrast, prior MSNPs generated using solution-based techniques tend to aggregate when the pH or ionic strength of their suspension media changes (Liong et al., 2009), typically require complex strategies involving toxic solvents to form SLBs (Cauda et al., 2010; Schlobauer et al., 2012), and have maximum loading capacities of 1-5 wt % (Clemens et al., 2012), which, our MSNPs exceed by an order of magnitude.
[0488] Optimization of pore size and chemistry enables high capacity loading of physicochemically disparate antivirals, while optimization of silica framework condensation results in tailorable release rates.
[0489] Despite recent improvements in encapsulation efficiencies and serum stabilities, state-of-the-art liposomes, multilamellar vesicles, and polymeric nanoparticles still suffer from several limitations, including complex processing techniques that are highly sensitive to pH, temperature, ionic strength, presence of organic solvents, lipid or polymer size and composition, and physicochemical properties of the cargo molecule, al of which impact the resulting nanoparticle's size, stability, entrapment efficiency, and release rate. In contrast, MSNPs formed via aerosol-assisted EISA have an extremely high surface area (>1200 m.sup.2/g), which enables high concentrations of various therapeutic and diagnostic agents to be adsorbed within the core by simple immersion in a solution of the cargo(s) of interest. Furthermore, since aerosol-assisted EISA yields MSNPs that are compatible with a range of post-synthesis modifications, the naturally negatively-charged pore walls can be modified with a variety of functional moieties, enabling facile encapsulation of physicochemically disparate molecules, including acidic, basic, and hydrophobic drugs, proteins, small interfering RNA (siRNA), minicircle DNA vectors that encode small hairpin RNA (shRNA), plasmids, and diagnostic/contrast agents like quantum dots, iron oxide nanoparticles, gadolinium, and indium-111 (Ashley et al., 2012; Ashley at al., 2011).
[0490] The MSNPs and the protocells comprising such MSNPs described herein demonstrate high-capacity loading of effective antiviral agents. As demonstrated by
[0491] It is also important to note that the MSNPs and protocells comprising such MSNPs can be loaded with complex combinations of physicochemically disparate antivirals (e.g., three small molecule drugs in combination with five separate siRNAs), a capability other nanoparticle delivery vehicles typically do not possess. High loading capacities can be achieved for acidic, basic, and hydrophobic drugs, as well as small molecules and macromolecules by altering the solvent used to dissolve the drug prior to loading and by modulating the pore size and chemistry of the MSNP (see
[0492] Another unique feature of the MSNPs and the protocells comprising such MSNPs is that the rate at which encapsulated drug is released can be precisely modulated by varying the degree of silica framework condensation and, therefore, the rate of its dissolution via hydrolysis under physiological conditions (Ashley et al., 2011). As shown in
[0493] Fusion of Liposomes to Antiviral-Loaded MSNPs Creates a Coherent SLB that Enhances Colloidal Stability and Enables DH-Triggered Release.
[0494] Liposomes and multilamellar vesicles have poor intrinsic chemical stability, especially in the presence of serum, which decreases the effective concentration of drug that reaches target cells and increases the potential for systemic toxicity (Couvreur et al, 2006; Morilla et al., 2011). In contrast, lipid bilayers supported on MSNPs have a high degree of stability in neutral-pH buffers, serum-containing simulated body fluids, and whole blood (
[0495] Although protocells are highly stable under neutral pH conditions, the SLB can be selectively destabilized under conditions that simulate the interior volume of intracellular vesicles (e.g., endosomes, lysosomes, macropinosomes), which become acidified via the action of proton pumps. Specifically, DOPC SLBs are destabilized at pH 5.0, which exposes the MSNP core and stimulates its dissolution at a rate dictated by core's degree of silica condensation; DOPC protocells with MSNPs cores that have a low degree of condensation are, therefore, able to retain ribavirin at pH 7.4 but rapidly release it at pH 5.0 (see
[0496] Modifying the SLB with Targeting Ligands Promotes Efficient Uptake of Antiviral-Loaded Protocells by Model Host Cells, which Enables Efficacious In Vitro Inhibition of Viral Replication.
[0497] In order to inhibit the intracellular replication of viruses, nanoparticle delivery vehicles must be efficiently internalized by host cells, escape intracellular vesicles, and release encapsulated antivirals in the cytosol of host cells. A number of factors govern cellular uptake and processing of nanoparticles, including their size, shape, surface charge, and degree of hydrophobicity (Peer et al., 2007). Additionally, a variety of molecules, including peptides, proteins, aptamers, and antibodies, can be employed to trigger active uptake by a plethora of specific cells (Peer et al., 2007). We have previously shown that incorporation of targeting peptides and endosomolytic peptides enable cell-specific delivery and cytosolic dispersion of encapsulated cargos (Ashley et al., 2011). As importantly, we have shown that SLB fluidity can be tuned to enable exquisite (sub-nanomolar) specific affinities for target cells at extremely low targeting ligand densities (about 6 targeting peptides per protocell) and that SLB charge can be modulated to reduce non-specific interactions, resulting in protocels that are internalized by target cells 10,000-times more efficiently than non-target cells (Ashley et al., 2011).
[0498] The targeting specificity of protocels was used to deliver various types of antivirals to host cells in which numerous viruses replicate in vitro. For example, modifying DOPC protocells with peptides or scFvs that target ephrin B2, the cellular receptor for Nipah (NiV) and Hendra (HeV) viruses, triggers a 100-fold increase in their selective binding and internalization by ephrin B2-expressing cells (see
[0499] As demonstrated by
[0500] Since endosomal escape of protocell-encapsulated antivirals is critical to maximize efficacy, the SLBs of protocels used in these experiments were further modified with peptides (e.g., R8 and H5WYG) that rupture the membranes of acidic intracellular vesicles via the proton sponge mechanism; as shown in
[0501] Protocells are Biocompatible, Biodegradable, and Non-Immunogenic.
[0502] Several reasons support the observation that amorphous MSNPs have low toxicity profiles in vivo: (1) amorphous (i.e., non-crystalline) silica is accepted as Generally Recognized As Safe (GRAS) by the U.S. FDA; (2) recently, solid, dye-doped silica nanoparticles received approval from the FDA for targeted molecular imaging of cancer (Chen et al., 2011; He et al., 2009); (3) compared to solid silica nanoparticles, MSNPs exhibit reduced toxicity and hemolytic activity since their surface porosity decreases the contact area between surface silanol moieties and cell membranes (Zhang et al., 2012; Tam et al., 2013; Zhao et al., 2011); (4) the high internal surface area (>1000 m.sup.2/g) and ultra-thinness of the pore walls (<2-nm) enable MSNPs to dissolve, and soluble silica (e.g., silicic acid, Si(OH).sub.4) has extremely low toxicity (He et al., 2009; Lin et al., 2010); and (5) in the case of protocells, the SLB further reduces interactions between surface silanol moieties and cell membranes and confers immunological behavior comparable to liposomes (Ashley et al., 2011).
[0503] To confirm these predictions, the biocompatibility, biodegradability, and immunogenicity of protocells was evaluated after repeat intraperitoneal (IP) or subcutaneous (SC) injections in Balb/c and C57Bl/6 mice. Balb/c mice injected IP with 200 mg/kg doses of DOPC protocells three times each week for 4 weeks showed no signs of gross or histopathological toxicity (see
[0504] The Biodistribution of Protocells can be Controlled by Tuning their Hydrodynamic Size and Surface Modification with Targeting Ligands.
[0505] Since liposomes and multilamellar vesicles are the most similar nanoparticle delivery vehicles to protocels, every effort is made to benchmark the performance of protocells against the performance of lipid-based nanoparticles. Liposomes and multilamellar vesicles, despite being more elastic that protocels, have biodistributions that are largely governed by their overall size and size distributions (Sommerman, 1986), an observation that holds true for protocells as well. The sizes of liposomes and multilamellar vesicles are difficult to control and subject to slight variations in lipid content, buffer pH and ionic strength, and chemical properties of cargo molecules, however (Sommermon, 1986: Comiskey et al., 1990: Moon et al., 1998). In contrast, the diameter of protocells is governed by the size of the MSNP core, which, as we have previously described, is easy to precisely modulate (Ashley at al., 2011). As demonstrated by
[0506] For example, modifying 150-nm protocels with CD47, a molecule expressed by erythrocytes that innate immune cells recognize as self (Oldenborg et al., 2000), substantially enhances their circulation half-life (see
[0507] Optimization of the BBB Penetration Potential of Protocells Using an In Vitro Transwell Assay.
[0508] The preliminary data indicate that various parameters affect the BBB penetration potential of protocels, including their hydrodynamic size, surface charge, and surface modifications; as shown in
[0509] To assess penetration and antiviral delivery efficiency, a high-throughput transwell assay was used where cerebral microvessel endothelial (hCMEC/D3) cells (Weksler et al., 2013) are grown to confluence on collagen-coated, microporous, polycarbonate membranes and inserted into 12-well Costar Transwell plates. Various concentrations of ribavirin-loaded protocells were added to the apical or basolateral chamber, incubate the wells for 2 hours at 37 C., and inductively-coupled plasma mass spectrometry (ICP-MS) and HPLC were used to measure Si and ribavirin concentrations, respectively, in both chambers. Ribavirin was used in these studies since there is a fluorescence-based HPLC method to detect it in cell culture medium. Monolayers are co-dosed with lucifer yellow to ensure that the cells are not damaged during the course of the experiment. DLS, transmission electron microscopy (TEM), and UV-visible spectroscopy are used to characterize the size, charge, and loading capacity of protocels that cross the cel monolayer. hCMEC/D3 cells are used because they are robust, easy to grow, and better replicate the human BBB than other in vitro models (Weksler et al., 2013).
TABLE-US-00004 TABLE 2 Table 2. The pore-templating surfactant, mean hydrodynamic diameter, average surface charge, Brunauer-Emmett-Teller (BET) surface area, and Barrett-Joyner-Halenda (BJH) pore size of MSNPs synthesized using aerosol-assisted EISA. Mean diameter and average surface charge were measured in 1X PBS, pH 7.4. Mean Average BET BJH Diameter Surface Charge Surface Area Pore Size Sufactant (nm) (mV) (m.sup.2/g) (nm) CTAB 102 4 34 1080 48 2.5 0.1 F68 105 5 35 440 20 4.4 0.2 F127 125 6 30 240 11 7.9 0.4 F127 + FC-4 480 56 35 190 32 18-25
TABLE-US-00005 TABLE 3 Table 3: mAb's to Treat Arbovirus Infections as cited in Sautto et al., (2013). Target Cloning Neutralizing mAb Origin Reactivity protein Epitope strategy Format/isotype activity Reference 4.8A Human DENV1-4 E DII EBV IgG IC50(g/mL): [37] D11C transformation DENV1: 1.3 DENV2: >40 DENV3: 2.4 DENV4: >40 IC50 (g/mL): DENV1: 1.5 DENV2: 1.0 DENV3: 10.2 DENV4: 1.6 IC50(g/mL): DENV1: 1.5 DENV2: 0.2 DENV3: 0.5 DENV4: 2.7 2H12 Murine DENV1-4 E DIII Hybridoma lgG2b IC50 nM; [38] (AB from DENV1: 0.56-54 loop: BALB/C aa mouse DENV3: 29 immunized 314-317) with DENV4: 145 DENV2 E/DIII C9 Murine/ DENV2 E DIII Phage VH1/V1 PRNT 50 [39] chimeric display of 850 g/mL a chimeric murine hybridoma library 4E11 Murine DENV1-4 E DIII Hybridoma IgG2a/ IC50 [40] (strand A: (g/mL): 308, 312 DENV10.16 and DENV2: 0.13 strand G: DENV-3: 8 387, 389, DENV-4: 15 391) 4G2 Murine DENV1-4 E DII Hybridoma IgG PRNT50 [39] (fusion from (g/mL): loop) DENV2 E DENV2: 15 Immunized mice 9F12 Murine DENV1-4, E DIII (aa Hybridoma IgG1k DENV1- [41] WNV 305, 307, from 4PRNT50: 310, 330: BALB/C 2-10.sup.6- A strand mouse 2-10.sup.7 M and BC immunized loop) with DENV-2 E/DIII 2A10G6 Murine DENV1-4, E DII Hybridoma IgG1 PRNT50 [36] YFV, WNV, (Fusion from (g/mL): JEV, TBEV loop: aa BALB/C DENV1: 2 98-101) mouse DENV2: 1.5 immunized DENV3: 2.1 with DENV4: 1.8 inactivated YNF: 3.6 DENV2 WNV: 46 mAB11 Human DENV1-4, E DII Phage Fusion PRNT80 [42, 43] WNV, SLEV, (fusion display of protein (g/mL): YFV, JEV loop) human scFv-Fc WNV: 1.25 MVEV scFv DENV2: 6.25 E16 Murine WNV E DIII Hybridoma IgG2b/humanized PRNT50: [44, 45] (MGAWN1) (LR; aa from 4-18 ng 302-309) immunized PRNT90: mice with 53-297 ng WNV E 1A1D-2 Murine DENV1-3 E DIII Hybridoma IgG2a DENV2 [46, 47] (strand: aa from PRNT50: 307, 310 immunized 2.1 nM and 312) mice with different pH-treated virus 1F4 Human DENV1 E DI-DII Electrofusion IgG DENV1 IC50 [48] 2D22 DENV2 (virion) DIII of infected 0.11 g/mL 5J7 DENV3 DI-DII memory B DENV2 IC50 cells from 0.08 g/mL DENV- DENV3 IC50 immune 0.10 g/mL subjects with EBV E105 Murine DENV1 E DIII Hybridomas IgG PRNT50 [32] E106 (BC loop: derived DENV-1: 0.5-59.2 E111 G328, T329 from ng/mL and D330: C57BL/6 PRNT50 DE loop: IFN- R.sup./ DENV-1: 0.6-59.2 K361 E and mice ng/mL E362 K; FG infected PRNT50: loop: K385) with 3.8-25 DIII DENV1 g/mL [49] (BC loop: G328, T329 and D330: DE loop; K361 E and E362 K: FG loop: K385: A strand: S305, K307, E309, K310 and E311) DIII (CC loop) CF4374 Human WNV E DIII Phage VH2-05/VL1e PRNT50: [50] CR4353 display of VH3-30/Vk3- 0.18 g/mL scFv IgG A27 PRNT90: library 0.95 g/mL PRNT50: 0.026 g/mL PRNT90 36.4 g/mL 1A5 Chimpanzee DENV1-4, E DII Phage Humanized DENV1: 048 [51] WNV, JEV, (aa G106) display of IgG1 DENV2: 0.95 LGTV Fab library DENV3: 3.2 from DENV4: 4.3 DENV1-4 WNV/DEN infected V4: 3.8 chimpanzees JEV: 21 LGTV: 28 mAb11 Human DENV1-4, E DII scFv scFv-Fc PRNT80 [42, 43] WNV (fusion loop, library (g/mL): W101, G104, DENV2: 6.25 G106) WNV: 1.25 3B4C-4 Murine SLEV E 1a Hybridoma IgG SLEV [52, 53] 1B2C-5 SLEV 1b PRNT: <1.7 6B5A-2 SLEV 1c SLEV 4A4C-4 SLEV 1d PRNT: <1.7 1B5D-1 SLEV, 2 SLEV 2B5B-3 JEV 3 PRNT: 4.8 2B6B-2 SLEV, 4a SLEV 6B6C-1 JEV, 4b (in PRNT: 2.9 MVEV, DII) SLEV WNV, PRNT: <1.7 YFV SLEV All PRNT: 2.3 Flavivirus/ SLEV All PRNT: <1.7 Flavivirus SLEV PRNT: 2.3 A3 Chimpanzee JEV E2 DI Phage Humanized PRNT50 [54] B2 aa.K179 display 0.04-0.2 E3 DII Phage nM aa.I126 Display PRNT50 DIII Phage 0.02-2 nM aa.G132 display PRNT50 0.14-0.93 nM FabTJE12 Human JEV E N/A Phage Fab FRNT50 [55] B02 display 50.2 g/mL 5F10 Human CHIKV E2 Domain EBV IgG12 IC50 < [56] 8B10 Human CHIKV E1-E2 B transformation IgG1k 100 ng/mL E2 EBV IC50 < Domain A transformation 100 ng/mL CHK-152 Murine CHIKV E2 aa 59 Hybridoma IgG2c IC50 1-3 [57] ng/mL 11E7 Murine CCHFV Gn C-ter Hybridoma IgG PRNT80 [58] diluted 1/2560 4-39-CC Murine RVFV G2 Domain Hybridoma IgG PRNT80 [59] IV diluted 1/20480- 1/81920 2C9 Murine YFV E Hybridoma IgG2a PRNT90: [60] i/10.sup.4 17D 1/10.sup.5.2 Asibi 5A Human YFV E DI-DII Phage ScFv PRNT90: [61] 7A Display 0.1-0.3 R3(27) g/mL 13D6 Murine TBEV E DIII Hybridoma IgG/chimeric PRNT50: [62] 1.9 g/mL PRNT50: 4.5 g/mL IC50 1.9- 16.7 g/mL 3B4C-4 Murine VEEV E2 aa Hybridoma IgG/humanized PRNT70 [63] (Hy4-26C) 182-209 (g/mL) 39.4-125
Example 2
[0510] Bioinformatics to identify and analyze target bacterial genes and to design effector RNAs.
[0511] Commercially-available strains of Klebsiella pneumonia (Kpn) (ATCC No. BAA-2146) and MRSA (ATCC No. BAA-1556) can be used to identify and analyze target bacterial genes and related RNA. The -lactamase genes as well as single-gene determinants of resistance to other antibiotics can serve as suitable targets in the Kpn genome. Similar antibiotic resistance gene analyses can be performed for the MRSA strain. Genes that contribute to virulence (e.g., ETC produced by Kpn and hemolysin produced by MRSA), as well as direct bactericidal targets, such as RNA polymerase or gyrase can also serve as suitable targets. Once target genes are selected, the most vulnerable sites are identified. Several recent discoveries have illuminated the multiple regulatory mechanisms of small RNAs in bacteria, which have been found to directly induce degradation of target mRNAs and to inhibit translation of mRNAs by targeting the ribosome-binding site (RBS) (Gottesman and Storz, 2010). Assess the secondary structure of the RBS and other potential sites in target mRNAs, since single-stranded loops or segments in mRNAs are typically the first contact points with effector RNAs. Recent studies have also shown that transformation of bacteria with plasmids that encode full-length antisense RNAs (i.e., RNAs that are antisense along the full length of the target mRNA) effectively knocks down gene activity. Explore both natural and full-length antisense models.
[0512] When designing effector RNAs, limit nuclease degradation by including nuclease-protective secondary structures and/or unnatural backbones, such as those found in peptide nucleic acids (PNAs). Maximize gene knockdown by engineering antisense RNA to: (1) promote binding by the protein, Hfq, which is known to activate a number of small bacterial regulatory RNAs or (2) drive the formation of a loop-loop kissing complex between antisense RNA and target mRNA, which will result in full pairing between effector and target. Assess potential off-target effects by screening candidate RNAs against the human (or mouse) genome.
[0513] Multiple target/effector pairs are designed for each gene or, in the case of multi-locus traits like -lactamase resistance, for each component locus. Antisense RNAs must be amenable to being assembled into PNAs. Our approach enables delivery of multiple RNAs simultaneously, such that multiple designs for targeting a given gene can be tested as a pool. Only one member of the pool need be effective, and this member can be identified in subsequent tests. Identify surface molecules on MRSA and Kpn that are conserved across most strains (AxioMx, Branford, Conn, automated phage display screening method can be used to develop targeting ligands that bind to these surface molecules with high affinity). Resulting targeting ligands are conjugated to PNA-loaded protocells to promote concentration of protocells at the sites of MRSA or Kpn infection.
[0514] Results
[0515] Identifying target antibiotic resistance genes.
[0516] To combat antibiotic resistance gene it is first essential to identify the target genes. An emerging pathogen of the Carbapenem-Resistant Enterobacteriaceae (CRE group), Klebsiella pneumoniae ATCC 2146 (Kpn2146), was selected. This strain was resistant to all 34 antibiotics tested at ATCC, and known to carry the carbapenemase gene blaNDM-1. A partial genome sequence (Kim at al., 2013) was inadequate for evaluating the antibiotic resistance gene repertoire. The genome was completed by preparing a Pacific Biosciences sequence dataset (PacBio) and using this data to connect the contigs in the partial genome, yielding five circular replicons: a chromosome and four plasmids (Hudson et al., 2014).
[0517] ATCC has reported resistance of Kpn2146 to each of the 34 antimicrobial and antimicrobial/inhibitor combinations tested, including tests for 23 -lactams (penicillin with or without inhibitors, cephalosporins, carbapenems and aztreonam), five fluoroquinolones, three aminoglycosides (tobramycin, amikacin and gentamicin), and four others (tetracycline, tigecydine, nitrofurantoin, and trimethoprim/sulfamethoxazole); see http://www.atcc.org//media/BA6C8F7C7C4C4649B2AEF501E51 D76B8.ashx for the full list. Kpn2146 resistance genes have also been surveyed with a combination of microarray and amplicon sequencing. The genome sequence fully rationalized the resistance profile, with ample evidence for one or more mechanisms explaining each observed antibiotic-resistance, and supported the gene survey. It further identified previously untested genes (like qnrB9), allelic multiplicity (aac(6)-Ib, sul1, bla.sub.SHV-11 and bla.sub.CTM-M-15) and location (plasmid vs. chromosome), as well as housekeeping gene mutations (Table 4). These gene duplications can increase resistance; duplication of bla.sub.SHV-11 has been shown to increase amoxicillin-resistance 16-fold.
[0518] Eight genes for -lactamases representing all four Ambler classes were identified; together these explain the broad -lactam and inhibitor resistance of Kpn2146. We further identified specific resistance genes for tetracycline, trimethoprim, sulfonamides, macrolides, and multiple aminoglycoside resistance genes, including three aac(6)-Ib variants, one shown to confer additional low-level resistance to quinolones in addition to the usual spectrum of aminoglycosides inactivated by AAC(6)-Ib which includes tobramycin, amikacin, and gentamicin C1a and C2.
[0519] The complete genome also reveals certain housekeeping gene mutations that are related to drug resistances. For example, the GyrA Ser83>11e and ParC Ser80>11e combination has previously been found in K. pneumoniae isolates with high-level resistance to several fluoroquinolones. QnrB9 of Kpn2146, like other plasmid-encoded quinolone resistance enzymes, confers low-level resistance to fluoroquinolones, and may facilitate selection of mutations in gyrA and parC associated with high-level resistance. A frameshift mutation in the nitroreductase gene nfsA is likely responsible for the observed resistance to nitrofurantoin.
[0520] The above observations explain the entire known resistance profile, except the tigecycline resistance. Mechanisms previously suggested for tigecycline resistance are mutations in the gene for the ribosomal protein S10 (Kpn2146 has the wild type allele) and mutations increasing the expression of the AcrAB/TolC efflux system. One mutation class causing overexpression of this efflux system is inactivation of its repressor RamR; Kpn2146 has such a ramR disruption (insertion of ISKpn18) that can thereby explain the observed tigecydine resistance. Additional efflux systems (Table 4), such as the macrolide-specific efflux system MacAB/TolC, may contribute to the intrinsic spectrum of resistance, especially if overexpressed.
[0521] An early nonsense mutation that disrupts the porin gene ompK35 was detected, fitting with many ESBL-producing K. pneumoniae strains that lack OmpK35. The concomitant loss of OmpK36 that significantly decreases susceptibility for meropenem and several cephalosporin -lactams was not observed: ompK36 and ompK37 appear to be intact. In a recently reported Klebsiella carbapenem resistance mode, the marR regulatory gene is inactivated and the yedS porin gene is active; this mode is unlikely to pertain here since marR is intact and yedS is lacking in Kpn2146.
[0522] One third of the antibiotic resistance enzyme genes listed in Table 4, including all three of the aac(6)-Ib alleles, are associated with five scattered class 1 integrons or integron fragments. Four of these are on plasmids, often within recognizable fragments of transposons, and the fifth is within a genomic island on the chromosome. We discuss below a case of cassette swapping where comparative analysis suggests the swap may have been mediated by homologous recombination rather than class 1 integron integrase action.
TABLE-US-00006 TABLE 4 Enzymes, efflux pumps, and mutations expected to confer resistance to antibiotics of clinical relevance.sup.a Enzyme.sup.b Gene locations(s) Coordinates Resistance phenotype NDM-1 (class pNDM = US Tn125 122191-123003 Penicillins, cephalosporins, B) carbapenems, inhibitor-resistant SHV-11 (class 1. pKpn2146b 36313-37173 Penicillins, some A).sup.c 2. Chromosome 2612996-2613856 cephalosporins, inhibitor- sensitive CTX-M-15 1. pKpN2146b 47130-48005 Penicillins, some (class A) ISEcp1 cephalosporins, aztreonam, 2. Chromosome 5407530-5408405 inhibitor-sensitive ISEcp1 TEM-1 (class pKpn2146b Tn2 50827-51687 Penicillins, some A) cephalosporins, inhibitor- sensitive CMY-6 (class pNDM-US ISEcp1 72203-73348 Penicillins, some C) cephalosporins, inhibitor- resistant OXA-1 (class pKpn2146b In37 38798-39673 Penicillins, inhibitor-resistant D) AAC(3)-Ile pKpn2146b 41116-41976 Gentamicin, tobramycin, netilmicin, sisomicin ACC(6)-Ib pNDM-US In46 115114-115737 Tobramycin, amikacin, (43) netilmicin, sisomicin ACC(6)-Ib (1) pKpn2146b 82745-83350 Tobramycin, amikacin, InTn1331 netilmicin, sisomicin ACC(6)-Ib-CR PkPN2146B In37 38113-38712 Tobramycin, amikacin, (29) netilmicin, sisomicin, quinolones (low-level) ANT(3)-Ia Kpn23SapB In127 2297711-2298502 Streptomycin, spectinomycin APH(3)-Ib pKpn2146b ISCR2 53244-54047 Streptomycin (StrA) APH(6)-Id pKpn2146b ISCR2 52408-53238 Streptomycin (StrB) Sul2 pKpn2146b ISCR2 54108-54923 Sulfonamides RmtC pNDM-US ISEcp1 120100-120945 Aminoglycosides (via rRNA modification) Sul1 1. Kpn23SapB In127 2299007-2299846 Sulfonamides 2. pNDM-US In46 116245-117084 DfrA14 pKpn2146b In191 8281-8754 Trimethoprim QnrB9 pKpn2146b 26074-26742 Quinolones, fluoroquinolones Mph(A) pKpn2146c 16503-17408 Macrolides, Erythromycin FosA Chromosome 667960-668379 Fosfomycin Efflux pump Gene location Probable Substrate(s).sup.d AcrAB-TolC Chromosome 1249681-1254043 Aminoglycosides, -lactams, tigecycline, macrolides AcrEF-TolC Chromosome 4936203-4940465 Minor role EefABC Chromosome 5354323-5329922 Chloramphenicol, tetracyclines, ciprofloxacin MacAB-TolC Chromosome 1857393-1860445 Macrolides MdfA Chromosome 1781588-1782820 Aminoglycosides, fluoroquinolones, chloramphenicol MdtG, H, K, Chromosome * Many possible substrates (MFS L, M, NOP superfamily pumps) OqxAB Chromosome 4169609-4173960 Chloramphenicol, fluoroquinolones, trimethoprim EmrAB Chromosome 4218886-4221612 Nalidixic acid, hydrophobic compounds TetA(A) pKpn2146c Tn1721 19168-20367 Tetracyclines Gene Mutation Resistance phenotype gyrA Gyrase Ser83TTC.fwdarw.DeATC 3763583-3766216 Quinolone, fluoroquinolones parC Topo IV Ser80AGC.fwdarw.DeATC 4689294-4691552 Quinolone, fluoroquinolones nfsA Frameshift 1826275-1826998 Nitrofurantoin Nitroreductase .sup.aExcluding the resistance for bleomycin, an antibiotic used clinically only as an antitumor agent .sup.bVariant number from Table 1 of Ramirez et al. is used to distinguish the AAC(6)-Ib variants. .sup.cTwo silent differences between two copies. .sup.dProbable efflux substrates identified from literature sources including ARDB; the substrates list is not comprehensive and in many cases has been deduced from organisms other than K. pneumoniae. .sup.eMdt genes are scattered over the chromosome
[0523] Design of PNA sequences to target antibiotic resistance genes.
[0524] Twenty-one of the above-described antibiotic resistance enzyme genes (not transporter genes, which probably contribute less to resistance) from Klebsiella pneumoniae ATCC 2146 were chosen as targets. Work on gene inhibition in Salmonella (Soofi and Seleem, 2012) and Brucella (Rajasekaran et al., 2013) elucidated design principles for peptide-nucleic acid (PNA) gene-specific inhibitors, which were applied to our targets. Anti-antibiotic-resistance PNA sequences are listed in Table 5, with the six beta-lactamase genes being listed first.
TABLE-US-00007 TABLE5 Enzymes,effluxpumps,andmutationsexpectedtoconferresistanceto antibioticsofclinicalrelevance Metallo-beta-lactamaseNDM-1;p843:239-1051 CATcaagttttc(SEQIDNO:28) SHV-11betalactamase;csome:1155376-1154516,p850:72286-71426 CATaaccacaat(SEQIDNO:29) CMY-6AmpC-typebeta-lactamse:p843:91073-92218 CATgaaatcagt(SEQIDNO:30) CTX-M-15extendedspectrumbeta-lactamase;csome:3948604-3949479 CATgggattcct(SEQIDNO:31) TAM-1beta-lactamase;p850:766-1626 OXA-1beta-lactamase;p850:73911-74786 CAAttaaatgagg(SEQIDNO:32) Aminoglycoside-(3)(9)-adenyltransferaseAADA2;csome:838991-840016 CATtcaaaggcc(SEQIDNO:33) SulIdihydropteroatesynthase;csome:840521-841360 CATggcgtcggc(SEQIDNO:34) Undecaprenyl-diphosphates;csome:325972-3257151 CATccaattaaa(SEQIDNO:35) 16SribosomalRNAmethyltransferase:csome:4799637-4798816 CATtgggtatta(SEQIDNO:36) AAC(6)-Ibaminoglycoside6-N-acetyltransferasetypeIb;p843:133984-134607 CAAttaatgagg(SEQIDNO:37) SulIdihydropteroatesynthase;p843:135117-135956 CATggcgtcggc(SEQIDNO:38) 16SrRNAmethyltransferaseRmtC;p843:139815-138970 CATatatggtct(SEQIDNO:39) Aminoglycoside3phosphotransferaseAPH(3)-1b(strA);p850:3986-3183 CAAtggaggttc(SEQIDNO:40) Sul2sulfonamideinsensitivedihydropteroatesynthetase;p850:4862-4047 CATggggcttc(SEQIDNO:41) Streptomycin3-O-adenyltransferaseaadAANT(3)-Ia;p850:32614-32420 CATgatgtttaa(SEQIDNO:42) Dfra14trirnethoprim-resistantdihydrofolatereductase;p850:43383-43856 CAAggttctcat(SEQIDNO:43) QnrB10;p850:61200-61844 CATatttgtacc(SEQIDNO:44) AminoglycosideN(3)-acetyltransferaseII(Acc(3)-II);p50:76229-77089 CATcgcgatatc(SEQIDNO:45) TetracyclineeffluxproteinTetA;p852:90940-92139 CACgtctggcct(SEQIDNO:46) Macrolide2-phosphotransferasemphA;p852:88273-89178 CATgattcactc(SEQIDNO:47)
Example 3
[0525] Use of Quantitative PCR (qPCR) to Quantify the Decrease in Target mRNA Expression
[0526] To assess the efficiency of target gene knock down, electroporating commercially-available strains of Kpn (2146) and MRSA (1556) are used in the presence of candidate RNAs and quantitative PCR (qPCR) employed to quantify the decrease in target mRNA expression. These strains have numerous genes that contribute to antibiotic resistance via complex, interconnected, orthogonal mechanisms. Once antisense RNA cocktails using commercial strains of Kpn and MRSA are optimized, test them against clinical isolates of extended-spectrum -lactamase (ESBL)-producing K. pneumoniae and mecA-positive S. aureus. When compared to commercial strains, clinical isolates might have different or additional genes that contribute to antibiotic resistance; therefore, re-design antisense RNA cocktails for each target pathogen is necessary. In parallel, the effects of RNA length, structure, and composition on PNA formation, stability, and size are assessed. Assess the ability of candidate PNAs to penetrate Kpn-2146 and MRSA-1556 and effectively knock down gene expression using qPCR to quantify target mRNA.
[0527] Results
[0528] Choice of E. coli ER2420/pACYC177 as Model System
[0529] Given the large number of antimicrobial resistance mechanisms present in our K. pneumoniae BAA-2146 strain the cell penetrating peptide-peptide nucleic acid (CPP-PNA) conjugate silencing approach with a simpler experimental system, with fewer overlapping resistance mechanisms was selected. Non-pathogenic laboratory strains of E. coli are routinely used for cloning or protein expression, utilizing plasmids with specific drug resistance genes for selection in the laboratory. In most cases the resistance genes are carried on small, high-copy number plasmids, whereas our K. pneumoniae (and many wild Gram-negative pathogens) carry resistance genes on large, low-copy number plasmids. As a model organism, we chose a non-pathogenic E. coli strain, ER2420, which harbors a small, low-copy plasmid with two drug resistance genes: bla.sub.TEM-1 (TEM-1 beta-lactamase) and aph-3-ia (aminoglycoside-3-phosphotransferase type Ia, or APH(3)-Ia). The E. coli APH(3)-Ia confers resistance to the aminoglycoside drug kanamycin. The K. pneumoniae has several other aminoglycoside-modifying enzymes, but not this specific gene.
[0530] TEM-1 is one of six beta-lactamases harbored by K. pneumoniae BAA-2146, and it is a common mechanism of resistance in clinical isolates worldwide. TEM-1 confers resistance to several beta-lactam drugs including penicillin, and is susceptible to classical beta-lactamase inhibitors such as clavulanic acid (Paterson and Bonomo, 2005). The E. coli TEM-1 beta-lactamase has the identical amino acid sequence as TEM-1 in our K. pneumoniae strain, and is found in almost the same genetic environment, including the same start codon and ribosomal binding site, as shown in
[0531] Rapid, microscale testing for MIC with PNA antisense compounds.
[0532] The gold standard test for determining the minimum inhibitory concentration (MIC) or efficacy of an antimicrobial compound is a broth dilution assay. In this assay, a standardized stock of the microbe (the inoculum) is introduced into a series of test tubes containing a series of two-fold dilutions of the antimicrobial compound in sterile growth media (usually Mueller-Hinton broth for aerobic growth, or occasionally Mueller-Hinton agar). The tubes are incubated (typically overnight), and monitored for microbial growth, indicated by onset of turbidity. The lowest concentration that prevents the growth of the microbe is called the minimum inhibitory concentration, or MIC. Traditional antibiotics are relatively inexpensive and are active at fairly low concentrations, and the broth dilution protocol can easily be carried out in volumes of 5-10 mL per concentration. More recently, the protocol has been adapted to 96-well plate, where growth is performed in volumes of 100 L per well, and typically 8 to 12 concentrations of drug are used per test to establish MIC. This scaled-down protocol is termed a broth microdilution assay.
[0533] Testing the CPP-PNA conjugates for silencing drug resistance genes presented a unique challenge. For testing and development purposes, the CPP-PNA conjugates are custom-synthesized at small scale, for relatively high cost, on the order of $1,000/mg (100 nmol synthesis scale). To test whether the CPP-PNA conjugates effectively silence drug resistance genes, we need to demonstrate that the CPP-PNA restores susceptibility to a drug, or in other words demonstrate that the CPP-PNA lowers the minimum inhibitory concentration (MIC) of the drug to a resistant microbe. Based on prior literature, we expected effective concentrations of the CPP-PNA conjugates on the order of 5-40 M (Soofi and Seleem, 2012; Bai et al., 2012a; Bai et al., 2012b). A 100 nmol-scale batch of CPP-PNA provides enough material to produce 2.5 mL at 40 M concentration, or approximately 25 wells of a standard broth microdilution. Since a typical MIC test requires at least 8 wells per drug, the typical 100 nmol synthesis scale for CPP-PNA provides barely enough material for three tests (for example, one drug repeated twice, plus a no-drug control experiment). Clearly, even the small-scale broth microdilution is not small enough to enable cost-effective screening of CPP-PNA conjugates.
[0534] To address this shortcoming for CPP-PNA conjugates, microscale test strip compatible with either broth or agar microdilution was developed, allowing MIC to be determined with only 5-10 L of test solution. The test strip comprises a linear or rectangular array of wells (up to 20 per strip), designed with spacing of 4.5 mm or 3 mm between wells. These spacings are one-half or one-third the 9 mm spacing of an SBS-standard microtiter plate, ensuring that our test strips are compatible with multichannel pipettes and other laboratory instrumentation designed around standard 9 mm spacing. (SBS-standard 384-well plates with 9/2=4.5 mm spacing and 1536-well plates with 9/4=2.25 mm spacing also retain compatibility with multichannel pipettes designed for 96 well plates).
[0535] The closest commercially available items identified are 8- or 12-tube strips designed for PCR. These tubes are typically conical with rounded bottoms and are typically used for volumes of 20-50 L. The present test strips, by contrast, have a flat bottom with shallow, open chambers, which allows for efficient gas exchange for microbial growth without shaking or agitation. The shallow wells also accommodate either liquid or solid growth media (e.g., agar). 1536-well plates would accommodate similar liquid volumes as the present test strips, but in relatively deep wells which would present a greater challenge for gas exchange as well as pipetting. Typical experiments would use far less than 1536 wells, but once a sterile microwell plate is used, it is inadvisable to re-use it for subsequent experiments (e.g., simply using 1-2 rows per day until the plate was filled will likely lead to trouble with contamination).
[0536] The shallow wells present a challenge for detection of microbial growth by turbidity. To enable faster and more sensitive growth determination in shallow wells, the colorimetric and fluorogenic redox indicator resazurin (Mann and Markham, 1998; Palomino et al., 2002; Sener et al., 2011) was used. This well-known viability indicator undergoes a conspicuous color change from dark blue to bright pink, and non-fluorescent to fluorescent, as a consequence of microbial respiration (resazurin is irreversibly reduced to resorufin, and eventually undergoes a further reversible reduction to colorless dihydroresorufin). With this test strip, screening capability, for the standard 100 nmol scale of CPP-PNA conjugate synthesis was increased.
[0537] Fabrication of microwell test strips.
[0538] Test strips were fabricated by laser micromachining and lamination of thin plastic sheets and pressure-sensitive adhesives. Ideally, the test strips would be fabricated of materials that laser-cut easily, and can withstand autoclave sterilization at 121 C. Black Delrin was found to be a suitable material on both of these points. Black Delrin also provides high contrast and minimal autofluorescence for either colorimetric or fluorescent readout of the resazurin growth assay. A variety of materials were tested for use as a clear bottom, with 0.2 mm PMMA or 0.25 mm PET providing acceptable results. PMMA typically has a glass transition temperature (Tg) below the temperature of the autoclave sterilization, but in this case since the PMMA was tightly bonded to the overlying Delrin, with relatively small clear apertures, we did not observe noticeable sagging or melting upon autoclaving.
[0539] Laser micromachining is acceptable as a laboratory prototyping technique, but mass production of such test strips would likely be performed by injection molding, and sterilization would more likely be performed by ethylene oxide gas or gamma irradiation, and thus different materials would likely be usedpolypropylene may be an acceptable choice.
[0540] Proof of concept with conventional antimicrobials.
[0541] The microwell resazurin growth assay was tested with several classes of antimicrobial compounds to understand the performance of the test strips and rapid growth test. Antimicrobial compounds that were used for testing included amoxicillin (with or without the beta-lactamase inhibitor clavulanic acid), kanamycin, ciprofloxacin, nalibdixic acid, tetracycline, and rifampicin (resistant E. coli for several of these drugs were available in the laboratory). Test strips were prepared with a liquid suspension of the drug, or with drugs dried down into the wells, or with the drugs prepared in molten agar media dispensed into the wells prior to solidification. Overnight cultures of E. coli were diluted to give an inoculum equivalent to approximately 510.sup.5 cells/mL (about 5000 cells per 10 L well), which is typical for broth dilution. A typical final concentration of resazurin was 100 g/mL, which has previously been demonstrated to be non-inhibitory to bacteria.
[0542] Test strips include at least one well as a no-drug control, and one well as a sterility control (no cells inoculated). Test strips were typically placed in a sterile Petri dish along with several moist tissues (Kimwipes) to provide a humid atmosphere. The Petri dish was covered, wrapped with Parafilm, and placed in a 37 C. incubator. The test strips would monitored periodically for signs of color change, which would typically become evident within 4-5 hours.
[0543] Most frequently, cells were inoculated by pipette. We did experiment with producing a comb-like inoculating device, with pins or teeth that would dispense a controlled volume of cell suspension to each well of the device simultaneously. In the case of test strips fabricated with solid agar pads, we also experimented with using a small spatula to spread cell suspension across the wells.
[0544] Examples of test strips used for conventional antibiotic testing are shown in
[0545] Proof of concept with CPP-PNA.
[0546] The test strip described above was used for a microvolume screening assay with a CPP-PNA conjugate designed to silence the biaTEM-1 gene. In our first trial, two concentration of amoxicillin were tested: 256 and 64 g/mL, with CPP-PNA concentration ranging from 0-40 M. Results are shown in
[0547] This strain of E. coli is resistant to AMX, MIC>256 mg/mL (well 1). With AMX=256 or 64 g/mL, the E. coli still grows with 10 M of the silencer probe, but not with the silencer probe at 20-40 M, suggesting that the silencer probe suppresses the resistance due to the bla.sub.TEM-1 gene. Growth is unaffected by presence of the nonsense control probe. As expected, the cells grow in the no-antibiotic control well (N), and no growth is observed in the sterility control (SC) well. Thus this initial test demonstrated the concept of lowering MIC by silencing translation of the resistance gene, and suggested there was some promise for moving forward. Subsequently, we attempted to determine the efficacy at a lower drug concentration (E. coli is considered resistant to amoxicillin at an MIC>8 pglmL).
[0548] However, in several subsequent trials we could not reproduce even the initial result of silencing at 20 M CPP-PNA and 64 g/mL AMX. We eventually suspected this was due to aggregation of the CPP-PNA upon storage in solution at 20 C. The manufacturer recommended heating immediately prior to use. Eventually we were able to reproduce the initial result, although we found that longer incubations (>8 hours) led eventually to growth of the E. coli even in wells with the silencer. This suggested that the CPP-PNA did not fully or permanently suppress expression of the TEM-1, but merely slowed the growth rate of the E. coli.
[0549] A second possible explanation for incomplete inhibition of growth is that the inoculum already contains some active TEM-1 enzyme. The overnight growth and subsequent re-growth of the culture was performed without drugs, so as to prevent inducible overexpression of the resistance enzyme. However, this particular gene may be constitutively expressed regardless of whether the drug is present. Thus, the initial inoculum may contain enough active enzyme to survive, if not grow, in the presence of drug. B-lactam drugs such as amoxicillin are relatively unstable in aqueous media (half life on the order of a few hours), and thus the E. coli with pre-existent TEM-1 may simply persist in a viable but not actively-growing state until the active concentration of drug drops low enough that the E. coli can proliferate. Additionally, -lactamases such as TEM-1 can be secreted into growth media, or released upon cell death. Small amounts of secreted or released TEM-1 can slowly hydrolyze amoxicillin, eventually reducing it to non-inhibitory levels.
[0550] The products of gene expression, e.g., a protein or an enzyme, are generally much more stable than the corresponding mRNA. Proteins or enzymes can have half-lives of hours or days, and once expressed they tend to persist in cells. Bacterial mRNA, on the other hand, is highly unstable. Once a gene is expressed, the mRNA may persist for only a few minutes before being degraded. Bacterial mRNA (apart from highly expressed housekeeping genes) may be present at very low copy number per cell, on the order of zero, one, or a few copies present at any one time, and in many cases are transcribed in bursts (Chong et al., 2014). Protein translation from bacterial mRNA also proceeds in bursts (Yu, Science 311:16000-1603, 2006) with numerous copies of protein produced from a single mRNA transcript in a matter of minutes before the mRNA is degraded.
[0551] To be effective at completely suppressing gene expression, a silencing probe needs to effectively out-compete the protein translation machinery (i.e., the ribosome) for binding to the mRNA. Bacterial rRNA is present in high copy number, on the order of 10,000 copies per cell. Considering a typical E. coli has a volume of about 2 fL (about 1 m1 m2 m), 10 copies of rRNA translates to a concentration of 8 M. Even if a silencing probe binds to the mRNA with 1-2 orders of magnitude higher affinity than the rRNA, the silencer must still be present within the cell at micromolar or tens of micromolar concentration at all times to effectively outcompete the rRNA for binding of every transcript produced, to prevent even a single burst of translation. This may account for previous reports of CPP-PNA silencing probes having active concentrations of tens of micromolar.
[0552] As a therapeutic approach, combine the bla.sub.TEM-1 CPP-PNA to silence translation of TEM-1, in combination with clavulanic acid to inhibit any TEM-1 that is expressed. The CPP-PNA conjugate should be much more stable in solution than clavulanic acid, which itself is a -lactam with a half-life of a few hours in solution. In combination, clavulanic acid provides inhibition of already-formed TEM-1, while the CPP-PNA prevents new TEM-1 from being formed.
[0553] Besides the growth-based assay to determine MIC with and without the CPP-PNA silencer, verify that the CPP-PNA silencer prevents expression of the TEM-1 by growing E. coli in the presence or absence of the CPP-PNA silencer with no drug (so there is no selection pressure), and then test for beta-lactamase activity. This can be done easily using colorimetric or fluorogenic beta-lactamase substrates such as nitrocefin or fluorocillin. Additionally, plate or culture from wells grown with AMX+CPP-PNA silencer to determine whether the CPP-PNA restores the bactericidal effect of AMX, or simply prevents growth of a subpopulation of viable cells (bacteriostatic effect).
Example 4
Novel Rapid Diagnostic Assay Based on PMA-PCR
[0554] Quantitative PCR provides accurate determination of bacterial growth: each doubling of the bacteria should lead to a decrease of 1 cycle (delta-Ct=1) for detection in real-time PCR. Thus sampling at multiple time points could give an indication of whether bacteria are growing in presence of antibiotics. However, PCR does not discriminate between cells that are alive and cells that are dead or dying. Depending on their mechanism of action, antibiotics may or may not immediately kill bacteria, and in some cases bacteria may survive through one or more rounds of DNA replication or even cell division in the presence of antibiotics.
[0555] To improve the discrimination between living and dying or dead cells at early time points, we employed propidium monoazide (PMA). PMA is a photoreadive intercalating dye that is excluded from cells with intact membranes, but penetrates into dead cells with permeabilzed membranes. Activation with blue light results in formation of a nitrene radical, which crosslinks, modifies, or otherwise damages DNA to which PMA is bound, rendering it non-amplifiable by PCR. Thus, PMA treatment biases PCR against amplification of DNA from dead cells. In qPCR, this effect manifests as a large delta-Ct between a sample treated with PMA versus an untreated control (Nocker et al., 2006).
[0556] E. coli ER2420 with pACYC177 (amoxicillin/kanamycin resistance) or pACYC184 (tetracycline/chloramphenicol resistance) was measured. As early as 2 hours later, based upon the delta-Ct for PMA treatment, the killing action of amoxicillin or kanamycin in the susceptible strain (pACYC184) and not in the resistant strain (pACYC177) was detected. The killing effect of cefotaxime (a cephalosporin which TEM-1 beta-lactamase does not cleave) in both strains was also detected. However, the technique does have its limits: the killing action was most evident (large delta-Ct) within 2 hours only for concentrations of drugs that were well above the expected MIC for amoxicillin, kanamycin, or cefotaxime. Selected results are shown in
[0557] Ciprofloxacin was another drug for which the PMA technique was not useful. Ciprofloxacin is rapidly bactericidal to both E. coli at low concentrations. However, the mechanism of killing (inhibition of DNA replication) does not result in immediate permeabilization of the cell membrane (Mason et al., 1995). So in the case of ciprofloxacin, PMA treatment did not result in a noticeable delta-Ct. We did observe, however, minimal delta-Ct (minimal growth) between the initial inoculum (heat-killed at the beginning of the experiment), and the inoculum after several hours of growth, indicating that qPCR alone (without PMA treatment) can provide an indication of growth in presence of ciprofloxacin. This is not entirely surprising, as qPCR detects DNA copy number as an indicator of bacterial concentration, and ciprofloxacin suppresses growth by preventing DNA replication.
[0558] Apart from the rapid growth step (2 hours incubation), the PMA-PCR experiments were performed with purely conventional techniques, including spin columns for DNA extraction, and conventional real-time PCR. Even so, the entire protocol required approximately 5 hours. Automating the DNA extraction, and using newer, rapid-cycling PCR technology could likely reduce the total protocol to under 3 hours. It is questionable whether the growth step could be reduced significantly below 2 hours, as bacteria often undergo a lag phase upon being introduced into new media (i.e., a test medium containing antibiotics). During this period, the bacteria do not actively divide, but rather adjust their metabolism to new conditions. This is the case whether a stationary-phase overnight culture is diluted to form the inoculum, or a clinical sample is placed directly into a test medium. Slow-growing or fastidious microbes such as Mycobacterium tuberculosis or Francisella tularensis which inherently divide more slowly would require longer incubations to detect a phenotypic response to drugs. The PMA-PCR technique may prove useful for determining viability or antimicrobial susceptibility for fast-growing biodefense pathogens such as Bacillus anthracis or Yersinia pestis, and literature suggests the technique also has some ability to discriminate infectious from non-infectious viruses (Parshionikar, Appl. Environ. Microbiol. 76:4318-4326, 2010). The PMA-PCR technique also presents the possibility of combining rapid phenotypic response (growth vs death) with molecular specificity. This may be useful in mixed samples (e.g., clinical samples) where total growth (as given by the color change of rifampicin, for example) would not distinguish between pathogens. In contrast, the PMA-PCR technique could be adapted to detect only certain species in a mixed culture.
Example 5
Optimization of Pore Chemistry
[0559] Despite recent improvements in encapsulation efficiencies and serum stabilities, state-of-the-art liposomes, multilamellar vesicles, and polymeric nanoparticles still suffer from several limitations, including complex processing techniques that are highly sensitive to pH, temperature, ionic strength, presence of organic solvents, lipid or polymer size and composition, and physicochemical properties of the cargo molecule, all of which impact the resulting nanoparticle's size, stability, entrapment efficiency, and release rate (Conley et al., 1997: Couvreur and Vauthier, 2006; Morilla and Romero, 2011; Wong at al., 2003).
[0560] In contrast, MSNPs formed via aerosol-assisted EISA have an extremely high surface area (>1200 m.sup.2/g), which enables high concentrations of various therapeutic and diagnostic agents to be adsorbed within the core by simple immersion in a solution of the cargo(s) of interest. Furthermore, since aerosol-assisted EISA yields MSNPs that are compatible with a range of post-synthesis modifications, the naturally negatively-charged pore walls can be modified with a variety of functional moieties, enabling facile encapsulation of physicochemically disparate molecules, including acidic, basic, and hydrophobic drugs, proteins, small interfering RNA, minicircle DNA vectors, plasmids, and diagnostic agents like quantum dots and iron oxide nanoparticles (Ashley et al., 2012; Ashley et al., 2011; Epler et al., 2012).
[0561] As demonstrated by
[0562] As shown in
[0563] Fusion of liposomes to Drug-Loaded MSNPs Creates a Coherent SLB that Enhances Colloidal Stability and Enables Long-Term Cargo Retention.
[0564] Liposomes and multilamellar vesicles have poor intrinsic chemical stability, especially in the presence of serum, which decreases the effective concentration of drug that reaches target cells and increases the potential for systemic toxicity (Couvreur and Vauthier, 2006; Morilla and Romero, 2011). In contrast, lipid bilayers supported on mesoporous silica particles were shown to have a high degree of stability in neutral-pH buffers and serum-containing simulated body fluids, regardless of the charge or fluidity of lipids used to form the SLB (Ashley et al., 2011). In addition to being highly stable, the SLB provides a biocompatible interface with tailorable fluidity for display of functional molecules, such as polyethylene glycol (PEG) and targeting ligands (Ashley et al., 2011).
[0565] Protocells with SLBs composed of the zwitterionic, fluid lipid, 1,2-dioleoyl-sn-glycerol-3-phosphocholine (DOPC) with 30 wt % cholesterol and 10 wt % of PEG have a high degree of colloidal stability (see
[0566] Modifying the SLB with Various Targeting Ligands Promotes Efficient Uptake of Antibiotic-Loaded Protocels by Model Host Cells and Enables Highly Efficacious Killing of Intracellular Bacteria.
[0567] In order to effectively kill intracellular bacteria, such as F. tularensis and B. pseudomallei, nanoparticle delivery vehicles must release antibiotics directly into the cytosol of host cells, which not only increases the concentration of drug in the vicinity of the pathogen but is also important since many classes of antibiotics, including -lactams, lincosamides, and fluoroquinolones, show poor penetration or rapid efflux from mammalian cells (Pinto Alphandary et al., 2000). A number of factors govern cellular uptake and processing of nanoparticles, including their size, shape, surface charge, and degree of hydrophobicity (Peer et al., 2007). Additionally, a variety of molecules, including peptides, proteins, aptamers, and antibodies, can be employed to trigger active uptake by a plethora of specific cells.
[0568] Incorporation of targeting and endosomolytic peptides that trigger endocytosis and endosomal escape on the protocell SLB enables cell-specific delivery and cytosolic dispersion of encapsulated cargos (Ashley et al., 2011). As importantly, SLB fluidity can be tuned to enable exquisite (sub-nanomolar) specific affinities for target cells at extremely low targeting ligand densities (about 6 targeting peptides per protocel) and that SLB charge and degree of PEGylation can be modulated to reduce non-specific interactions, resulting in protocells that are internalized by target cells 10,000-times more efficiently than non-target cells (Ashley et al., 2011).
[0569] To promote uptake by model F. tularensis host cells, including innate immune cells, alveolar type II epithelial cells, and hepatocytes, levofloxacin-loaded MSNPs were encapsulated within SLBs composed of DOPC with 5 wt % of 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE), 30 wt % of cholesterol, and 10 wt % of PEG. Heterobifunctional crosslinkers were used to modify DOPE moieties with Fc from human IgG (binds to Fc receptors on macrophages and dendritic cells (Moon et al., 2012; Sandor et al., 2012; Schmidt et al., 2007), human complement C3 (binds to CR1 on macrophages and dendritic cells), ephrin B2 (binds to EphB4 receptors on alveolar type II epithelial cels (Hafner et al., 2004)), and the SP94 peptide (binds to unknown receptor(s) on hepatocyte-derived cells (Lo et al., 2008)). Additionaly, protocels targeted to the mannose receptor (a.k.a. CD206) were targeted by incorporating mannosylated cholesterol (Kawakami et al., 2000) into liposomes used to form SLBs.
[0570] As demonstrated by
[0571] As shown by
[0572] Levofloxacin-loaded protocells are not toxic to host cells, even upon burst release of 1 mg/mL (about 25,000 times the MIC90 value of levofloxacin). In summary, protocells are highly flexible and modular. In dramatic contrast to other state-of-the-art nanoparticle delivery vehicles, we can load high concentrations of physicochemically disparate molecules and specifically tailor release rates without altering the protocel's size, size distribution, stability, or synthesis strategy. Properties of the SLB and MSNP core can be modulated entirely independently, which enables us to optimize such properties as surface charge, colloidal stability, and targeting specificity independently from overall size, type of cargo(s), loading capacity, and rate of release and offers us several options for engineering and tailoring triggered cargo release.
Example 6
Synthesis and Characterization of CPP-PNA-Loaded Protocols
[0573] Mesoporous silica nanoparticles were prepared using the emulsion processing technique described by Carroll et al. (2009) and were characterized by a Brunauer-Emmett-Teler (BET) surface area of 850 m.sup.2/g, a pore volume fraction of about 65%, and a multimodal pore morphology composed of large (23-30 nm), surface-accessible pores interconnected by 3-13 nm pores (see
[0574] The CPP-PNA loading capacity of protocells is compared to that of zwitterionic and cationic lipid nanoparticles (LNPs) in
[0575] Modification of the silica core with the amine-containing silane, 3-[2-(2-aminoethylamino)ethylamino]propyltrimethoxysilane (AEPTMS), increased the zeta potential () from 32 mV to +12 mV and resulted in a CPP-PNA capacity of about 1 nmol per 10.sup.10 particles. Use of DOTAP liposomes to synergistically load CPP-PNA into negatively-charged cores (OBrien et al., 2007) resulted in protocells with a similar capacity, more than 100-fold higher than that of the zwitterionic LNPs that are commonly utilized in particle-based therapeutic applications. DOPC protocells with AEPTMS-modified cores were selected for further studies due to their high capacity for CPP-PNA and their low intrinsic cytotoxicity.
[0576] It should be noted that CPP-PNA-loaded protocells were slightly larger (17824.3 nm) than CPP-PNA-loaded DOPC LNPs (13519.1 nm) and DOTAP LNPs (14414.8 nm), resulting in a about 2-fold increase in particle volume. When the capacities shown in
[0577]
[0578] Under mildly acidic conditions comparable to those in the endosome/lysosome pathway, the reduced electrostatic and dipolar interactions between the CPP-PNA-loaded, AEPTMS-modified core and the PE and PC headgroups of the supported lipid bilayer caused membrane destabilization and exposure of the core to the acidic medium. After membrane destabilization, the combined rates of cargo diffusion and core dissolution resulted in the release profile seen in
Example 7
Efficacy of Novel Protocells in Mouse Model of Invasive MRSA Infection
[0579] The efficacy of lead protocel formulations was tested in a mouse model of invasive MRSA infection. To assess the biodistribution of designed, synthesized, and optimized protocels, we injected Balb/c mice via the tail vein with 200 mg/kg of protocells labeled with the near-infrared fluorophore, DyLight 680 and used an IVIS Lumina II to monitor whole animal fluorescence as a function of time after injection. If necessary, the size of the MSNP core could be modified to achieve a broad systemic distribution, which will be required to treat invasive MRSA infections. A dermanecrosis or air pouch Balb/c mouse model of invasive MRSA infection was used to assess the efficacy of protocells targeted to MRSA and co-loaded with CPP-PNAs specific for antibiotic resistance genes (e.g., mecA) and appropriate antibiotics (e.g., cephalosporins like cefotaxime or cefazolin). Various concentrations of protocells were administered to infected mice via the tail vein; at 1, 12, 24, and 48 hours after injection, and assigned each mouse an overall morbidity score and attempted to quantify bacterial burden in the spleen and either the abscess site (dermanecrosis model) or air pouch. Free antibiotics, free PNAs, and antibiotic-loaded protocells are used as controls in all experiments.
[0580] Results
[0581] A well-established mouse air-pouch model of infection (Fleming at al., 2013) was used to assess the biodistribution of fluorescently labeled (Dylight-633) protocells during methicilin-resistant Staphylococcus aureus (MRSA) skin and soft tissue infections (SSTI). The air-pouch model is based on subcutaneous infection of air over the course of six days on C57B/6 mice with 710.sup.7 colony forming units (CFU) of the MRSA USA300 isolate LAC, and co-injected 2.5 mg of DyLight-633 stained protocells. At four and 24 hours post-infection, mice were sacrificed, kidney, spleen and liver removed and the pouch contents recovered by lavage.
[0582] The post-infection biodistribution of DyLight-633 stained protocels was determined using an IVIS in vive imaging system (PerkinElmer, Waltham, Mass.) and flow cytometry. To determine the relative concentrations of protocells remaining in the air-pouch at four and 24 hours post-infection, flow cytometry was used to compare the amount of DyLight-633 fluorescence recovered from pouch lavage to in vitro standards. As shown in
[0583] Next fluorescence imaging (IVIS) was used to visualize the protocells within lavaged and extracted air-pouches and dissemination of protocells to mouse kidneys and liver, at four and 24 hours post-infection (
[0584] Next, it was determined whether the protocells co-localized with MRSA during infection. To address this, confocal microscopy was employed to demonstrate that fluorescently labeled protocells overlapped with GFP-expressing MRSA in the epidermis and dermis of the air-pouch during SSTI (
[0585] Finally, it was determined whether protocells loaded with the anti-MRSA antibiotic vancomycin, and injected into the infected air-pouch, could mediate bacterial clearance. As shown in
[0586] The aforementioned data proved proof-of-principle that antibiotic-loaded protocells can bind to MRSA and mediate bacterial clearance at the site of infection.
Example 8
Versatile MSNPs and Protocells
[0587] As illustrated in
[0588] Using EISA as described herein, MSNP's were prepared that have a nominal BET surface area of 1,200 m.sup.2/g, zeta potentials that range from 30 mV to +30 mV, and a highly ordered pore structure that enables high-capacity loading of disparate types of cargos. See
[0589] Further, together with silica core functionalization, the supported-lipid bi- or multilayer (SLB) can be formulated with lipids that are zwitterionic, positively charged, or negatively charged. This allows for synergistic-cargo loading upon fusion with the core particle, an additional method for controlling the type and amount of cargo that is loaded. See
Example 9
Pore Size and Chemistry Enables High Capacity Loading of Physicochemically Disparate Antivirals, while Optimization of Silica Framework Condensation Results in Tailorable Release Rates
[0590] Using aerosol-assisted EISA, MSNPs were prepared that have an extremely high surface area (>1200 m.sup.2/g), which enables high concentrations of various therapeutic and diagnostic agents to be adsorbed within the core by simple immersion in a solution of the cargo(s) of interest. Furthermore, since aerosol-assisted EISA yields MSNPs that are compatible with a range of post-synthesis modifications, the naturally negatively-charged pore walls can be modified with a variety of functional moieties, enabling facile encapsulation of physicochemically disparate molecules, including acidic, basic, and hydrophobic drugs, proteins, small interfering RNA (siRNA), minicircle DNA vectors that encode small hairpin RNA (shRNA), plasmids, and diagnostic/contrast agents like quantum dots, iron oxide nanoparticles, gadolinium, and indium-111 (Ashley et al., 2012; Ashley et al., 2011). Table (supra) lists the MSNP and SLB properties we can precisely control and how these properties can be used to tailor the in vitro and in vivo functionality of protocells.
[0591] Aerosol-assisted evaporation-induced self-assembly (EISA) (Lu et al., 1999) is a robust, scalable process that we pioneered over a decade ago to synthesize spherical, well-ordered oxide nano- and microparticles with a variety of pore geometries and sizes (see
[0592] Aerosol-assisted EISA, additionally, produces particles compatible with a variety of post-synthesis processing procedures, enabling the hydrodynamic size to be varied from 20-nm to >10-m and the pore walls to be modified with a wide range of functional moieties that facilitate high capacity loading of physicochemically disparate diagnostic and/or therapeutic molecules. Importantly, aerosol-assisted EISA produces MSNPs that can be easily dispersed in a variety of aqueous and organic solvents without any appreciable aggregation, which enables us to load drugs that have high and low solubility in water. Our MSNPs are also easily encapsulated within anionic, cationic, and electrically-neutral SLBs via simple liposome fusion. In contrast, MSNPs generated using solution-based techniques tend to aggregate when the pH or ionic strength of their suspension media changes (Liong et al., 2009), typically require complex strategies involving toxic solvents to form SLBs, and have maximum loading capacities of 1-5 wt %,.sup.20 which, our MSNPs exceed by an order of magnitude.
[0593] As demonstrated by
[0594] It is also important to note that the present MSNPs can be loaded with complex combinations of physicochemically disparate anticancer agents, antibacterial agents and antiviral agents (e.g., three small molecule drugs in combination with five separate siRNAs), a capability other nanoparticle delivery vehicles typically do not possess. We are able to achieve high loading capacities for acidic, basic, and hydrophobic drugs, as well as small molecules and macromolecules by altering the solvent used to dissolve the drug prior to loading and by modulating the pore size and chemistry of the MSNP (see
[0595] Furthermore, since MSNPs formed via aerosol-assisted EISA remain stable upon post-synthesis processing, the pore chemistry can be precisely altered by, e.g., soaking naturally negatively-charged MSNPs in amine-containing silanes (e.g., (3-aminopropyl)triethoxysilane, or APTES), in order to maximize electrostatic interactions between pore walls and cargo molecules. Non-polar compositions may also be used such as methylating agents (e.g., hexamethyldisilazane (HDMS), sodium bis(tnmethylsilyl)amide (NaHDMS) or potassium bis(trimethylsilyl)amide (KHDMS) to enhance MSNP core loading with relatively water-insoluble active ingredients.
[0596] Another unique feature of the present MSNPs is that the rate at which encapsulated drug is released can be precisely modulated by varying the degree of silica framework condensation and, therefore, the rate of its dissolution via hydrolysis under physiological conditions (Ashley et al., 2011). As shown in
Example 10
Fusion of Liposomes to Antiviral-Loaded MSNPs Creates a Coherent SLB that Enhances Colloidal Stability and Enables DH-Triggered Release
[0597] Liposomes and multilamellar vesicles have poor intrinsic chemical stability, especially in the presence of serum, which decreases the effective concentration of drug that reaches target cells and increases the potential for systemic toxicity (Couvreur et al., 2006; Morilla et al., 2011). In contrast, lipid bilayers supported on MSNPs have a high degree of stability in neutral-pH buffers, serum-containing simulated body fluids, and whole blood, regardless of the melting temperature (T.sub.m, which controls whether lipids are in a fluid or non-fluid state at physiological temperature) of lipids used to form the SLB. Specifically, we have demonstrated that protocells with SLBs composed of the zwitterionic, fluid lipid, 1,2-dioleoyl-sn-glycerol-3-phosphocholine (DOPC) have a high degree of colloidal stability (see
[0598] Although protocells are highly stable under neutral pH conditions, the SLB can be selectively destabilized under conditions that simulate the interior volume of intracellular vesicles (e.g., endosomes, lysosomes, macropinosomes), which become acidified via the action of proton pumps. Specifically, DOPC SLBs are destabilized at pH 5.0, which exposes the MSNP core and stimulates its dissolution at a rate dictated by core's degree of silica condensation; DOPC protocells with MSNPs cores that have a low degree of condensation are, therefore, ribavirin was retained at pH 7.4 but rapidly release it at pH 5.0 (see
Example 11
PTX Protocell
[0599] Paclitaxel (PTX) is a complex diterpenoid natural product, which has become a first-line treatment for NSCLC. However, because of its poor water solubility, paclitaxel has been used in an encapsulated form with the organic co-solvents ethanol and polyethoxylated castor oi (a formulation marketed as Taxol; Bristol-Myers Squibb, New York, N.Y., USA) for clinical trials, but has been shown to cause toxic effects, including life-threatening anaphylaxis. Liposomal paclitaxel (Lipusu; Luye Pharma Group Ltd., Nanjing, China) is a new formulation of paclitaxel and phosphatidylcholine liposomes. Pharmacokinetic studies in animal models have shown that, compared with the current pacditaxel formulation, liposomal paclitaxel has a significantly prolonged elimination half-life and mean retention time, and an apparent larger volume of distribution. Even more unexpected and exciting is that the concentration of liposomal paclitaxel in tissues is dramatically higher than that of paclitaxel, especially in the reticuloendothelial system, including the lymph nodes, liver, and spleen. Several clinical studies recently indicated that the efficacy of liposomal paditaxel equaled or slightly exceeded that of the current paclitaxel (Taxol) formulation, while having a superior safety profile. Hu, et al., Trials 2013, 14:45 doi:10.1186/1745-6215-14-45 (citations omitted).
[0600] PTX MSNPs are made according to EISA techniques described herein. PTX nanoparticles comprise PTX loaded into MSNPs whose 20 nm-50 nm pores. MSNPs are methylated with hexamethyldisilazane (HDMS); the EISA surfactant is hexadecyltrimethylammonium bromide (Cis; CTAB). Nanoparticles have a differential pore volume of between about 1.0 cm.sup.3/g and a BET surface area of about 1,000 m.sup.2/g. The MSNP weight ratio of PTX to silica is about 0.75 and the MSNPs have a Zeta () potential of about 20 mV. The MSNPs are coated with a lipid bilayer comprising DOPC or DPPC in combination with DOPE, cholesterol and PEG-2000 PE (18:1). Other small-molecule water-insoluble cargos can be used in the protocell in place of PTX.
[0601] In some examples, the lipid bilayer comprises a c-MET binding peptide having sequence selected from SEQ ID Nos. 1-4 below:
TABLE-US-00008 SEQIDNO:48: AlaSerValHisPheProPro SEQIDNO:49: ThrAlaThrPheTrpPheGln SEQIDNO:50: ThrSerProValAlaLeuLeu SEQIDNO:51: IleProLeuLysValHisPro
[0602] The drug loading efficiency is determined in triplicate by HPLC (Agilent 1100 series. Agilent Technologies, Diegem. BE). The mobile phase consists in acetonitrile/water (70:30 vv). The reverse phase column is a CC125/4 Nucleod UR100-5 C18. The column temperature is maintained at 30 C. The flow rate is set at 1.0 ml/min and the detection wavelength is 227 nm. Sample solution is injected at a volume of 50 l. The HPLC is calibrated with standard solutions of 5 to 100 g/ml of PTX dissolved in acetonitrile (correlation coefficient of R.sup.2=0.9965). The limit of quantification is 0.6 ng/ml. The coefficients of variation (CV) are all within 4.3%. Nanoparticles are dissolved in acetonitrile and vigorously vortexed to get a clear solution. The encapsulation efficiency is defined by the ratio of measured and initial amount of PTX encapsulated in nanoparticles, the recovery corresponds to the ratio of the amount of PTX in the supernatant and in the pellets to the initial amount of PTX. About 1.4 mg of the 2 mg PTX starting material is encapsulated.
[0603] In vitro measurements determine that at a pH of about 5, the protocells release between about 30 wt % to about 100 wt % of PTX at about three hours after delivery, and releases about 60 wt % to about 100 wt % of PTX at about six hours after delivery. At a pH of about 7, less than about 10 wt % of PTX is released from the protocells after about eight weeks.
Example 12
Protocells are Biocompatible, Biodegradable, and Non-Immunogenic
[0604] The biocompatibility, biodegradability, and immunogenicity of protocells were evaluated after repeat intraperitoneal (IP) or subcutaneous (SC) injections in Balb/c and C57B6 mice. Balb/c mice injected IP with 200 mg/kg doses of DOPC protocels three times each week for 4 weeks showed no signs of gross or histopathological toxicity (see
Example 13
The Biodistribution of Protocells can be Controlled by Tuning their Hydrodynamic Size and Surface Modification with Targeting Ligands
[0605] Since liposomes and multilamellar vesicles are the most similar nanoparticle delivery vehicles to protocels, every effort is made to benchmark the performance of protocells against the performance of lipid-based nanoparticles. Liposomes and multilamellar vesicles have biodistributions that are largely governed by their overall size and size distributions. This holds true for protocells as well. However, the sizes of liposomes and multilamellar vesicles are difficult to control and subject to slight variations in lipid content, buffer pH and ionic strength, and chemical properties of cargo molecules. In contrast, the diameter of protocells is generally governed by the size of the core, which can be modulated by the methods described herein. As demonstrated by
[0606] For example, modifying 150-nm protocels with CD47, a molecule expressed by erythrocytes that innate immune cells recognize as self, substantially enhances their circulation half-life (see
Example 14
Optimization of the BBB Penetration Potential of Protocells Using an In Vitro Transwell Assay
[0607] The preliminary data indicate that various parameters affect the BBB penetration potential of protocels, including their hydrodynamic size, surface charge, and surface modifications; as shown in
[0608] To assess penetration and cargo delivery efficiency, use a high-throughput transwell assay where cerebral microvessel endothelial (hCMEC/D3) cells are grown to confluence on collagen-coated, microporous, polycarbonate membranes and inserted into 12-well Costar Transwell plates. Various concentrations of ribavirin-loaded protocells are added to the apical or basolateral chamber, the wells incubate for 2 hours at 37 C., and inductively-coupled plasma mass spectrometry (ICP-MS) and HPLC used to measure Si and ribavirin concentrations, respectively, in both chambers. Ribavirin is used since a fluorescence-based HPLC method is developed to detect it in cell culture medium. Monolayers are co-dosed with lucifer yellow to ensure that the cells are not damaged during the course of the experiment. Use DLS, transmission electron microscopy (TEM), and UV-visible spectroscopy to characterize the size, charge, and loading capacity of protocells that cross the cell monolayer, hCMEC/D3 cells will be used because they are robust, easy to grow, and better replicate the human BBB than other in vitro models.
Example 15
Exemplary Protocells
[0609] In one embodiment, a mesoporous silica or metal oxide nanoparticle is provided having a pore size ranging from about 0.001 to about 100 nm, e.g., from about 0.01 to about 50 nm, from about 0.1 to about 100 nm, from about 0.1 nm to about 35 nm, or from about 2 nm to about 25 nm, and a diameter ranging from about 25 nm to about 500 nm, e.g., from about 100 nm to about 300 nm, said nanoparticle being functionalized with either a polar group for loading of hydrophilic cargo or a non-polar group for loading of hydrophobic cargo. In one embodiment, the mesoporous metal oxide nanoparticle of embodiment 1, wherein the polar group is an amino group and the non-polar group is a methyl or a phenyl group. In one embodiment, the mesoporous metal oxide nanoparticle of embodiment 2, wherein the nanoparticle is aminated or methylated with an organosiloxane. In one embodiment, the mesoporous metal oxide nanoparticle of embodiments 1-3, wherein the nanoparticle is aminated with aminopropyltriethoxysilane (APTES) or 3-[2-(2-aminoethylamino)ethylamino]propyttrimethoxysilane (AEPTMS) or is methylated with hexamethyldisilazane (HDMS), sodium bis(trimethylsilyl)amide (NaHDMS) or potassium bis(trimethylsilyl)amide (KHDMS), or is functionalized with phenyltriethoxysilane (PTS). In one embodiment, the mesoporous metal oxide nanoparticle of embodiments 1-4, wherein the nanoparticle is a silica nanoparticle (MSNP) or an aluminum oxide (Al.sub.2O.sub.3) nanoparticle. In one embodiment, the mesoporous metal oxide nanoparticle has a differential pore volume of between about 0.25 cm.sup.3/g to about 10 cm.sup.3/g, e.g., from about 0.25 cm.sup.3/g to about 1.5 cm.sup.3/g. In one embodiment, the mesoporous metal oxide nanoparticle, wherein the nanoparticle has a nominal BET surface area of between about 50 m.sup.2/g to about 1,500 m.sup.2/g, more for example from about 100 m.sup.2/g to about 1,300 m.sup.2/g. In one embodiment, the mesoporous metal oxide nanoparticle of embodiments 1-7, wherein either: (a) the nanoparticle is methylated and is loaded with a cargo having a water solubility of between about less than 0.001 mg/mL to about 0.5 mg/mL; or (b) the nanoparticle is aminated and is loaded with a cargo having a water solubility of between about 0.2 mg/mL to greater than about 3,000 mg/mL In one embodiment, the mesoporous metal oxide nanoparticle of embodiments 1-10, wherein the nanoparticle is a silica nanoparticle (MSNP). In one embodiment, the mesoporous metal oxide nanoparticle, wherein the nanoparticle is methylated and is loaded with one or more small molecules which have a water solubility of between about less than 0.001 mg/mL to about 0.50 mg/mL. In one embodiment, the mesoporous metal oxide nanoparticle, wherein the small molecule is selected from the group consisting of paclitaxel, imatinib, curcumin, ciclopirox and ibuprofen.
[0610] In one embodiment, the mesoporous metal oxide nanoparticle is aminated and is loaded with a cargo having a water solubility of between about 0.2 mg/mL to greater than about 3,000 mg/mL, said cargo being selected from the group consisting of a small molecule, a mRNA, a siRNA, a shRNA, a micro RNA, a protein, a protein toxin (e.g., ricin toxin A-chain or diphtheria toxin A-chain) and/or DNA (including double stranded or linear DNA, minicircle DNA, plasmid DNA which may be supercoiled and/or packaged (e.g., with histones) and which may be optionally modified with a nuclear localization sequence). In one embodiment, the small molecule is selected from the group consisting of cisplatin, doxorubicin, gemcitabine, carboplatin, ciprofloxacin and ribavirin. In one embodiment, the nanoparticle is a silica nanoparticle (MSNP) which is loaded with cargo, and wherein the weight ratio of cargo to silica ranges from about 0.10 to about 0.75. In one embodiment, the nanoparticle is made by evaporation-induced self-assembly (EISA) or emulsion processing. In one embodiment, the mesoporous metal oxide nanoparticle of embodiments 1-15, wherein the nanoparticle is aminated or methylated and wherein the Zeta () potential of an aminated nanoparticle is between about 0 mV to about +40 mV, and wherein the Zeta () potential of a methylated nanoparticle is between about 40 mV to about 0 mV. In one embodiment, the nanoparticle is a silica nanoparticle (MSNP) made by an evaporation-induced self-assembly (EISA) process which includes the steps of: (a) preparing a precursor solution comprising (1) a surfactant (2) tetraethyl orthosilicate (TEOS), tetramethyl orthosilicate (TMOS) or a mixture thereof (3) a C.sub.1-4 alcohol (for example ethanol), and (4) water, wherein said surfactant, tetraethyl orthosilicate (TEOS), tetramethyl orthosilicate (TMOS) or a mixture thereof, C.sub.1-4 alcohol, and water are combined at a temperature below the surfactant's critical micelle concentration; (b) atomizing the precursor solution to generate droplets; (c) drying the droplets, thereby evaporating solvent and increasing effective surfactant concentration and inducing nanoparticle self-assembly; and (d) heating dried droplets, thereby evaporating residual solvent, inducing silica condensation and forming solid nanoparticles, wherein the degree of silica condensation is increased by thermal calcination to maximize the number of SiOSi bonds and reduced by using acidified ethanol to extract structure-directing surfactants.
[0611] In one embodiment, the surfactant is a cationic surfactant selected from the group consisting of a dodecylsulfate salt (e.g., sodium dodecylsulfate or lithium dodecylsulfate (SDS)), a tetradecyl-trimethyl-ammonium salt (e.g., tetradecyl-trimethyl-ammonium bromide (C.sub.14 TAB) or tetradecyl-trimethyl-ammonium chloride), a hexadecyltrimethylammonium salt (e.g., hexadecyltrimethylammonium bromide (C.sub.16; CTAB)), an octadecyltrimethylammonium salt (e.g., odadecyltrimethylammonium bromide (C.sub.18; OTAB)), a dodecylethyldimethylammonium salt (e.g., dodecylethyldimethylammonium bromide), a cetylpyridinium salt (e.g., cetylpyridinium chloride (CPC)), polyethoxylated tallow amine (POEA), hexadecyltrimethylammonium p-toluenesulfonate, a benzalkonium salt (e.g., benzalkonium chloride (BAC)), or a benzethonium salt (e.g., benzethonium chloride (BZT)) and mixtures thereof. In one embodiment, the nanoparticle has a nominal BET surface area of about 1,200 m.sup.2/g and the surfactant is hexadecyltrimethylammonium bromide (C.sub.16; CTAB). In one embodiment, the MSNP is further modified with SiOH. In one embodiment, the MSNP is further modified with PEG. In one embodiment, the nanoparticle is loaded with two or more different cargos. In one embodiment, the two or more different cargos are of different kinds. In one embodiment, the nanoparticle further comprises a targeting ligand. In one embodiment, the nanoparticle is loaded with one or more cargo components, said cargo being loaded either exclusively onto the nanoparticle surface or is loaded through pore and/or surface loading. In one embodiment, (a) the MSNP is methylated with hexamethyldisilazane (HDMS) and is loaded with a cargo having a water solubility of between about less than 0.001 mg/mL to about 0.5 mg/mL; or (b) the MSNP is aminated with aminopropyltriethoxysilane (APTES) and is loaded with a cargo having a water solubility of between about 0.2 mg/ml to greater than about 3,000 mg/ml; and (c) the surfactant is hexadecyltrimethylammonium bromide (C.sub.16; CTAB). In one embodiment, the precursor solution is dispersed within an oil phase to form a multiphase emulsion, and wherein: (a) the precursor solution comprises (1) tetraethyl orthosilicate (TEOS), tetramethyl orthosilicate (TMOS) or a mixture thereof, and (2) at least one cationic surfactant; and wherein (b) the oil phase comprises a C.sub.12-C.sub.20 alkane and a non-ionic emulsifier soluble in the oil phase. In one embodiment. (a) the emulsion is an oil-in-water emulsion; (b) the precursor solution comprises one or more components selected from the group consisting of: (1) hexadecyltrimethylammonium bromide (C.sub.16; CTAB), (2) a Brij surfactant (for example Brij56), (3) a block copolymer based on ethylene oxide and propylene oxide (for example Pluronic F108), optionally in combination with urea and/or polystyrene (PS) or glycerol monooleate, (4) a difunctional block copolymer surfactant terminating in a primary hydroxyl group (for example Pluronic P123), optionally in combination with (i) a triblock copolymer of poly(ethylene oxide) (PEO) or poly(propylene oxide) (PPO), and/or (ii) polypropylene glycol acrylate (PPGA); and wherein (c) the volumetric ratio of the precursor solution:oil phase is between about 1:2 to 1:4.
[0612] In one embodiment, the nanoparticle is a mesoporous silica nanoparticle (MSNP) which is self-assembled using a templating surfactant system comprised of at least one cationic surfactant. In one embodiment, protocell is also provided comprising a nanoparticle coated with a lipid bi- or multilayer. In one embodiment, the lipid bi- or multilayer is comprised of lipids selected from the group consisting of 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC), 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC), 1,2-dioleoyl-sn-glycero-3-[phosphor-L-serine] (DOPS), 1,2-dioleoyl-3-trimethylammonium-propane (18:1 DOTAP), 1,2-dioleoyl-sn-glycero-3-phospho-(1-rac-glycerol) (DOPG), 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE), 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine (DPPE), 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene glycol)-2000] (18:1 PEG-2000 PE), 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene glycol)-2000] (16:0 PEG-2000 PE), 1-oleoyl-2-[12-[(7-nitro-2-1,3-benzoxadiazol-4-yl)amino]lauroyl]-sn-glycero-3-phosphocholine (18:1-12:0 NBD PC), 1-palmitoyl-2-{12-[(7-nitro-2-1,3-benzoxadiazol-4-yl)amino]lauroyl}-sn-glycero-3-phosphocholine (16:0-12:0 NBD PC), cholesterol and mixtures thereof. In one embodiment, the lipid bi- or multilayer comprises DOPC in combination with DOPE. In one embodiment, the lipid bi- or multilayer comprises DOTAP, DOPG, DOPC or mixtures thereof. In one embodiment, the lipid bi- or multilayer comprises DOPG and DOPC. In one embodiment, the lipid bi- or multilayer further comprises cholesterol. In one embodiment, the lipid bi- or multilayer further comprises a cell targeting species. In one embodiment, the targeting species is a targeting peptide. In one embodiment, (a) the lipid bi- or multilayer comprises DOPC or DPPC in combination with DOPE, cholesterol and PEG-2000 PE (18:1); and (b) the targeting peptide targets cancer cells. In one embodiment, wherein at a pH of about 5, the protocel releases approximately 30% to approximately 100% of its cargo over a time period of about six hours after delivery. In one embodiment, (a) the nanoparticle is an aminated silica nanoparticle (MSNP); (b) the lipid bilayer comprises DOPC or DPPC in combination with DOPE, cholesterol and PEG-2000 PE (18:1); (c) the targeting peptide targets cancer cells; (d) the cargo comprises one or more hydrophilic anticancer active ingredients; and (e) at a pH of about 5, the protocell releases between about 30% to about 100% of its cargo at about three hours after delivery, and releases about 60% to about 100% of its cargo at about six hours after delivery. In one embodiment, (a) the nanoparticle is a methylated silica nanoparticle (MSNP) or a MSNP with functionalized with a phenyl group; (b) the lipid bilayer comprises DOPC or DPPC in combination with DOPE, cholesterol and PEG-2000 PE (18:1); (c) the targeting peptide targets cancer cells; (d) the cargo comprises one or more hydrophobic anticancer active ingredients; and (e) at a pH of about 5, the protocell releases between about 40% to about 90% of its cargo at about three hours after delivery, and releases about 90% to about 100% of its cargo at about twelve hours after delivery. In one embodiment, upon delivery, the protocell releases substantially all of its cargo through burst release over a period of about twelve hours. In one embodiment, upon delivery, the protocell releases its cargo through sustained release at a rate of about 10% weight cargo per day over a period of about ten days. In one embodiment, the targeting peptide is selected from the group consisting of a S94 peptide, a MET binding peptide or mixtures thereof. A pharmaceutical composition comprising: (a) a therapeutically effective amount of nanoparticles, said nanoparticles being loaded with one or more active ingredients; and (b) optionally, one or more pharmaceutically acceptable excipients. In one embodiment, the composition may be administered intranasally, intradermally, intramuscularly, intraosseously, intraperitoneally, intravenously, subcutaneously or intrathecally. Embodiment 47. A pharmaceutical composition comprising: (a) a therapeutically effective amount of protocells; and (b) optionally, one or more pharmaceutically acceptable excipients. In one embodiment, the composition may be administered intranasally, intradermally, intramuscularly, intraosseously, intraperitoneally, intravenously, subcutaneously or intrathecally.
[0613] In one embodiment, a method of treating cancer is provided, the method comprising administering a therapeutically effective amount of a pharmaceutical composition to a subject in need thereof, wherein the compositions comprises nanoparticles that are loaded with one or more anticancer agents. In one embodiment, the cancer is hepatocellular carcinoma. In one embodiment, an evaporation-induced self-assembly (EISA) process for making a mesoporous silica nanoparticle (MSNP) is provided. The process including the steps of: (a) preparing a precursor solution comprising (1) a surfactant (2) tetraethyl orthosilicate (TEOS), tetramethyl orthosilicate (TMOS) or a mixture thereof (3) a C.sub.1-4 alcohol (for example, ethanol), and (4) water, wherein said surfactant, tetraethyl orthosilicate (TEOS), tetramethyl orthosilicate (TMOS) or a mixture thereof, C.sub.1-4 alcohol, and water are combined at a temperature below the surfactant's critical micelle concentration; (b) adding either (1) an amine-containing silane to the precursor solution to replace a controllable fraction of SiOSi bonds with SiRNH.sub.2 bonds, where R is a C.sub.1-12 hydrocarbon, or (2) a methyl or phenyl-containing organosiloxane to replace a controllable fraction of SiOSi bonds with SiRCH.sub.3 or SiR-Ph bonds, where R is a C.sub.1-12 hydrocarbon; (c) atomizing the precursor solution to generate droplets; (d) drying the droplets, thereby evaporating solvent and increasing effective surfactant concentration and inducing nanoparticle self-assembly; and (e) heating dried droplets, thereby evaporating residual solvent, inducing silica condensation and forming solid nanoparticles, wherein the degree of silica condensation is increased by thermal calcination to maximize the number of SiOSi bonds and is reduced by using acidified ethanol to extract structure-directing surfactants. In one embodiment, the precursor solution is dispersed within an oil phase to form a multiphase emulsion, and wherein: (a) the precursor solution comprises (1) tetraethyl orthosilicate (TEOS), tetramethyl orthosilicate (TMOS) or a mixture thereof, and (2) at least one cationic surfactant; and wherein (b) the oil phase comprises a Ci.sub.2-C.sub.20 alkane and a non-ionic emulsifier soluble in the oil phase. In one embodiment, the precursor solution is functionalized with an organosiloxane selected from the group consisting of aminopropyltriethoxysilane (APTES), 3-[2-(2-aminoethylamino)ethylamino]propyltrimethoxysilane (AEPTMS), hexamethyldisilazane (HDMS), sodium bis(trimethylsilyl)amide (NaHDMS), potassium bis(trimethylsilyl)amide (KHDMS) and phenyltriethoxysilane (PTS). In one embodiment, a method of diagnosing and/or treating a cancer, a bacterial infection or a viral infection is provided, the method comprising administering to a subject in need thereof a population of nanoparticles, wherein said nanoparticles are optionally coated with a lipid bi- or multilayer. In one embodiment, a method of diagnosing and/or treating a cancer, a bacterial infection or a viral infection, the method comprising administering to a subject in need thereof a population of nanoparticles, wherein said nanoparticles are coated with a lipid b- or multilayer which comprises a reporter. In one embodiment, a kit comprising a population of nanoparticles and/or a population of protocells and, optionally, instructions for the use of the protocells in the diagnosis and treatment of a cancer or a bacterial or viral infection is provided. In one embodiment, (a) the nanoparticle is loaded with the naked siRNA TD101 and the protocell is useful in the treatment of Pachyonychia Congenita; or (b) the nanoparticle is loaded with the naked siRNA 15NP and the protocell is useful in the treatment of delayed graft function associated with kidney transplant; or (c) the nanoparticle is loaded with the naked siRNA SYL040012 and the protocel is useful in the treatment of glaucoma and/or ocular hypertension; or (d) the nanoparticle is loaded with the naked siRNA SYL1001 and the protocell is useful in the treatment of dry eye syndrome; or (e) the nanoparticle is loaded with the naked siRNA Bevasiranib and the protocell is useful in the treatment of Wet AMD or Diabetic AMD; or (f) the nanoparticle is loaded with the naked siRNA QPI-1007 and the protocel is useful in the treatment of chronic optic nerve atrophy; or (g) the nanoparticle is loaded with the naked siRNA Sima-027/AGN211745 and the protocell is useful in the treatment of AMD and CNV; or (h) the nanoparticle is loaded with the naked siRNA PF-655 and the protocell comprising is useful in the treatment of AMD/DME.
[0614] In one embodiment, the nanoparticle is loaded with the siRNA siG12D and the protocell is useful in the treatment of pancreatic cancer. In one embodiment, the nanoparticle is loaded with the siRNA TKM-PLK1 (PLK1 SNALP, TKM-080301) and the protocell is useful in the treatment of a solid tumor and primary and secondary liver cancer. In one embodiment, the nanoparticle is loaded with the siRNA siRNA-EphA2-DOPC and the protocell is useful in the treatment of a solid tumor. In one embodiment, (a) the nanoparticle is loaded with the aptamer C2 (2F RNA) and the protocell is useful in the treatment of leukemia cancer or a skin cancer, or (b) the nanoparticle is loaded with the aptamer EpDT3 (2F RNA) and the protocell is useful in the treatment of colon cancer or breast cancer, or (c) the nanoparticle is loaded with the aptamer PSM-A10 (2F RNA) and the protocell is useful in the treatment of prostate cancer; or (d) the nanoparticle is loaded with the aptamer S6 (2F RNA) and the protocell is useful in the treatment of breast cancer; or (e) the nanoparticle is loaded with the aptamer C1 (2F RNA) and the protocell is useful in the treatment of breast cancer; or (f) the nanoparticle is loaded with the aptamer CL4 (2F RNA) and the protocel is useful in the treatment of breast cancer; or (g) the nanoparticle is loaded with the aptamer YJ1 (2F RNA) and the protocell is useful in the treatment of metastatic colon cancer; or (h) the nanoparticle is loaded with the aptamer Aptamer 14 (2F RNA) and the protocel is useful in the treatment of leukemia; or (i) the nanoparticle is loaded with the aptamer C10 (DNA) and the protocell is useful in the treatment of Burkitt like lymphoma; or (j) the nanoparticle is loaded with the aptamer Sgc8 (DNA) and the protocell is useful in the treatment of acute lymphoblastic leukemia; or (k) the nanoparticle is loaded with the aptamer TA6 (DNA) and the protocell is useful in the treatment of breast cancer, lymphoma and melanoma.
REFERENCES
[0615] 2007. Target Product ProfileA Strategic Development Process Tool, Food and Drug Administration [0616] Arias et al., Nat. Rev. Microbiol., 10:266 (2012). [0617] Al et al., Curr. Pharm. Des., j1:1644 (2010). [0618] Aloush et al., Antimicrob. Agents Chem., 50:43 (2006). [0619] Ashley et al., ACS Nano, 6:2174 (2012). [0620] Ashley et al., Nat. Mater., 10:389 (2011). [0621] Bai et al., Biomaterials, U:659 (2012b). [0622] Bai et al., PLOS ONE, 7:e29886 (2012a). [0623] Berge et al., Am. J. Hyg 73: 209-18 (1961). [0624] Brinker at al., Advanced Materials. 11:579 (1999). [0625] Calhoun et al., Clin. Orthoo. Related Res., 466:1356 (2008). [0626] Carroll et al., Lanamuir. 25:13540 (2009). [0627] Cauda et al., Nano Letters, 10:2484 (2010). [0628] Chen et al., Accounts of Chemical Research, 44:841 (2011). [0629] Chong et al., Cell, 158:314 (2014). [0630] Chrastina, A, et al. J Vasc Res. 47: 531-43. 2010. [0631] Clemens et al., Antimicrobial Agents and Chemotherapy, 56:2535 (2012). [0632] Comiskey et al., Biochemistry, 22:3626 (1990). [0633] Conley et al., Antimicrobial Agents and Chemotherapy, 41:1288 (1997). [0634] Couvreur and Vauthier, Pharmaceutical Research, 21:1417 (2006). [0635] Dengler et al., Journal of Controlled Release, 168:209 (2013). [0636] des Rieux et al., Journal of Controlled Release, 116:1 (2006). [0637] Diamond, Antiviral Res., 83:214 (2009). [0638] Dietz et al., J. Virol., 87:6172 (2013). [0639] Edwards, Immunodiagnostic: A Practical Approach. Oxford University Press, Oxford; England, (1999) [0640] El-Sayed et al., J. Biol. Chem., 283:23450 (2008). [0641] Epler at al., Advanced Healthcare Materials, 1:348 (2012). [0642] Fleming et al., J. Trauma Acute Care Surg. 14:1067 (2013). [0643] Gao et al., J. Phys. Chem. B., 11:1796 (2009). [0644] Gavrilov et al., Yale J. Biol. Med., 855:187 (2012). [0645] Georges-Courbot at al., Antimicrobial Agents and Chemotherapy, 50:1768 (2006). [0646] Giri at al., Nanomedicine, 2:99 (2007). [0647] Goodchild et al., Antiviral Res., 90:1 (2011). [0648] Gottesman and Storz, Cold Spring Harbor Perspectives in Biology. [0649] Grabrucker et al., PLoS ONE. 6:e17851 (2011). [0650] Grassin-Delyle et al., Pharmacology & Therapeutics, 134:366 (2012). [0651] Hafner et al., Clinical Chemistry, 50:490 (2004). [0652] Hanson et al., J. Vis. Exp. (2013). [0653] Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press (1999). [0654] Harmon at al., J. Virol., 86:12954 (2012). [0655] He et al., Small, 5:2722 (2009). [0656] Hosoya et al., Antimicrobial Agents and Chemotherapy, 48:4631 (2004). [0657] Hudson et al., PLOS ONE. 9:e99209 (2014). [0658] Huggins et al., Antimicrobial Agents and Chemotherapy, 26:476 (1984). [0659] Hujer et al., Antimicrobial Agents and Chemotherapy. 50:4114 (2006). [0660] Jackson et al., Vet. Pathol., 28:410 (1991). [0661] Jain et al., N. Engl. J. Med., 364:1419 (2011). [0662] Kawakami et al., Gene therapy, 7:292 (2000). [0663] Kim et al., PLOS ONE, 8:e68988 (2013). [0664] LaCasse at al., Nucl. Acids Res., 23:1647 (1995). [0665] Lin et al., Journal of the American Chemical Society, 132:4834 (2010). [0666] Liong et al., Journal of Materials Chemistry, 19:6251 (2009). [0667] Liu et al., Chem. Comm., ___:5100 (2009). [0668] Liu et al., J. Amer. Chem. Soc., 11:7567 (2009). [0669] Liu, J W, et al., Journal of the American Chemical Society, 131:1354-5. 2009. [0670] Lo et al., Molecular Cancer Therapeutics, 1:579 (2008). [0671] Lu et al., Nature, 28:223 (1999). [0672] Lu et al., Small, 6:1794 (2010). [0673] Mann and Markham, Journal of Applied Microbiology, 84:538 (1998). [0674] Mason et al., Antimicrobial Agents and Chemotherapy, 39:2752 (1995). [0675] Meng et al., ACS Nano. 4:4539 (2010). [0676] Meng et al., ACS Nano. 5:4434 (2011). [0677] Merkus et al., Drugs in R & D, 8:133 (2007). [0678] Meyer et al., Fresenius' Journal of Analytical Chemistry, 363:174 (___). [0679] Mofaie at al., Asian Pac J Cancer Prev., 14:7045 (___). [0680] Moon et al., Advanced Materials, 24:3724 (2012). [0681] Moon et al., Journal of Chromatography A. 813:91 (1998). [0682] Moon et al., Nat Mater, 12:243 (2011). [0683] Moore et al., The Journal of Gene Medicine, 10:1134 (2008). [0684] Moreau et al., Chem. Mater., 25:2394 (2013). [0685] Morilla et al., Intracellular Delivery, ed. A Prokop, pp. 745-811: Springer Netherlands [0686] Murat Cokol et al., at the website ubic.bioc.columbia.edu/papers/2000 nls/paper.html#tab2. [0687] Murray at al., Bacteiology of War Wounds at the Time of Injury, Military Medicine, 171:826 (2006). [0688] Musa at al., J. Applied Sci., 11: 3650 (2011). [0689] Musa et al., J. Applied Sci. 11:3850 (2011). [0690] Nasser et al., J. Virol., 1.2:10169 (2010). [0691] National Institute of Standards and Technology (NIST) (Particle Size Characterization, Special Publication 960-1, January 2001). [0692] Nielsen et al., Molec. Biol., 1:89 (1999). [0693] Nocker et al., Journal of Microbiological Methods. 67:310 (2006). [0694] Nordmann et al., Lancet Infect. Dis., 9:228 (2009). [0695] O'Brien et al., Virology, 426:100 (2012). [0696] O'Brien. Antiviral Res., 75:20 (2007). [0697] Oldenborg et al., Science, 288:2051 (2000). [0698] Paessler et al., J. Infect. Dis., 18:2072 (2004). [0699] Palomino et al., Antimicrobial Agents and Chemotherapy, 46:2720 (2002). [0700] Pascal et al. ACS Nano. 7, 11174 (2013). [0701] Paterson and Bonomo, Clinical Microbiology Reviews, 18:657(2005). [0702] Peer et al., Nat. Nano., 2:751 (2007). [0703] Pinto-Alphandary et al., International journal of antimicrobial agents. 13:155 (2000). [0704] Rajasekaran et al., Int J Antimicrob Agents, 41:358 (2013). [0705] Reed et al., J. Infect. Dis., 189:1013 (2004). [0706] Reed et al., Vaccine, 3:3139 (2005). [0707] Rockx et al., J. Virol., 84:9831 (2010). [0708] Rosi et al., Science, 12:1027 (2006). [0709] Rulker et al., PLoS One, 1:e37242 (2012). [0710] Rungta et al., Molecular Therapy Nucleic Acids, 2:e136 (2013). [0711] Salazar et al., Zoonoses Public Health, 59:278 (2012). [0712] Sambrook et al., Sambrook et al., 2001; Ausubel, ed., 1994, Current Protocols in Molecular Biology Vol. I-III; Cells, ed. (2001). [0713] Sambrook et al., Animal Cell Culture: IRL (1986). [0714] Sambrook et al., Cell Biology: A Laboratory Handbook. Vol. I-III; Coligan, ed. (1994), [0715] Sambrook et al., 1994, Current Protocols in Immunology, Vol. I-III; Gait ed. (1994). [0716] Sambrook et al., 1985, Nucleic Acid Hybridization: Hames & Higgins, eds., (1985). [0717] Sambrook et al., 1984, Oligonucleotide Synthesis; Hames & Higgins eds. (1984). [0718] Sambrook et al., ranscription And Translation; Freshney, ed., (1984). [0719] Sandor et al., Immunobiology (2006). [0720] Sautto et al., Biomed Research International, 2013: ___(2013). [0721] Schlobauer et al., Advanced Healthcare Materials, 1:316 (2012). [0722] Schmidt C S, Morrow W J W, Sheikh N A. 2007. Smart adjuvants. Expert Review of Vaccines 6: 391-400 [0723] Sener et al., Journal of Clinical Microbiology, 4:1124 (2011), [0724] Sindac, J, et al. J. Med. Chem. 55: 3535-45 (2012). [0725] Snell, Expert Opin Pharmacother., 2:1317 (2001). [0726] Sommerman, Factors Influencing The Biodistribution of Liposomal Systems. The University of British Columbia. 163 pp. [0727] Soofi and Seleem. Antimicrob Agents Chemother., 56.6407 (2012). [0728] Souris et al., Biomaterials. 1:5564 (2010). [0729] Steele et al., Vet Pathol., 47:790 (2010). [0730] Stephen et al., ICN Pharmaceuticals Scientific Symposium, (1979). [0731] Takeuchi et al., Advanced Materials, 17:1067 (2005). [0732] Tam et al., Accounts of Chemical Research, 46:792 (2013). [0733] Townson et al., Journal of the American Chemical Society. 35:16030 (2013). [0734] Walters et al., ASN NEURO, 4:art:e00099 (2012). [0735] Weaver et al., Am J. Trop. Med. Hyg., 60:441 (1999). [0736] Weaver et al., Lancet VEE Study Group, 436:40 (1996). [0737] Weis, TIBS, 2:185 (1998). [0738] Weis, Trends Biochem. Sci., 1998 23:235 (1998). [0739] Weksler et al., Fluids and Barriers, 102013. [0740] White et al., Am. J. Trop. Med. Hyg., 84:709 (2011). [0741] Wong et al., Journal of Controlled Release, 92:265 (2003). [0742] Woodford and Wareham, Journal of Antimicrobial Chemotherapy, 3:225 (2009). [0743] Zanta et al., Proc. Natl. Acad. Sci. USA, 96:91 (1999). [0744] Zhang et al., J. Controlled Release, 123:1 (2007). [0745] Zhang et al., Journal of the American Chemical Society, 134:15790 (2012). [0746] Zhao et al., ACS Nano, 5:1366 (2011).
[0747] All publications, patents and patent applications are incorporated herein by reference. While in the foregoing specification, this invention has been described in relation to certain preferred embodiments thereof, and many details have been set forth for purposes of illustration, it will be apparent to those skilled in the art that the invention is susceptible to additional embodiments and that certain of the details herein may be varied considerably without departing from the basic principles.