ANTI-TRKA ANTIBODY
20190263932 ยท 2019-08-29
Inventors
- Catherine Brautigam Beidler (Poway, CA)
- Daniel Scott Girard (San Diego, CA, US)
- Chetankumar Natvarlal Patel (Fishers, IN)
Cpc classification
C07K16/2863
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/51
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
International classification
Abstract
Antibodies to tropomysin receptor kinase (TrkA), compositions including such antibodies, and methods of using such antibodies for the treatment of pain including post-surgical pain, rheumatoid arthritis pain, neuropathic pain and osteoarthritis pain.
Claims
1. An antibody that binds tropomysin receptor kinase (TrkA) comprising a heavy chain variable region (HCVR) and a light chain variable region (LCVR), wherein the HCVR comprises complementarity determining regions (CDRs) HCDR1, HCDR2, and HCDR3 and the LCVR comprises CDRs LCDR1, LCDR2, and LCDR3, wherein the amino acid sequence of HCDR1 is SEQ ID NO. 3, the amino acid sequence of HCDR2 is SEQ ID NO. 4, the amino acid sequence of HCDR3 is SEQ ID NO. 5, the amino acid sequence of LCDR1 is SEQ ID NO. 7, the amino acid sequence of LCDR2 is SEQ ID NO. 8, and the amino acid sequence of LCDR3 is SEQ ID NO. 9.
2. The antibody of claim 1, wherein X.sub.aa at residue 10 of SEQ ID NO. 7 is A.
3. The antibody of claim 1, wherein X.sub.aa at residue 10 of SEQ ID NO. 7 is Q.
4. The antibody of claim 1, wherein the amino acid sequence of the HCVR is SEQ ID NO. 10 and the amino acid sequence of the LCVR is SEQ ID NO. 11.
5. The antibody of claim 4, wherein X.sub.aa at residue 33 of SEQ ID NO. 11 is A.
6. The antibody of claim 4, wherein X.sub.aa at residue 33 of SEQ ID NO. 11 is Q.
7. An antibody that binds tropomysin receptor kinase (TrkA) comprising a heavy chain (HC) and a light chain (LC), wherein the amino acid sequence of the HC is selected from the group consisting of SEQ ID NO. 1 and SEQ ID NO. 2, and wherein and the amino acid sequence of the LC is SEQ ID NO. 6.
8. The antibody of claim 7, wherein there are two HCs, each of which have the amino acid sequence of SEQ ID NO. 1, and wherein there are two LCs, each of which has the amino acid sequence of SEQ ID. NO. 6.
9. The antibody of claim 8, wherein X.sub.aa at residue 33 of SEQ ID NO. 6 is A.
10. The antibody of claim 8, wherein X.sub.aa at residue 33 of SEQ ID NO. 6 is Q.
11. The antibody of claim 7, wherein there are two HCs, each of which have the amino acid sequence of SEQ ID NO. 2, and wherein there are two LCs, each of which has the amino acid sequence of SEQ ID. NO. 6.
12. The antibody of claim 11, wherein X.sub.aa at residue 33 of SEQ ID NO. 6 is A.
13. The antibody of claim 11, wherein X.sub.aa at residue 33 of SEQ ID NO. 6 is Q.
14. A pharmaceutical composition comprising an antibody of claim 1 and one or more pharmaceutically acceptable carriers, diluents or excipients.
15. A method of treating pain comprising administering to a patient in need thereof an effective amount of an antibody of claim 1.
16. The method of claim 15, wherein the pain is one of post-surgical pain, neuropathic pain, rheumatoid arthritis pain and osteoarthritis pain.
17. The method of claim 15, wherein the pain is chronic pain.
18. A method of treating pain comprising administering to a patient in need thereof the pharmaceutical composition of claim 14.
19. The method of claim 18, wherein the pain is one of post-surgical pain, neuropathic pain, rheumatoid arthritis pain and osteoarthritis pain.
20. The method of claim 18, wherein the pain is chronic pain.
21. An antibody of claim 1 for use in therapy.
22. An antibody of claim 1 for use in the treatment of pain.
23. An antibody for use according to claim 22 wherein the pain is one of post-surgical pain, rheumatoid arthritis pain, neuropathic pain, and osteoarthritis pain.
24. An antibody for use according to claim 22 wherein the pain is chronic pain.
25. The use of an antibody of claim 1 in the manufacture of a medicament for the treatment of pain.
26. The use according to claim 25 wherein the pain is one of post-surgical pain, neuropathic pain, rheumatoid arthritis pain and osteoarthritis pain.
27. The use according to claim 25 wherein the pain is chronic pain.
Description
Examples
[0045] The Examples use some of the presently claimed antibodies, including mAb A, mAb B, mAb C, mAb D, and mAb E, wherein the sequences of such antibodies are given herein.
Example 1. Engineering, Expression, and Purification of mAbs A-E
[0046] To develop antibodies specific for TrkA, AlivaMab mice (Ablexis), transgenic for human immunoglobulin variable regions, are immunized with His-tagged Human TrkA extracellular domain (ECD). Mouse B cells positive for human TrkA binding are sorted by Fluorescence-activated cell sorting (FACS) and antibodies are cloned by single cell Polymerase Chain Reaction (PCR) as human IgG4PAA/Kappa antibodies. The engineered molecule is made as both an IgG4PAA isotype and an IgG1EN isotype.
[0047] The antibodies of the invention can be biosynthesized, purified, and formulated for administration by well-known methods. An appropriate host cell, such as Chinese hamster ovarian cells (CHO), is either transiently or stably transfected with an expression system for secreting antibodies using a predetermined HC:LC vector ratio if two vectors are used, or a single vector system encoding both heavy chain and light chain. Vectors suitable for expression and secretion of antibodies from these commonly-used host cells are well-known. Following expression and secretion of the antibody, the medium is clarified to remove cells. Clarified medium is applied to a Protein A affinity column that has been equilibrated with a compatible buffer, such as PBS (pH 7.4). The column is washed with buffer supplemented with 1M NaCl to remove nonspecific binding components. Bound antibody is eluted, for example, with sodium citrate at pH 3.5 and fractions are neutralized with 1M 2-amino-2-(hydroxymethyl)propane-1,3-diol (Tris) buffer. Antibody fractions are detected, such as by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) or analytical size-exclusion, and then are pooled. Soluble aggregate and multimers may be effectively removed by common techniques, including size exclusion, hydrophobic interaction, ion exchange, or hydroxyapatite chromatography. An exemplified antibody of the present invention is concentrated and/or sterile filtered using common techniques. The purity of exemplified antibody after these chromatography steps is greater than 95% and samples may be immediately frozen at 70 C. or stored at 4 C. for several months.
The ability of the present Example antibodies to bind to and or inhibit signalling by TrkA can be assessed according to Examples 2-7.
Example 2. Binding Kinetics and Affinity of mAbs A-E
[0048] The binding kinetics and affinity of exemplified antibodies to human, cynomolgus monkey, rat, mouse, and rabbit TrkA are determined as described below using a surface plasmon resonance assay on a BIACORE 8K instrument (GE Healthcare). Two different isoforms of human TrkA (isoform 1 and isoform 2) are evaluated along with human TrkB and human TrkC. The BIACORE 8K is primed with HBS-EP+ running buffer [10 mM 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid (Hepes pH 7.4, 150 mM NaCl, 3 mM ethylenediaminetetraacetic acid (EDTA), 0.05% polysorbate 20 surfactant (P20, TWEEN 20)]. The analysis temperature is set at 37 C. and the sample compartment is set at 15 C. Binding kinetics and affinities are obtained using a parallel kinetics assay with an antibody capture method. Antibodies are captured onto a Series-S Sensor Protein A CMS chip (GE Healthcare). For each channel, Flow Cell 1 (FC1) is designated as a buffer reference and Flow Cell 2 (FC2) is designated for antibody capture. All FC2 on all eight channels are set to capture approximately 89 response units (RU) of antibody at a flow rate of 10 L/min. The antibody sample is prepared at 1 g/mL by dilution into the running buffer. The human TrkA isoform 1 and 2, mouse, rat, rabbit and cynomolgus monkey TrkA analytes are prepared at a final concentration of 400, 200, 100, 50, 25, 12.5, 6.25, and 3.125 nM by dilution into the running buffer. The human TrkB and TrkC analytes are prepared at a final concentration of 800, 400, 200, 100, 50, 25, 12.5, and 6.25 nM by dilution into the running buffer. Before the analysis cycle, the chip is regenerated with 3 injections of glycine (pH 1.5) at 100 L/min for a contact time of 15 seconds on FC1 and FC2 in order to clean the surface of the chip. Regeneration is followed by a conditioning step consisting of (1) 5 g/mL of an IgG4 isotype control antibody at 5 L/min for 15 seconds on FC2; (2) running buffer at 30 L/min for 250 seconds and dissociation for 600 seconds on FC1 and FC2; (3) chip surface regeneration with an injection of glycine (pH 1.5) at 100 L/min for a contact time of 15 seconds. Each analysis cycle consists of: (1) capturing the test antibody on all eight FC2, where all eight respective FC1 pairs are used as a buffer reference, at 10 L/min; (2) running buffer wash step; (3) injection of TrkA, TrkB, or TrkC, at 100 L/min for a contact time of 120 seconds on channels 1-8 in order of descending concentration; (4) return to buffer flow for a dissociation time of 600 seconds; (5) regeneration of the chip surface with two injections of glycine(pH 1.5), at 100 L/min for 15 seconds per injection; (6) final running buffer wash step . Data is processed using predefined antibody parallel kinetics with reference subtraction and fit to a 1:1 binding model using BIACORE 8K evaluation software (version 1.1.1.7442) to determine the association rate (on-rate, kon, M.sup.1s.sup.1 units) and the dissociation rate (off-rate, koff, s.sup.1 units). The equilibrium dissociation constant (K.sub.D) is calculated from the relationship K.sub.D=k.sub.off/k.sub.on, in molar units. The average (Avg) K.sub.D and error, reported as the standard deviation (SD), is determined from three independent experiments unless noted otherwise. Exemplified antibodies demonstrate concentration-dependent binding to human, cynomolgus monkey, rat, mouse, and rabbit TrkA. At the highest concentration of human TrkB and human TrkC injected (800 nM), the binding response signal does not reach the theoretical half-maximal response signal. As a result, the K.sub.D of tested antibodies to human TrkB and human TrkC is estimated to be >800 nM. The results are shown in Table 1.
TABLE-US-00007 TABLE 1 BIACORE binding kinetics and affinity of mAbs A-E K.sub.D # k.sub.off (1/s) (nM) Rep- k.sub.on (1/Ms) Avg Avg li- Antibody Analyte Avg SD SD SD cates mAb A Human TrkA 1.8 0.1 E5 7.2 0.03 4.1 0.2 3 Isoform 2 E4 Human TrkA 1.8 0.2 E5 6.9 0.1 3.9 0.5 3 Isoform 1 E4 Human TrkB K.sub.D >800 nM 3 Human TrkC K.sub.D >800 nM 3 Mouse TrkA 1.1 0.1 6.9 0.2 6.1 0.5 3 E5 E4 Rat TrkA 1.4 0.1 6.9 0.2 5.1 0.5 3 E5 E4 Cynomolgus 1.9 0.1 6.9 0.04 3.6 0.2 3 monkey E5 E4 TrkA Rabbit TrkA 2.1 0.1 6.1 0.1 2.9 0.2 3 E5 E4 mAb B Human TrkA 1.9 0.1 1.3 0.01 6.8 0.5 3 Isoform 2 E5 E3 Human TrkA 1.9 0.3 1.3 0.01 6.7 0.9 3 Isoform 1 E5 E3 Human TrkB K.sub.D >800 nM 3 Human TrkC K.sub.D >800 nM 3 Mouse TrkA 1.2 0.1 1.2 0.04 10.5 0.7 3 E5 E3 Rat TrkA 1.3 0.1 1.2 0.05 9.1 1.0 3 E5 E3 Cynomolgus 1.9 0.2 1.3 0.02 6.9 0.8 3 monkey E5 E3 TrkA Rabbit TrkA 2.2 0.1 1.1 0.05 5.0 0.3 3 E5 E3 mAb C Human TrkA 2.0 0.1 1.3 0.04 6.6 0.4 3 Isoform 2 E5 E3 Human TrkA 2.0 0.1 1.3 0.06 6.7 0.6 3 Isoform 1 E5 E3 Human TrkB K.sub.D >800 nM 3 Human TrkC K.sub.D >800 nM 3 Mouse TrkA 1.2 0.4 1.2 0.04 10.2 0.5 3 E5 E3 Rat TrkA 1.3 0.1 1.2 0.04 9.0 0.2 3 E5 E3 Cynomolgus 2.0 0.2 1.3 0.03 6.6 0.6 3 monkey E5 E3 TrkA Rabbit TrkA 2.2 0.1 1.1 0.1 4.7 0.4 3 E5 E3 mAb D Human TrkA 2.5 1.3 E03 4.9 1 Isoform 2 E+05 Human TrkA 2.8 1.2E03 4.4 1 Isoform 1 E+05 mAb E Human TrkA 2.6 1.4E03 5.2 1 Isoform 2 E+05 Human TrkA 2.7 1.3E03 4.8 1 Isoform 1 E+05
The sequences of the Trk proteins listed in the Analyte column in Table 1 are given below in SEQ ID NOs. 20-27.
Example 3. In Vitro Neurite Outgrowth Assay of mAbs A-E
[0049] Inhibition of NGF induced neurite outgrowth on neurons is assessed using rat NEUROSCREEN-1 cells (pheochromocytoma PC12 subclone, CELLOMICS). The cells are maintained in F-12K basal medium, 12.5% heat inactivated horse serum, 2.5% heat inactivated fetal bovine serum (FBS), 1 GlutaMAX (INVITROGEN, Cat. #35050061), and 1 Anti-Anti (INVITROGEN, Cat. #15240) at 37 C., 95% humidity, in collagen coated flasks. To measure neurite outgrowth, the NEUROSCREEN-1 cells are seeded into Collagen I 96-well plates at 2000 cells per well in growth medium using only the interior 60 wells. On the following day, the medium is removed and replaced with fresh growth medium containing an 8 point dilution series of anti-TrkA antibodies in the presence or absence of NGF (R&D SYSTEMS, Cat #:256-GF) at 25 ng/mL. There are three technical replicates for each point in the dilution series. The plates are incubated for 4 days at 37 C., 95% humidity, and then fixed with 1 Prefer fixative (Anatech, Ltd) for 1 hour. The plates are washed twice with 1 Dulbecco's Phosphate-Buffered Saline (DPBS) and once with 1 NO buffer [1 DBPS, 0.5% bovine serum albumin (BSA), 0.01% saponin]. The cells are immuno-stained overnight with primary antibody mouse anti-beta 3 tubulin (TU-20, INVITROGEN, Cat. #MA1-19187) diluted 1:800 in NO buffer and for >2 hours with secondary antibody goat anti-mouse DYLIGHT 488 (INVITROGEN, Cat. #35502) diluted 1:500 in NO buffer. The plates are washed once with NO buffer, twice with DPBS, sealed, and loaded onto the CELLINSIGHT Instrument for high content imaging and analysis using the Neuronal Profiling v4.0 algorithm. Data generated by the algorithm is processed for IC.sub.50 calculation with GraphPad PRISM software. The results are shown in Table 2.
TABLE-US-00008 TABLE 2 In vitro Neurite Outgrowth Activity Antibody IC50 (nM) % Max Stimulation mAb A 0.10 7 mAb B 0.07 10 mAb C 0.06 7 mAb D 0.08 17 mAb E 0.07 17
[0050] Exemplified anti-TrkA antibodies show concentration-dependent inhibition of NGF-induced neurite outgrowth. Exemplified antibodies D and E showed consistently greater stimulatory effects on neurite outgrowth in the absence of NGF.
Example 4. Inhibition of NGF-Induced Phosphorylation of Human or Rat TrkA of mAbs A-E (and some Comparative Data)
[0051] Inhibition of rat or human NGF-stimulated phosphorylation of TrkA is assessed in cells that were transfected and express either the rat or human TrkA receptor in human embryonic kidney cells (HEK293) or standard fibroblast cells (3T3) background, respectively. Cells are incubated with PBS or test antibody for 5 minutes prior to a 5 minute stimulation with or without 10 g/mL rat or human -NGF at room temperature. Antibody concentrations range from 1 M to 0.1 pM to 1 in a volume of 300-450 L PBS (Gibco, Cat #20012-027) in 1.5 mL Eppendorf tubes. Samples are frozen on dry ice and stored at 80 C. until extraction. Cell Lysis buffer consists of 2 Tissue Lysis buffer (CELL SIGNALLING TECHNOLOGY, Cat. #9803S), with 100 HALT protease and phosphatase inhibitor cocktail (ThermoFisher) and 1 mM phenylmethylsulfonyl fluoride. Lysis buffer is added to each tube and homogenized (Qiagen Homogenizer) for 10 seconds on ice. Supernatants resulting from centrifugation at 4 C. for 15 minutes at 12,000 relative centrifugal force (RCF) are analyzed by ELISA methods to measure pTrkA, using methods described in Price et al (J Neurosci Methods 282:34-42, 2017), each sample measured in duplicate or quadruplicate.
[0052] Either the rat TrkA capture antibody (R&D SYSTEMS, Cat. #AF1056) or the human TrkA capture antibody (R&D SYSTEMS, Cat. #MAB1751) is diluted carbonate-bicarbonate buffer (PIERCE CHEMICAL, Cat. #28382) to 3 g/mL and 100 L per well is used to coat Black MAXISORP 96 well plates (NUNC, Cat. #446471) overnight at 4 C. Plates are washed with 20 mM Tris-buffer saline containing 150 mM NaCl, pH 7.4 (TBS), blocked with 3% BSA (Sigma, Cat. #A3059) in TBS for 1 hour at room temperature, then blotted dry, sealed and stored at 4 C. before using within 2 weeks. Homogenates described above (100 L) are added to each well and incubated at 4 C. overnight. Plates are washed with TBST (TBS with 0.05% TWEEN-20, 3 300 L/well) and the rabbit Phospho-TrkA (Tyr674/675)/TrkB (Tyr706/707) (CELL SIGNALLING TECHNOLOGY, Cat. #4621) diluted 1:20,000 in 1% BSA/TBST, 100 L per well added, and incubated for 2 hours at room temperature. Plates are washed as before and a secondary antibody, goat anti-rabbit alkaline phosphatase (Jackson Immunoresearch Labs, Cat. #111-055-144) is diluted 1:20,000 in 1% BSA/TBST, 100 L per well added, and incubated for 1 hour at room temperature. Plates are washed 5300 L/well with TBST and 100 L per well of alkaline phosphatase CDP-star substrate (APPLIED BIOSYSTEMS, Cat. #T2214) is added. Plates are read 30 minutes later in an Envision (PerkinElmer) plate reader with an enhanced luminescent protocol. Resulting counts per second (CPS) are converted to percent of NGF signal with the equation: 100*(CPS sampleCPS control)/(CPS NGF CPS control), plotted versus the concentration of exemplified antibodies, and a four parameter curve fit is determined using Graph Pad PRISM 7 to give the IC.sub.50/EC.sub.50 values.
TABLE-US-00009 TABLE 3 Inhibition of NGF-induced phosphorylation of human TrkA mAb A mAb D mAb E mAb C mAb B Counts per second (x 1000) PBS 160.2 346.0 149.9 162.8 216.7 10 g/mL NGF 1727.0 2937.7 1462.2 1639.1 2862.2 +1 M mAb 341.3 971.2 629.8 394.5 438.5 +100 nM mAb 390.3 1444.1 739.0 511.3 446.1 +10 nM mAb 570.8 1204.5 799.5 620.1 717.4 +1 nM mAb 790.6 1348.6 837.9 1088.4 1072.1 +100 pM mAb 1207.6 2011.9 2777.7 2342.0 3969.5 +10 pM mAb 1540.7 2685.0 2756.0 2400.2 3436.8 +1 pM mAb 1442.3 2787.1 2194.4 1918.5 4337.0 +0.1 pM mAb 1195.6 2557.8 1853.3 2265.3 IC50 and maximal inhibition from curve fits IC50 (nM) 0.77 0.12 0.48 0.80 0.58 % Max Inhibition 86% 66% 57% 77% 88%
TABLE-US-00010 TABLE 4 Inhibition of NGF-induced phosphorylation of rat TrkA mAb A mAb D mAb E mAb C mAb B Counts per second (x 1000) PBS 220.4 472.6 504.7 605.0 591.8 10 g/mL NGF 2129.7 3254.4 2760.0 2812.1 4292.6 +1 M mAb 580.5 1932.3 1878.6 1296.5 2990.3 +100 nM mAb 544.4 2589.5 1699.3 1583.0 2337.2 +10 nM mAb 709.8 2429.8 2232.2 1529.4 2865.2 +1 nM mAb 1147.9 3158.7 2267.4 2669.0 3299.7 +100 pM mAb 1685.4 3792.3 3701.4 2946.6 5162.9 +10 pM mAb 2201.1 4515.5 3444.4 3680.1 4456.1 +1 pM mAb 2091.6 4056.7 3379.5 3050.8 4862.9 +0.1 pM mAb 1826.8 4533.3 2939.4 3377.0 4786.9 IC50 and maximal inhibition from curve fits IC50 (nM) 0.57 0.68 0.68 1.6 0.72 % Max Inhibition 82% 40% 37% 65% 42%
TABLE-US-00011 TABLE 5 Stimulation of human TrkA phosphorylation mAb A mAb D mAb E mAb C mAb B Counts per second (x 1000) PBS 160.2 346.0 149.9 162.8 216.7 10 g/mL NGF 1727.0 2937.7 1462.2 1639.1 2862.2 1 M mAb 348.6 1022.2 482.8 420.5 366.6 100 nM mAb 385.1 993.5 605.3 522.4 486.8 10 nM mAb 472.9 1156.7 599.8 533.5 542.1 1 nM mAb 404.0 935.1 487.3 513.4 313.1 100 pM mAb 205.0 486.5 263.7 388.8 777.1 10 pM mAb 160.8 334,7 194.2 286.4 560.7 1 pM mAb 156.2 397.9 180.7 251.3 558.7 0.1 pM mAb 131.5 277.3 177.7 242.2 433.4 EC50 and maximal stimulation from curve fits EC50 (nM) 0.13 0.28 0.29 0.075 >1 M % Max stimulation 15% 27% 31% 23%
TABLE-US-00012 TABLE 6 Stimulation of rat TrkA phosphorylation mAb A mAb D mAb E mAb C mAb B Counts per second (x 1000) PBS 220.4 472.6 504.7 605.0 591.8 10 g/mL NGF 2129.7 3254.4 2760.0 2812.1 4292.6 1 M mAb 492.8 2051.7 2053.4 1626.6 1860.4 100 nM mAb 572.5 2847.6 2018.1 1765.1 2075.5 10 nM mAb 640.4 2967.3 2456.0 1690.2 2101.3 1 nM mAb 442.0 2387.2 1818.5 1544.4 1396.1 100 pM mAb 203.3 1248.4 1014.6 922.3 757.8 10 pM mAb 226.9 626.9 609.5 663.8 637.9 1 pM mAb 173.6 585.2 636.3 613.0 844.0 0.1 pM mAb 171.3 570.8 738.8 570.7 747.7 EC50 and maximal Stimulation from curve fits EC50 (nM) 0.88 0.17 0.30 0.21 0.98 % Max stimulation 18% 77% 74% 50% 38%
[0053] Exemplified anti-TrkA antibodies show concentration-dependent inhibition of NGF-induced phosphorylation of rat and human TrkA receptors. The exemplified mAb B was tested in two other independent experiments and the complete set of experiments summarized in table 7. The proported TrkA receptor antibodies mAb 1 and mAb 2 failed in inhibit (IC50 >1000 nM) NGF-induced phosphorylation of human TrkA receptors. (mAb 1 and mAb 2 were made and purified as outlined below.)
TABLE-US-00013 TABLE 7 Stimulation or inhibition of NGF-induced phosphorylation of rat or human TrkA. Human pTrkA EC50 (nM) % Stim.* IC50 (nM) % Inh.* mAb A 0.13 15% 0.77 86% mAb B ND.sup.#, 0.46, 0.35 <15%, 18%, 0.58, 0.84, 88%, 77%, 36% 1.07 74% mAb C 0.075 23% 0.80 77% mAb D 0.28 27% 0.12 66% mAb E 0.29 31% 0.48 56% mAb 1 <1000 <1000 mAb 2 <1000 <1000 *Maximal stimulation or inhibition from the curve fit as a percent of the NGF-stimulated response .sup.#ND = Not Determined as the simulation signal was too low to allow an accurate curve fit.
Example 5. TrkA Receptor Antibody Internalization In Vitro of mAb A
[0054] Fluorescence signal corresponding to total and internalization of mAb A is measured by performing high content live cell imaging assay in four different cell lines (human TrkA 3T3, SKNSH neuroblastoma, rat TrkA HEK293, and PC12 pheochromocytoma). Briefly, 33 nM (5 g/mL) of mAb A is mixed with 0.2 M (10 g/mL) of anti-human IgG Fc fragment specific Fab fragment (Jackson ImmunoResearch, Cat. #109-007-008) labelled with either DYLIGHT 650 (Thermo Fisher, Cat. #62266) or pHAb dye (Promega, Cat. #G9845) in culture media and incubated overnight with live cells grown in a 96 well plate at 37 C. The following day, the cells are washed, incubated for 20 min with NUCBLUE Hoechst dye (Thermo Fisher, Cat. #R37605), washed again, and imaged with CYTATION 5 High Content Imager) (BIOTEK). DYLIGHT 650 signal measures total antibody levels while pHAb pH sensor dye signal measures only internalized fluorescence. The intensity of the signal in each well is divided by the number of Hoechst stained nuclei to determine signal intensity per cell. The background signal is determined from human IgG isotype control and subtracted from the final value. The internalized fluorescence signal is then normalized to total antibody fluorescence by DYLIGHT650 to determine relative fluorescence across cell lines.
TABLE-US-00014 TABLE 7A Internalization of TrkA receptor antibody mAb A mAb A background subtracted fluorescence per cell, normalized to total antibody levels Total Internalized hTrkA 3T3 (mean SD, N = 2) 100.00% 33.42 1.15% SKNSH (mean SD, N = 2) 100.00% 42.64 27.79% rTrkA HEK293 (mean SD, N = 2) 100.00% 52.62 5.12% PC12 (mean SD, N = 2) 100.00% 66.65 11.08%
Example 6. Attenuation of CFA-Induced Gait Deficit In Vivo of mAb A
[0055] Attenuation of temporal and spatial gait features induced by Complete Freund's Adjuvant (CFA) delivered to the intra-articular space is assessed with the mAb A of the present invention as previously described (Adams, et al., 2016). Briefly, female Sprague Dawley rats (Envigo) weighing between 175 and 209 g at the start of testing are group-housed with access to food and water ad libitum except during testing. Rats receive a habituation session to the ExerGait treadmill apparatus (Columbus Instruments) at the start of the study. A digital camera (Basler) records activity at 100 frames/second while rats walk on the treadmill belt, approximately 10.5 long3.5 wide, housed within a plexiglass chamber. During the habituation session, the rats are placed into the chamber for approximately 30 seconds with the treadmill turned off. The treadmill is turned on and slowly increased incrementally to 3 cm/sec, 8 cm/sec, 12 cm/sec, and 15 cm/sec while the rat makes two attempts to walk forward. Following habituation, rats receive a 50 L intra-articular injection of Complete Freund's Adjuvant (1 mg/mL concentration CFA, Sigma lot #:SLBK1731V) mixed with Freund's Incomplete Adjuvant (IFA, MP Biomedicals LLC, Cat. #:642861, lot #:07263) to form a 0.4 mg/L (1 mL/kg) of 10 mg/kg IgG4 negative control, 0.1, 1, or 10 mg/kg of mAb A, or a positive control. mAb A (lot number BE05366-048) is diluted from the initial concentration of 12.4 mg/mL to 0.1, 1 and 10 mg/mL in PBS. The control IgG4PAA is diluted from 14.5 mg/mL to 10 mg/mL in PBS. Test sessions are conducted at 1, 2, and 3 days post-CFA administration. For each test session, rats are placed into the chamber and the treadmill is slowly ramped from 0 cm/sec to 16 cm/sec. Video is recorded at 16 cm/sec of the rats walking over a sufficient number of frames (approximately 1200-2000 frames). The dependent measures include: range of motion for each limb (subtraction of distance from the rear paw to the body midline at the beginning of the stance to the end of the stance), stance/swing ratio (stance time divided by the swing time for each limb), normalized stance distance (multiplication of percent of time in the stride in the stance phase by the total stride length), and the paw print size (number of pixels detected in the paw print as determined by pre-set color conditions that capture the limb in contact with the treadmill). These four endpoints are transformed to index measures by comparison to the contralateral limb which is not injected with CFA in order to provide a percentage of change from the control limb. All four measures are then summed to provide the Gait Index Score. Repeated measures ANOVAs are conducted with an alpha level of 0.05, followed by Dunnet's post-hoc comparisons to the IgG4 control. The 1 mg/kg and 10 mg/kg dose levels of mAb A both showed statistically significant improvement in composite Gait Index Score vs. IgG4 controls (as indicated by the * in the table).
TABLE-US-00015 TABLE 8 Effects of mAb A on CFA-induced Gait Deficits Three Days Post-Dosing Range Stance/ Normalized Paw Composite of Swing Stance Print Gait Antibody Motion Ratio Distance Size Score IgG4 74.36 75.43 59.18 54.95 263.92 6.62 Control 0.1 mg/kg 46.18 63.87 37.44 38.47 185.96 26.15 mAb A 1 mg/kg 22.72 41.31 20.17 20.11 104.3 24.93* mAb A 10 mg/kg 26.58 43.6 25.51 22.9 118.59 23.08* mAb A N = 9-10/group, mean SEM, * = p < 0.05
Example 7. Inhibition of NGF-Induced Phosphorylation of TrkA Ex Vivo in Brain, Skin and Dorsal Root Ganglia of mAb A
[0056] Inhibition of NGF stimulated phosphorylation of TrkA is assessed ex vivo in brain skin or dorsal root ganglia tissue. Female Sprague Dawley rats are euthanized and one hippocampus combined with one caudate brain area per 2 mL Eppendorf tubes containing either 100 L PBS (Gibco, Cat. #20012-027) or 100 L rat -NGF (10 g/mL in PBS). Similarly, two 6 mm skin punches are taken from hind paw pad and placed in a 2 mL tube containing 150 L PBS or 150 L rat -NGF (Sigma-Aldrich, Cat. #N-2513, 10 g/mL in PBS). Dorsal root ganglia are dissected and 10 ganglia placed in a 2 mL tube containing 200 L PBS or 150 L rat -NGF (10 g/mL in PBS). Two 5 mm stainless steel beads are added to each sample and shaken by hand for 10 seconds and incubated at room temperature for 5 minutes. Samples are frozen on dry ice and stored at 80 C. until extraction. Cell lysis buffer consisting of 2 Tissue Lysis buffer (CELL SIGNALING TECHNOLOGY, Cat. #9803S), 1 HALT protease, phosphatase inhibitor cocktail (ThermoFisher, Cat #78441) and 1 mM phenylmethanesulfonyl fluoride is added to each tube (to give a total volume of 500 L) and homogenized using a Qiagen tissuelyzer set at 30 Hz 23 minutes. Supernatants resulting from centrifugation at 4 C. for 15 minutes at 12,000 RCF are analyzed by ELISA methods to measure pTrkA, using procedures described in Price et al. (J Neurosci Methods 282:34-42, 2017).
[0057] Either the rat TrkA capture antibody (R&D SYSTEMS, Cat. #AF1056) or the human TrkA capture antibody (R&D SYSTEMS, Cat. #MAB1751) is diluted in carbonate-bicarbonate buffer (THERMO SCIENTIFIC PIERCE CHEMICAL, Cat. #28382) to 3 g/mL and 100 L per well used to coat Black MAXISORP 96 well plates (NUNC, Cat. #446471) overnight at 4 C. Plates are washed with 20 mM Tris-buffer saline (INVITROGEN, Cat. #15567-027) containing 150 mM NaCl NaCl (Sigma-Aldrich, Cat. #S3014-500G), pH 7.4 (TBS), blocked with 3% BSA (Sigma-Aldrich, Cat. #A3059) in TBS for 1 hour at room temperature, blotted dry, sealed, and stored at 4 C. before using within 2 weeks. Homogenates described above (100 L) are added to each well and incubated at 4 C. overnight. Plates are washed with TBST (TBS with 0.05% TWEEN-20 (Fisher Biochemical, Cat. #BP337100), 3300 L/well) and the rabbit phospho-TrkA (Tyr674/675)/TrkB (Tyr706/707) (CELL SIGNALING TECHNOLOGY, Cat. #4621) is diluted 1:20,000 in 1% BSA/TBST, 100 L per well is added and plates are incubated for 2 hours at room temperature on a gentle shaker. Plates are washed as before and a secondary antibody, goat anti-rabbit alkaline phosphatase (Jackson Immunoresearch Laboratories, INC., Cat. #111-055-144) diluted 1:20,000 in 1% BSA/TBST, is added (100 L per well) and incubated for 1 hour at room temperature. Plates are washed 5300 L/well with TBST, and 100 L per well of alkaline phosphatase CDP-star substrate (APPLIED BIOSYSTEMS, Cat. #T2214) is added. Plates are read 30 minutes later on an ENVISION (PerkinElmer) plate reader with an enhanced luminescent protocol. Resulting mean counts per second (CPS) for baseline and NGF stimulated for each tissue sample from each animal are presented in table 9.
TABLE-US-00016 TABLE 9 Inhibiton of tissue TrkA IgG4 Control mAb A mAb A mAb A 10 mg/kg, SC 0.1 mg/kg, SC 1 mg/kg, SC 10 mg/kg, SC Counts per seconds (x1000) Brain: Baseline 70.6 12.8 58.5 5.3 80.8 14.2 119.6 25.5 (10) (9) (9) (10) NGF 506.6 94.8 383.4 81.1 476.6 151.4 327.0 86.2 Stimulated (10) (9) (9) (10) DRG: Baseline 109.0 7.3 99.8 4.0 110.5 5.9 109.7 8.6 (5) (5) (5) (5) NGF 482.8 60.4 329.4 46.4 226.9 57.4 195.7 28.2 Stimulated (5) (5)* (5)** (5)** Skin: Baseline 14.5 1.0 15.9 1.4 16.2 1.3 16.0 1.3 (9) (9) (9) (9) NGF 33.3 2.6 26.6 2.6 22.3 1.6 20.5 1.4 Stimulated (9) (9)* (9)** (9)** Mean SEM (N) */**p < 0.05/0.001 vs NGF-stimulated IgG control, Two-way ANOVA followed by Dunnett's post hoc comparison.
[0058] The corresponding DNA sequences for the antibodies described herein may be prepared. Such DNA sequences for mAb A, mAb B, mAb C, mAb D, and mAb E are listed herein as indicated in the following table 10.
TABLE-US-00017 TABLE 10 Listing of DNA sequences for Some of the Antibodies Described Herein Antibody DNA Light Chain DNA Heavy Chain mAb A SEQ ID NO. 12 SEQ ID NO. 13 mAb B SEQ ID NO. 14 SEQ ID NO. 15 mAb C SEQ ID NO. 16 SEQ ID NO. 15 mAb D SEQ ID NO. 17 SEQ ID NO. 19 mAb E SEQ ID NO. 18 SEQ ID NO. 19
Example 8. Blocking the Binding of Human Trk A to NGF of mAbs A-E
[0059] Each row of a 96-well high-binding clear-bottom microtiter plate (Microlon, #655061) was coated overnight at 4 C. with 100 L/well of recombinant human TrkA protein, diluted to 2 g/mL in phosphate buffered saline, pH 7.2 (PBS). The next day, the coating solution was removed, and the plate was blocked with 150 L of Casein-PBS (Thermo Scientific, #37528) for 1 hour at 25 C. with gentle shaking. The plate was then washed three times with PBS supplemented with 0.05% Tween20 (PBST). A two-fold dilution series of exemplified antibodies, along with IgG4 and IgG1 isotype control antibodies, was generated starting at 20 nM in Casein-PBS. 100 L of the each dilution series sample was added to a well for 30 min at 37 C. with gentle shaking. The plate was then washed three times with PBST. A 100 nM solution of biotinylated recombinant human NGF (btNGF) was prepared in Casein-PBS buffer, and 100 L/well was added to the plate and incubated for 75 min at 37 C. with gentle shaking. The plate was then washed three times with PBST. A 1:3500 dilution of a 1 mg/mL stock solution of streptavidin-HRP (Thermo Scientific, #21130) in Casein-PBS was prepared and 100 was added to each well for 20 min at 37 C. with gentle shaking. The plate was washed three times with PBST. A 100 L solution of 1:1 TMB:H.sub.2O.sub.2 (Thermo Scientific, #1854050, #1854060) was added to each well and incubated for 3 min. The reaction was stopped by addition of 100 L of 1M H.sub.3PO.sub.4 to each well. The absorbance at 450 nm (Abs450) was measured using a SpectraMax 340PC plate reader (Molecular Devices). The Abs450 was plotted versus the antibody concentration, and a four parameter curve fit is determined using SigmaPlot 12.5 (Systat Software Inc.) to give the IC.sub.50 values.
[0060] Exemplified mAbs A-E, but not the IgG4 and IgG1 isotype control antibodies, block the binding of human TrkA to NGF in a dose-dependent manner within the antibody concentration range tested (as shown in the Table 11).
TABLE-US-00018 TABLE 11 Blocking of binding of human Trk A to NGF mAb mAb mAb mAb mAb IgG4 IgG1 A B C D E Control Control Absorbance 450 nm +20 nM mAb 0.20 0.15 0.15 0.19 0.19 1.12 1.13 +10 nM mAb 0.20 0.14 0.15 0.17 0.19 1.11 0.97 +5 nM mAb 0.20 0.15 0.16 0.19 0.21 1.08 1.10 +2.5 nM mAb 0.21 0.16 0.15 0.16 0.19 1.07 1.17 +1.25 nM mAb 0.26 0.17 0.16 0.19 0.25 1.03 1.04 +0.63 nM mAb 0.38 0.25 0.30 0.38 0.41 1.13 1.14 +0.31 pM mAb 0.73 0.55 0.56 0.67 0.68 1.14 1.19 +0.16 nM mAb 0.87 0.70 0.77 0.89 0.92 1.13 1.12 +0.08 nM mAb 1.03 0.75 0.92 0.96 1.05 1.14 1.16 +0.04 nM mAb 1.09 0.87 1.03 1.00 1.04 1.15 1.10 +0.02 nM mAb 1.11 0.97 0.97 1.05 1.10 1.13 1.14 +0 nM mAb 1.06 0.92 1.04 1.00 1.06 1.15 1.11 IC50 from curve fits IC50 (nM) 0.34 0.27 0.28 0.37 0.35
Example 9. Engineering, Expression, and Purification of mAb 1 and mAb 2
[0061] Expression vectors for the mammalian expression of mAb 1 were generated using the light chain sequence (Sequence ID #29) and heavy chain sequence (Sequence ID #57) provided in patent WO2016/087677 A1. Thus, mAb 1 has a light chain sequence defined by Sequence ID #29 and a heavy chain sequence defined by Sequence ID #57 of WO2016/087677 A1. Expression vectors for the mammalian expression of mAb 2 were generated using the light chain sequence (Sequence ID #91) and heavy chain sequence (Sequence ID #90) provided in patent US2013/0336964 A1. Thus, mAB2 has a light chain sequence defined by Sequence ID #91 and a heavy chain sequence defined by Sequence ID #90 of U.S. Patent Application Publication No. 2013/0336964.
[0062] These antibodies can be biosynthesized, purified, and formulated for administration by well-known methods. An appropriate host cell, such as Chinese hamster ovarian cells (CHO), is either transiently or stably transfected with an expression system for secreting antibodies using a predetermined HC:LC vector ratio if two vectors are used, or a single vector system encoding both heavy chain and light chain. Vectors suitable for expression and secretion of antibodies from these commonly-used host cells are well-known. Following expression and secretion of the antibody, the medium is clarified to remove cells. Clarified medium is applied to a Protein A affinity column that has been equilibrated with a compatible buffer, such as PBS (pH 7.4). The column is washed with buffer supplemented with 1M NaCl to remove nonspecific binding components. Bound antibody is eluted, for example, with sodium citrate at pH 3.5 and fractions are neutralized with 1M 2-amino-2-(hydroxymethyl)propane-1,3-diol (Tris) buffer. Antibody fractions are detected, such as by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) or analytical size-exclusion, and then are pooled. Soluble aggregate and multimers may be effectively removed by common techniques, including size exclusion, hydrophobic interaction, ion exchange, or hydroxyapatite chromatography. An exemplified antibody of the present invention is concentrated and/or sterile filtered using common techniques. The purity of exemplified antibody after these chromatography steps is greater than 95% and samples may be immediately frozen at 70 C. or stored at 4 C. for several months. The ability of mAb 1 and mAb 2 to bind to and/or inhibit signaling of TrkA can be assessed according to Examples 10-12.
Example 10. Binding Kinetics and Affinity for mAb B, mAb 1 and mAb 2
[0063] The binding kinetics and affinity of exemplified antibodies to human, cynomolgus monkey, rat, mouse, and rabbit TrkA are determined as described below using a surface plasmon resonance assay on a BIACORE 8K instrument (GE Healthcare). Two different isoforms of human TrkA (isoform 1 and isoform 2) are evaluated along with human TrkB and human TrkC. The BIACORE 8K is primed with HBS-EP+ running buffer [10 mM 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid (Hepes pH 7.4, 150 mM NaCl, 3 mM ethylenediaminetetraacetic acid (EDTA), 0.05% polysorbate 20 surfactant (P20, TWEEN 20)]. The analysis temperature is set at 37 C. and the sample compartment is set at 15 C. Binding kinetics and affinities are obtained using a parallel kinetics assay with an antibody capture method. Antibodies are captured onto a Series-S Sensor Protein A CM5 chip (GE Healthcare). For each channel, Flow Cell 1 (FC1) is designated as a buffer reference and Flow Cell 2 (FC2) is designated for antibody capture. All FC2 on all eight channels are set to capture approximately 89 response units (RU) of antibody at a flow rate of 10 L/min. All antibody samples are prepared at 5 g/mL by dilution into the running buffer. The human TrkA Isoform 2 analyte was prepared at a final concentration of 400, 200, 100, 50, 25, 12.5, 6.25, and 3.125 nM by dilution into the running buffer. Before the analysis cycle, the chip is regenerated with 3 injections of glycine (pH 1.5) at 100 L/min for a contact time of 15 seconds on FC1 and FC2 in order to clean the surface of the chip. Regeneration is followed by a conditioning step consisting of (1) 5 g/mL of an IgG4 isotype control antibody at 5 L/min for 15 seconds on FC2; (2) running buffer at 30 L/min for 250 seconds and dissociation for 600 seconds on FC1 and FC2; (3) chip surface regeneration with an injection of glycine (pH 1.5) at 100 L/min for 15 seconds. Each analysis cycle consists of: (1) capturing the test antibody on all eight FC2, where all eight respective FC1 pairs are used as a buffer reference, at 10 L/min; (2) running buffer wash step; (3) injection of TrkA analyte at 100 L/min for 120 seconds on channels 1-8 in order of descending concentration; (4) return to buffer flow for a dissociation time of 600 seconds; (5) regeneration of the chip surface with two injections of glycine (pH 1.5), at 100 L/min for 15 seconds per injection; (6) final running buffer wash step. This is repeated for each antibody evaluated. Data is processed using predefined antibody parallel kinetics with reference subtraction and fit to a 1:1 binding model using BIACORE 8K evaluation software (version 1.1.1.7442) to determine the association rate (on-rate, kon, M.sup.1s.sup.1 units) and the dissociation rate (off-rate, koff, s.sup.1 units). The equilibrium dissociation constant (K.sub.D) is calculated from the relationship K.sub.D=k.sub.off/k.sub.on, in molar units. The average (Avg) K.sub.D and error, reported as the standard deviation (SD), is determined from three independent experiments. Exemplified antibodies mAb B and mAb 1 demonstrate concentration-dependent binding to human TrkA. However, exemplified antibody mAb 2 shows no observable binding signal at the highest concentration of human TrkA injected (400 nM), and the binding response signal does not reach the theoretical half-maximal response signal. As a result, the K.sub.D of mAb 2 to human TrkA is estimated to be >400 nM. The results are shown in Table 12.
TABLE-US-00019 TABLE 12 BIACORE binding kinetics and affinity of mAb B, mAb 1, and mAb 2 # Rep- Anti- k.sub.on (1/Ms) k.sub.off (1/s) K.sub.D (nM) li- body Analyte Avg SD Avg SD Avg SD cates mAb B Human 1.6 0.3 E5 1.2 0.01 E3 7.7 1.4 3 TrkA Isoform 2 mAb 1 Human 8.8 1.5 E4 5.9 0.8 E3 70.0 22.6 3 TrkA Isoform 2 mAb 2 Human K.sub.D > 400 nM 3 TrkA Isoform 2
Example 11. Inhibition of NGF-Induced Phosphorylation of Human TrkA of mAb 1 and mAb B
[0064] Inhibition of human NGF-stimulated phosphorylation of TrkA after a 1 or 24 hour pretreatment of antibody is assessed in cells that were transfected and express human TrkA receptor standard fibroblast cells (3T3) background. Methods are as described for example 4 with the following exceptions. Cells are seeded into a standard 24 well plate at 800,000 cells per well in standard growth media and placed in a 37 C./5% CO.sub.2 incubator for 1.5 to 2 hours to allow cell adherence. Exemplified mAb B, an IgG4 control mAb, or proported TrkA receptor antibody mAb 1 were added to the media at a final concentration of 1 M either 1 hour or 24 hours prior to addition of media or human -NGF to give a final concentration 10 g/mL. Media is removed after a 5 minute incubation at room temperature. One mL of Cell Lysis buffer described above is added, cells scraped and the homogenate transferred to a 1.5 mL Eppendorf tube and frozen on dry ice and stored at 80 C. Samples are thawed supernatants resulting from centrifugation at 4 C. for 15 minutes at 12,000 relative centrifugal force (RCF) are analyzed for protein concentration and equivalent protein amounts analyzed by ELISA methods to measure pTrkA, using methods described in Price et al (J Neurosci Methods 282:34-42, 2017), as detailed in example 4.
[0065] Resulting counts per second (CPS) are in the table 13 below:
TABLE-US-00020 TABLE 13 Stimulation or inhibition of NGF-induced phosphorylation of human TrkA. IgG4 control mAb B mAb 1 Media only 27600 26112 21320 +mAb 1 hr 28392 46576 30292 +mAb 24 hr 28700 45280 50588 NGF 292400 170212 147624 NGF + mAb 1 hr 238000 81504 117536 NGF + mAb 24 hr 289620 78156 177412
[0066] As seen from the results in Table X, the exemplified mAb B inhibited the NGF-induced phosphorylation of human TrkA to a similar extent when preincubated for either 1 or 24 hours. In contrast, mAb 1 failed to inhibit NGF-induced phosphorylation of human TrkA when preincubated with the cells for 1 or 24 hours.
Example 12. Blocking the Binding of Human Trk A to NGF for mAb B and mAb 1
[0067] Each row of a 96-well high-binding clear-bottom microtiter plate (Microlon, #655061) was coated overnight at 4 C. with 100 L/well of recombinant human TrkA protein, diluted to 2 g/mL in phosphate buffered saline, pH 7.2 (PBS). The next day, the coating solution was removed, and the plate was blocked with 150 L of Casein-PBS (Thermo Scientific, #37528) for 1 hour at 25 C. with gentle shaking. The plate was then washed three times with PBS supplemented with 0.05% Tween20 (PBST). A three-fold dilution series of mAb B, mAb 1, and IgG4 isotype control mAb were generated starting at 300 nM in Casein-PBS. 100 L of the each dilution series sample was added to a well for 30 min at 37 C. with gentle shaking. The plate was then washed three times with PBST. A 100 nM solution of biotinylated recombinant human NGF (btNGF) was prepared in Casein-PBS buffer, and 100 L/well was added to the plate and incubated for 75 min at 37 C. with gentle shaking. A Casein-PBS buffer control row was included where btNGF was left out of the sample to assess background signal. The plate was then washed three times with PBST. A 1:3500 dilution of a 1 mg/mL stock solution of streptavidin-HRP (Thermo Scientific, #21130) in Casein-PBS was prepared and 100 L was added to each well for 20 min at 37 C. with gentle shaking. The plate was washed three times with PBST. A 100 L solution of 1:1 TMB:H.sub.2O.sub.2 (Thermo Scientific, #1854050, #1854060) was added to each well and incubated for 3 min. The reaction was stopped by addition of 100 L of 1M H.sub.3PO.sub.4 to each well. The absorbance at 450 nm (Abs450) was measured using a SpectraMax 340PC plate reader (Molecular Devices). The Abs450 was plotted versus the antibody concentration. Complete blocking of TrkA binding to NGF was determined by whether or not the Abs450 reached the level of the buffer baseline at the highest antibody concentration tested. Results are summarized in Table 14.
[0068] Exemplified mAb B exhibited complete blocking of TrkA to NGF in a dose-dependent manner as the binding signal reached the buffer control baseline at the highest antibody concentration tested. The molecule mAb 1 did not exhibit complete blocking of TrkA to NGF within the concentration range tested as the binding signal did not reach the buffer control baseline at the highest antibody concentration tested. Instead, the binding signal of mAb 1 plateaued at binding signal that was higher than the buffer control baseline. This suggests that mAb 1 is a partial blocker of TrkA binding to NGF. The IgG4 isotype control mAb does not block the TrkA binding to NGF within the concentration range tested.
TABLE-US-00021 TABLE 14 Blocking of binding of human Trk A to NGF Absorbance (450 nm) Antibody IgG4 Buffer Concentration (nM) mAb B mAb 1 Control Control 300 0.08 0.20 0.40 0.10 100 0.08 0.19 0.39 0.10 33.3 0.08 0.19 0.41 0.12 11.1 0.09 0.22 0.40 0.11 3.7 0.16 0.27 0.43 0.12 1.24 0.28 0.34 0.43 0.12 0.41 0.33 0.36 0.42 0.18 0.14 0.36 0.38 0.42 0.13 0.05 0.37 0.39 0.40 0.13 0.015 0.36 0.38 0.41 0.12 0.005 0.36 0.41 0.40 0.12 0 0.36 0.38 0.41 0.11
TABLE-US-00022 Sequences ExemplifiedHC#1(HumanIgG4PAA/Kappa)(SEQIDNO.1) EVQLVESGGGLVKPGGSLRLSCAASGFTFSGVSINWVRQAPGKGLEWVSSETTSS GTIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARSYYYGMDVWG QGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALT SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKY GPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNW YVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKS LSLSLG ExemplifiedHC#2(HumanIgG1EN/Kappa)(SEQIDNO.2) EVQLVESGGGLVKPGGSLRLSCAASGFTFSGVSINWVRQAPGKGLEWVSSETTSS GTIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARSYYYGMDVWG QGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS CDKTHTCPPCPAPEAEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPSSIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHY TQKSLSLSPGK ExemplifiedHCDR1(SEQIDNO.3) AASGFTFSGVSIN ExemplifiedHCDR2(SEQIDNO.4) SETTSSGTIYYADSVKG ExemplifiedHCDR3(SEQIDNO.5) ARSYYYGMDV ExemplifiedLC(SEQIDNO.6) DIVMTQTPLSSPVTLGQPASISCRSSQSLVHRX.sub.aaGNTYLSWLQQRPGQPPRLLIYKI SNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQARQFPLTFGGGTKVEI KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC whereinX.sub.aaatresidue33isoneofN,AorQ ExemplifiedLCDR1(SEQIDNO.7) RSSQSLVHRX.sub.aaGNTYLS whereinX.sub.aaatresidue10isoneofN,AorQ ExemplifiedLCDR2(SEQIDNO.8) YKISNRFS ExemplifiedLCDR3(SEQIDNO.9) MQARQFPLT ExemplifiedHCVR(SEQIDNO.10) EVQLVESGGGLVKPGGSLRLSCAASGFTFSGVSINWVRQAPGKGLEWVSSETTSS GTIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARSYYYGMDVWG QGTTVTVSS ExemplifiedLCVR(SEQIDNO.11) DIVMTQTPLSSPVTLGQPASISCRSSQSLVHRX.sub.aaGNTYLSWLQQRPGQPPRLLIYKI SNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQARQFPLTFGGGTKVEI K whereinX.sub.aaatresidue33isoneofN,AorQ LightChainDNASequenceFormAbA(UnoptimizedDNA)(SEQIDNO.12) (Unoptimized) GATATTGTGATGACCCAGACTCCACTCTCCTCACCTGTCACCCTTGGACAGCC GGCCTCCATCTCCTGCAGGTCTAGTCAAAGTCTCGTACACAGAGCTGGAAAC ACCTACTTGAGTTGGCTTCAGCAGAGGCCAGGCCAGCCTCCAAGACTCCTAAT TTATAAGATTTCTAACCGGTTCTCTGGGGTCCCAGACAGATTCAGTGGCAGTG GGGCAGGGACAGATTTCACACTGAAAATCAGCAGGGTGGAAGCTGAGGATGT CGGAGTTTATTATTGCATGCAAGCTAGACAATTTCCGCTCACTTTCGGCGGAG GGACCAAGGTGGAGATCAAACGGACCGTGGCTGCACCATCTGTCTTCATCTTC CCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCT GAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCC CTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACA GCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAA ACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTC ACAAAGAGCTTCAACAGGGGAGAGTGC HeavyChainDNASequenceFormAbA(UnoptimizedDNA)(SEDIDNO.13) (Unoptimized) GAGGTGCAGCTGGTGGAGTCTGGAGGAGGCCTGGTCAAGCCTGGGGGGTCCC TGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTGGCGTCAGCATAAAC TGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCATCCGAGACTA CAAGTAGTGGTACAATATACTACGCAGACTCAGTGAAGGGCCGATTCACCAT CTCCAGAGACAACGCCAAGAACTCACTGTATCTGCAAATGAACAGCCTGAGA GCCGAGGACACGGCTGTGTATTACTGTGCGAGAAGCTACTACTACGGTATGG ACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCAGCCTCCACCAAGGG CCCATCGGTCTTCCCGCTAGCGCCCTGCTCCAGGAGCACCTCCGAGAGCACAG CCGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCG TGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACA GTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCT TGGGCACGAAGACCTACACCTGCAACGTAGATCACAAGCCCAGCAACACCAA GGTGGACAAGAGAGTTGAGTCCAAATATGGTCCCCCATGCCCACCCTGCCCA GCACCTGAGGCCGCCGGGGGACCATCAGTCTTCCTGTTCCCCCCAAAACCCA AGGACACTCTCATGATCTCCCGGACCCCTGAGGTCACGTGCGTGGTGGTGGA CGTGAGCCAGGAAGACCCCGAGGTCCAGTTCAACTGGTACGTGGATGGCGTG GAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTTCAACAGCACG TACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAACGGCA AGGAGTACAAGTGCAAGGTCTCCAACAAAGGCCTCCCGTCCTCCATCGAGAA AACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAGCCACAGGTGTACACCCTG CCCCCATCCCAGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGG TCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAAAGCAATGGGCA GCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCC TTCTTCCTCTACAGCAGGCTAACCGTGGACAAGAGCAGGTGGCAGGAGGGGA ATGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACACAG AAGAGCCTCTCCCTGTCTCTGGGT LightChainDNASequenceFormAbB(CodonOptimized)(SEDIDNO.14) (Optimized) GACATCGTGATGACCCAGACCCCTTTATCCTCCCCCGTTACACTGGGCCAGCC CGCTTCCATCTCTTGTCGTTCCTCCCAGTCTTTAGTGCATCGTGCTGGCAACAC CTATTTATCTTGGCTGCAGCAGAGGCCCGGTCAGCCTCCTCGTCTGCTGATCT ACAAGATCAGCAACCGGTTCTCCGGCGTGCCCGATCGTTTTTCCGGCTCCGGA GCCGGCACCGATTTCACTTTAAAGATCTCTCGTGTGGAGGCCGAGGATGTGG GCGTGTACTACTGCATGCAAGCTCGTCAGTTCCCTCTGACCTTCGGCGGCGGC ACCAAGGTGGAGATCAAGCGTACGGTGGCTGCACCATCTGTCTTCATCTTCCC GCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGA ATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCT CCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAG CACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAA CACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCA CAAAGAGCTTCAACAGGGGAGAGTGT HeavyChainDNASequenceFormAbBandmAbC(CodonOptimized)(SEQ IDNO.15)(Optimized) GAGGTGCAGCTCGTGGAGTCCGGCGGAGGACTGGTGAAGCCCGGTGGCTCTT TAAGGCTGTCTTGTGCCGCTTCCGGCTTCACCTTCTCCGGCGTGTCCATCAACT GGGTGAGGCAAGCTCCCGGTAAGGGTTTAGAGTGGGTGTCCTCCGAGACCAC CTCCTCCGGCACCATCTACTACGCCGACTCCGTGAAGGGCCGGTTCACCATCT CTCGTGACAACGCCAAGAACTCTTTATATTTACAGATGAACTCTTTAAGGGCC GAGGACACCGCCGTGTACTACTGCGCTCGTTCCTACTACTACGGCATGGACGT GTGGGGCCAAGGTACCACCGTGACAGTCTCCTCCGCTAGCACCAAGGGCCCA TCCGTCTTCCCCCTGGCGCCCTGCTCCAGGAGCACCTCCGAGAGCACAGCCGC CCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCGTGG AACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTC CTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGG GCACGAAGACCTACACCTGCAACGTAGATCACAAGCCCAGCAACACCAAGGT GGACAAGAGAGTTGAGTCCAAATATGGTCCCCCATGCCCACCATGCCCAGCA CCTGAGGCAGCTGGGGGACCATCAGTCTTCCTGTTCCCCCCAAAACCCAAGG ACACTCTCATGATCTCCCGGACCCCTGAGGTCACGTGCGTGGTGGTGGACGTG AGCCAGGAAGACCCCGAGGTCCAGTTCAACTGGTACGTGGATGGCGTGGAGG TGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTTCAACAGCACGTACCG TGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAACGGCAAGGAG TACAAGTGCAAGGTCTCCAACAAAGGCCTCCCGTCCTCCATCGAGAAAACCA TCTCCAAAGCCAAAGGGCAGCCCCGAGAGCCACAGGTGTACACCCTGCCCCC ATCCCAGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAA GGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGG AGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTC CTCTACAGCAGGCTAACCGTGGACAAGAGCAGGTGGCAGGAGGGGAATGTCT TCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACACAGAAGAG CCTCTCCCTGTCTCTGGGT LightChainDNASequenceFormAbC(CodonOptimized)(SEQIDNO.16) (Optimized) GACATCGTGATGACCCAGACCCCTTTATCCTCCCCCGTTACACTGGGCCAGCC CGCTTCCATCAGCTGTAGGTCCTCCCAGTCTTTAGTGCATCGTCAAGGTAACA CATATTTATCTTGGCTGCAGCAGAGGCCCGGTCAACCTCCTCGGCTGCTGATC TACAAGATCTCCAACCGGTTCTCCGGCGTGCCCGATAGGTTCTCCGGCTCCGG CGCTGGCACCGATTTCACTTTAAAGATCTCTCGTGTGGAGGCTGAGGATGTGG GCGTGTACTACTGCATGCAAGCTCGTCAGTTCCCTTTAACCTTCGGAGGCGGC ACCAAGGTGGAGATCAAGCGTACGGTGGCTGCACCATCTGTCTTCATCTTCCC GCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGA ATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCT CCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAG CACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAA CACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCA CAAAGAGCTTCAACAGGGGAGAGTGT LightChainDNASequenceFormAbD(CodonOptimized)(SEQIDNO.17) (Optimized) GACATCGTGATGACCCAGACCCCTTTATCCTCCCCCGTTACACTGGGCCAGCC CGCTTCCATCTCTTGTCGTTCCTCCCAGTCTTTAGTGCATCGTGCTGGCAACAC CTATTTATCTTGGCTGCAGCAGAGGCCCGGTCAGCCTCCTCGTCTGCTGATCT ACAAGATCAGCAACCGGTTCTCCGGCGTGCCCGATCGTTTTTCCGGCTCCGGA GCCGGCACCGATTTCACTTTAAAGATCTCTCGTGTGGAGGCCGAGGATGTGG GCGTGTACTACTGCATGCAAGCTCGTCAGTTCCCTCTGACCTTCGGCGGCGGC ACCAAGGTGGAGATCAAGCGTACGGTGGCTGCACCATCTGTCTTCATCTTCCC GCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGA ATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCT CCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAG CACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAA CACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCA CAAAGAGCTTCAACAGGGGAGAGTGT LightChainDNASequenceFormAbE(CodonOptimized)(SEQIDNO.18) (Optimized) GACATCGTGATGACCCAGACCCCTTTATCCTCCCCCGTTACACTGGGCCAGCC CGCTTCCATCAGCTGTAGGTCCTCCCAGTCTTTAGTGCATCGTCAAGGTAACA CATATTTATCTTGGCTGCAGCAGAGGCCCGGTCAACCTCCTCGGCTGCTGATC TACAAGATCTCCAACCGGTTCTCCGGCGTGCCCGATAGGTTCTCCGGCTCCGG CGCTGGCACCGATTTCACTTTAAAGATCTCTCGTGTGGAGGCTGAGGATGTGG GCGTGTACTACTGCATGCAAGCTCGTCAGTTCCCTTTAACCTTCGGAGGCGGC ACCAAGGTGGAGATCAAGCGTACGGTGGCTGCACCATCTGTCTTCATCTTCCC GCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGA ATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCT CCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAG CACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAA CACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCA CAAAGAGCTTCAACAGGGGAGAGTGT HeavyChainDNASequenceFormAbDandmAbE(CodonOptimized)(SEQ IDNO.19)(Optimized) GAGGTGCAGCTCGTGGAGTCCGGCGGAGGACTGGTGAAGCCCGGTGGCTCTT TAAGGCTGTCTTGTGCCGCTTCCGGCTTCACCTTCTCCGGCGTGTCCATCAACT GGGTGAGGCAAGCTCCCGGTAAGGGTTTAGAGTGGGTGTCCTCCGAGACCAC CTCCTCCGGCACCATCTACTACGCCGACTCCGTGAAGGGCCGGTTCACCATCT CTCGTGACAACGCCAAGAACTCTTTATATTTACAGATGAACTCTTTAAGGGCC GAGGACACCGCCGTGTACTACTGCGCTCGTTCCTACTACTACGGCATGGACGT GTGGGGCCAAGGTACCACCGTGACAGTCTCCTCCGCTAGCACCAAGGGCCCA TCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGC CCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCGTGG AACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCCGGCCGTCCTACAGTC CTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGG GCACCCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGT GGACAAGCGGGTTGAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCG TGCCCAGCACCTGAAGCCGAGGGGGCACCGTCAGTCTTCCTCTTCCCCCCAAA ACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTG GTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACG GCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACA GCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAAT GGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCATCCTCCATCG AGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACA CCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTG CCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAAT GGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACG GCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCA GGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACA CGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA HumanTrkAExtracellularDomainIsoform1(33-414)(Purification Tag:N-terminal8XHistidine)(SEQIDNO.20) HHHHHHHHAAPCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQH LQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKT VQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMP NASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMK SGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTA VEMEIEWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRL NQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTS GDPVEKKDET HumanTrkAExtracellularDomainIsoform2(33-408)(Purification Tag:N-terminal8XHistidine)(SEQIDNO.21) HHHHHHHHAAPCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQH LQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKT VQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMP NASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMK SGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTA VEMEIRWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRL NQPTHVNNGNYTLLAANPFGQASASIIVIAAFMDNPFEFNPEDPIPDTNSTSGDPVE KKDET HumanTrkBExtracellularDomain(32-430)(PurificationTag:N- terminal8XHistidine)(SEQIDNO.22) HHHHHHHHCPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLE IINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFR HLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPN CGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQ GSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHEIWCIP FTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGD YTLIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTN RSNEIPSTDVTDKTGREH HumanTrkCExtracellularDomain(32-428)(PurificationTag:N- terminal8XHistidine)(SEQIDNO.23) HHHHHHHHCPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISR NITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLS SNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEAKLNSQNLYC INADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIV TGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVAL TVYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHVEYYQE GEISEGCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDE VSPTPPITVTHKPEED CynomolgusmonkeyTrkAExtracellularDomain(59-434)(Purification Tag:N-terminal8XHistidine)(SEQIDNO.24) HHHHHHHHASPCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQH LQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKT VQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVHEQKLQCHGQGPLAHMP NASCGVPMLKVQVPNASVDVGDDVLLWCQVEGRGLEQAGWILTELEQSATVM KSGALPSLGLTLANVTSDLNRKNVTCWAENDVGRAELSVQVNVSFPASVQLHTA VEMBHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRL NQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPDTNSTSGDPVE KKDET MouseTrkAExtracellularDomain(33-417with396-401deletion) (PurificationTag:N-terminal8XHistidine)(SEQIDNO.25) HHHHHHHHAASCREVCCPVGPSGLRCTRAGSLDTLRGLRGAGNLTELYVENQQ HLQRLEFEDLQGLGELRSLTIVKSGLRFVAPDAFRFTPRLSHLNLSSNALESLSWK TVQGLSLQDLTLSGNPLHCSCALFWLQRWEQEGLCGVHTQTLHDSGPGDQFLPL GHNTSCGVPTVKIQMPNDSVEVGDDVFLQCQVEGLALQQADWILTELEGAATV KKFGDLPSLGLILVNVTSDLNKKNVTCWAENDVGRAEVSVQVSVSFPASVHLGL AVEQHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTQFLESALTNETMRHGCL RLNQPTHVNNGNYTLLAANPYGQAAASVMAAFMDNPFEFNPEDPIPDGNSTSRD PVEKKDET RatTrkAExtracellularDomain(33-411)(PurificationTag:N-terminal 8XHistidine)(SEQIDNO.26) HHHHHHHHAASCRETCCPVGPSGLRCTRAGTLNTLRGLRGAGNLTELYVENQR DLQRLEFEDLQGLGELRSLTIVKSGLRFVAPDAFHFTPRLSHLNLSSNALESLSWK TVQGLSLQDLTLSGNPLHCSCALLWLQRWEQEDLCGVYTQKLQGSGSGDQFLPL GHNNSCGVPSVKIQMPNDSVEVGDDVFLQCQVEGQALQQADWILTELEGTATM KKSGDLPSLGLTLVNVTSDLNKKNVTCWAENDVGRAEVSVQVSVSFPASVHLG KAVEQHHWCIPFSVDGQPAPSLRWFFNGSVLNETSFIFTQFLESALTNETMRHGC LRLNQPTHVNNGNYTLLAANPYGQAAASIMAAFMDNPFEFNPEDPIPDTNSTSRD PVEKKDET RabbitTrkAExtracellularDomain(33-414)(PurificationTag:C- terminalpolyhistidinetag(unknownlength))(SEDIDNO.27) AALCPDVCCPRGPSGLLCTRPGALDRLRHLPGIENLTELYLENQNLQHLTLGDLR GLRELRNLAIVNSGLQSVATDAFRFTPRLSHLNLSFNALESLSWKTVQGLPLQEL VLSGNSLRCSCALRWLQRWEEEGLAGVREQKLRCSESEPLALMPNASCGMPTLK VQMPNGSVDVGDSVFLQCQVEGQGLEKAGWSLTELEELATVMIQKSEDLPTLRL TLANVTSDLNRKNVTCWAENDVGRTEVSVQVNVSFPASVQLHTAVEMEIHWCIP FSVDGQPAPSLHWLFNGSVLNETSFIFTEFLEPAANETMRHGCLRLNQPTHVNNG NYTLLATNPSGQAAASIMAAFMDNPFEFNPEDPIPVSFSPVDANSTSGDPVEKKD E