Constructs targeting prostate-specific membrane antigen (PSMA) and uses thereof
11993661 ยท 2024-05-28
Assignee
Inventors
- Hong Liu (El Sobrante, CA, US)
- Hongruo YUN (San Francisco, CA, US)
- Xiaomei GE (Foster City, CA, US)
- Zhiyuan Yang (Albany, CA, US)
- Lianxing Liu (San Francisco, CA, US)
- Pengbo ZHANG (Fremont, CA, US)
- Yixiang XU (Pearland, TX, US)
- Shan Li (Emeryville, CA, US)
- Lucas Horan (Emeryville, CA, US)
Cpc classification
C07K16/3069
CHEMISTRY; METALLURGY
C07K16/2809
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
C07K16/00
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
C07K14/705
CHEMISTRY; METALLURGY
C07K16/28
CHEMISTRY; METALLURGY
C12N15/00
CHEMISTRY; METALLURGY
Abstract
The present application provides constructs comprising an antibody moiety that specifically binds to PSMA (e.g., PSMA expressed on the surface of a cell). Also provided are methods of making and using these constructs.
Claims
1. An anti-prostate specific membrane antigen (PSMA) construct comprising an anti-PSMA antibody moiety specifically recognizing an extracellular domain of PSMA comprising the amino acid sequence of SEQ ID NO: 44, wherein the anti-PSMA antibody moiety comprises: a) a heavy chain variable domain (V.sub.H) comprising a heavy chain complementarity determining region (CDR-H) 1 comprising the amino acid sequence of SEQ ID NO: 1, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 3, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 5; and a light chain variable domain (V.sub.L) comprising a light chain complementarity determining region (CDR-L) 1 comprising the amino acid sequence of SEQ ID NO: 7, a CDR-L2 comprising the amino acid sequence GNS, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 9; or b) a V.sub.H comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 2, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 4, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 6; and a V.sub.L comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 8, a CDR-L2 comprising the amino acid sequence SNN, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 10.
2. The anti-PSMA construct of claim 1, wherein the anti-PSMA antibody moiety comprises: i) a V.sub.H comprising the amino acid sequence of SEQ ID NO: 16, or an amino acid sequence having at least about 85% sequence identity to SEQ ID NO: 16, and a V.sub.L comprising the amino acid sequence of SEQ ID NO: 18, or an amino acid sequence having at least about 85% sequence identity to SEQ ID NO: 18; or ii) a Vu comprising the amino acid sequence of SEQ ID NO: 17, or an amino acid sequence having at least about 85% sequence identity to SEQ ID NO: 17, and a V.sub.L comprising the amino acid sequence of SEQ ID NO: 19, or an amino acid sequence having at least about 85% sequence identity to SEQ ID NO: 19.
3. The anti-PSMA construct of claim 1, wherein the anti-PSMA antibody moiety is chimeric, human, humanized, or semi-synthetic.
4. The anti-PSMA construct of claim 1, wherein the anti-PSMA antibody moiety is a full-length antibody, a Fab, a Fab, a F(ab).sub.2, an Fv, or a single chain Fv (scFv).
5. The anti-PSMA construct of claim 4, wherein the anti-PSMA antibody moiety is an scFv.
6. The anti-PSMA construct of claim 5, wherein the scFv comprises: i) the amino acid sequence of SEQ ID NO: 20, or an amino acid sequence that has at least about 85% sequence identity to SEQ ID NO: 20; or ii) the amino acid sequence of SEQ ID NO: 21, or an amino acid sequence that has at least about 85% sequence identity to SEQ ID NO: 21.
7. The anti-PSMA construct of claim 4, wherein the anti-PSMA moiety is a full-length antibody, and wherein the full-length antibody comprises: i) a heavy chain comprising the amino acid sequence of SEQ ID NO: 39 or an amino acid sequence having at least about 85% sequence identity to SEQ ID NO: 39, and a light chain comprising the amino acid sequence of SEQ ID NO: 40 or an amino acid sequence having at least about 85% sequence identity to SEQ ID NO: 40; or ii) a heavy chain comprising the amino acid sequence of SEQ ID NO: 41 or an amino acid sequence having at least about 85% sequence identity to SEQ ID NO: 41, and a light chain comprising the amino acid sequence of SEQ ID NO: 42 or an amino acid having at least about 85% sequence identity to SEQ ID NO: 42.
8. The anti-PSMA construct of claim 1, wherein the anti-PSMA construct is monospecific.
9. The anti-PSMA construct of claim 1, wherein the anti-PSMA construct is multi specific.
10. The anti-PSMA construct of claim 9, wherein the anti-PSMA construct is a tandem scFv, a diabody (Db), a single chain diabody (scDb), a dual-affinity retargeting (DART) antibody, a F(ab).sub.2, a dual variable domain (DVD) antibody, a knob-into-hole (KiH) antibody, a dock and lock (DNL) antibody, a chemically cross-linked antibody, a heteromultimeric antibody, or a heteroconjugate antibody.
11. The anti-PSMA construct of claim 9, wherein the anti-PSMA construct further comprises a second antibody moiety specifically recognizing a second antigen.
12. The anti-PSMA construct of claim 11, wherein the second antigen is an antigen on the surface of a B cell, a natural killer cell, a dendritic cell, a macrophage, a monocyte, a neutrophil, or a T cell.
13. The anti-PSMA construct of claim 1, wherein the anti-PSMA construct is a chimeric antigen receptor (CAR) comprising: (a) an extracellular domain comprising the anti-PSMA antibody moiety; (b) a transmembrane domain; and (c) an intracellular signaling domain.
14. The anti-PSMA construct of claim 13, wherein the intracellular signaling domain comprises a primary immune cell signaling sequence of CD3?, TCR?, FcR?, FcR?, CD3?, CD3?, CD3?, CD5, CD22, CD79a, CD79b, or CD66d, and/or wherein the intracellular signaling domain further comprise a costimulatory signaling sequence of CD28, 4-1BB, ICOS, or OX40.
15. The anti-PSMA construct of claim 1, wherein the anti-PSMA construct is a chimeric antibody-T cell receptor (TCR) construct (caTCR) comprising: (a) an extracellular domain comprising the anti-PSMA antibody moiety; and (b) a TCR module (TCRM) comprising a first TCR domain (TCRD) comprising a first TCR transmembrane domain (TCR-TM) and a second TCRD comprising a second TCR-TM, wherein the TCRM facilitates recruitment of at least one TCR-associated signaling molecule.
16. The anti-PSMA construct of claim 15, wherein the first TCR-TM and the second TCR-TM are from a ?/? TCR.
17. The anti-PSMA construct of claim 2, wherein the anti-PSMA construct comprises: i) a first polypeptide chain comprising the amino acid sequence of SEQ ID NO: 31, and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO: 32; ii) a first polypeptide chain comprising the amino acid sequence of SEQ ID NO: 34, and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO; iii) a first polypeptide chain comprising the amino acid sequence of SEQ ID NO: 165, and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO: 166; iv) a first polypeptide chain comprising the amino acid sequence of SEQ ID NO: 167, and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO: 168; v) a first polypeptide chain comprising the amino acid sequence of SEQ ID NO: 169, and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO: 170; vi) a first polypeptide chain comprising the amino acid sequence of SEQ ID NO: 171, and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO: 172; vii) a first polypeptide chain comprising the amino acid sequence of SEQ ID NO: 173, and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO: 174; viii) a first polypeptide chain comprising the amino acid sequence of SEQ ID NO: 175, and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO: 176; ix) a first polypeptide chain comprising the amino acid sequence of SEQ ID NO: 177, and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO: 178; x) a first polypeptide chain comprising the amino acid sequence of SEQ ID NO: 179, and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO: 180; xi) a polypeptide chain comprising the amino acid sequence of SEQ ID NO: 29; xii) a polypeptide chain comprising the amino acid sequence of SEQ ID NO: 30; or xiii) a polypeptide chain comprising the amino acid sequence of any one of SEQ ID NOs: 37, 38, 55-84, 93, and 184-186.
18. The anti-PSMA construct of claim 15, wherein the TCR-associated signaling molecule is selected from the group consisting of CD3??, CD3??, and CD3??, and/or wherein the caTCR lacks a functional primary immune cell signaling domain.
19. The anti-PSMA construct of claim 1, wherein the anti-PSMA construct is a chimeric signaling receptor (CSR) comprising: i) a ligand-binding module comprising the anti-PSMA antibody moiety; ii) a transmembrane module; and iii) a co-stimulatory immune cell signaling module that is capable of providing a co-stimulatory signal to an effector cell, wherein the CSR lacks a functional primary immune cell signaling domain.
20. The anti-PSMA construct of claim 19, wherein: (i) the CSR lacks any primary immune cell signaling sequences; (ii) the transmembrane module of the CSR and the co-stimulatory immune cell signaling module of the CSR are from different molecules; (iii) the transmembrane module of the CSR comprises a transmembrane domain of CD28, CD3?, CD3?, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD27, CD30, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, 4-1BB, OX40, or the ?, ?, ?, or ? chain of a TCR; and/or (iv) the co-stimulatory immune cell signaling module is from the intracellular domain of a co-stimulatory receptor of a TCR selected from the group consisting of 4-1BB, CD27, CD28, CD30, OX40, ICOS, and CD40.
21. The anti-PSMA construct of claim 1, wherein the anti-PSMA antibody moiety is conjugated to an effector molecule, wherein the effector molecule is a detectable label or a therapeutic agent selected from the group consisting of a drug, a toxin, a radioisotope, a protein, a peptide, and a nucleic acid.
22. A nucleic acid or a vector encoding the anti-PSMA construct of claim 1.
23. A host cell comprising the nucleic acid or the vector of claim 22.
24. A method of producing an anti-PSMA construct, comprising culturing the host cell of claim 23 under a condition where the anti-PSMA construct is expressed, and recovering the anti-PSMA construct produced by the host cell.
25. A pharmaceutical composition comprising the anti-PSMA construct of claim 1, and a pharmaceutical acceptable carrier.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
DETAILED DESCRIPTION OF THE INVENTION
(9) The present application provides isolated constructs (referred to herein as anti-PSMA constructs) that comprise an antibody moiety (referred to herein as an anti-PSMA antibody moiety) that specifically binds to prostate specific membrane antigen, or PSMA (e.g., PSMA, such as human PSMA) expressed on the surface of a cell, such as a cancer cell). The anti-PSMA constructs allow for specific targeting of cells expressing PSMA (e.g., cells expressing PSMA on their surfaces), such as disease cells expressing (or overexpressing) PSMA. When present in a chimeric antigen receptor (CAR) or chimeric antibody-T cell receptor construct (caTCR) expressed by a T cell, the anti-PSMA antibody moiety specifically redirects human T cells to kill target cells (e.g., cancer cells) expressing PSMA. Furthermore, when fused to a detectable label, the anti-PSMA antibody moiety may be used to visualize changes in the number and localization of PSMA-expressing cells. Such information can, in turn, be used to diagnose and/or prognose PSMA-associated diseases or disorders.
(10) The present application provides constructs (such as isolated constructs) comprising an antibody moiety that specifically binds to PSMA (e.g., PSMA expressed on the surface of a cell, such as a cancer cell). Exemplary constructs include, but are not limited to, e.g., full-length anti-PSMA antibodies, multispecific anti-PSMA constructs (such as a bispecific anti-PSMA antibodies), anti-PSMA chimeric antigen receptors (CARs), anti-PSMA chimeric antibody-T cell receptor constructs (caTCRs), anti-PSMA chimeric signaling receptors (CSRs), an anti-PSMA immunoconjugates, as well as other constructs, as described in further detail below. Each of the constructs described herein demonstrates high specificity for human PSMA in native form (e.g., expressed on the surface of a cell, such as a cancer cell).
(11) The present application also provides nucleic acids that encode the anti-PSMA constructs described herein (or the polypeptide portion(s) thereof).
(12) Also provided herein are compositions (such as pharmaceutical compositions or formulations) comprising an anti-PSMA construct described herein or an effector cell expressing or associated with anti-PSMA construct described herein (such as a T cell expressing an anti-PSMA CAR, an anti-PSMA caTCR, or an anti-PSMA chimeric signaling receptor (CSR)).
(13) The present application also provides methods of making and using the anti-PSMA constructs (or effector cells expressing or associated with the anti-PSMA constructs) for treatment, for diagnostic purposes, for prognostic purposes, and for inclusion into kits and articles of manufacture useful for the treatment, diagnosis, and/or prognosis of PSMA-associated diseases and disorders.
Definitions
(14) Before describing the disclosed embodiments in detail, it is to be understood that the present disclosure is not limited to particular compositions or biological systems, which can, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting.
(15) As used in this specification and the appended claims, the singular forms a, an and the include plural referents unless the content clearly dictates otherwise. Thus, for example, reference to a molecule optionally includes a combination of two or more such molecules, and the like.
(16) As used herein prostate specific membrane antigen or PSMA refers to any native PSMA from any vertebrate source, including mammals such as primates (e.g., humans, non-human primates (e.g., cynomolgus or rhesus monkeys)) and rodents (e.g., mice and rats), unless otherwise indicated. The term encompasses full-length, unprocessed PSMA as well as any form of PSMA that results from processing in the cell. The term also encompasses naturally occurring variants of PSMA, e.g., splice variants, allelic variants, and isoforms. PSMA is a type II membrane protein originally characterized by the murine monoclonal antibody (mAb) 7E11-C5.3 and is expressed in all forms of prostate tissue (including carcinoma). The PSMA protein has a 3-part structure: a 19-amino-acid internal portion, a 24-amino-acid transmembrane portion, and a 707-amino-acid external portion (e.g., the extracellular domain. An exemplary amino acid sequence for human PSMA is
(17) TABLE-US-00001 (SEQIDNO:43) MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLL GFLFGWFIKSSNEATNITPKHNMKAFLDELKAENI KKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGL DSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFN TSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLV YVNYARTEDFFKLERDMKINCSGKIVIARYGKVFR GNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDG WNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYR RGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPP DSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTN EVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGG IDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFAS WDAEEFGLLGSTEWAEENSRLLQERGVAYINADSS IEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEG KSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFF QRLGIASGRARYTKNWETNKFSGYPLYHSVYETYE LVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPF DCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFD SLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMN DQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKY AGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVA AFTVQAAAETLSEVA.
(18) An exemplary amino acid sequence for the extracellular domain of human PSMA is
(19) TABLE-US-00002 (SEQIDNO:44) KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFT QIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHY DVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPP PGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTE DFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQ LAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGV QRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVG LPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSL KVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNV IGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAA VVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGL LGSTEWAEENSRLLQERGVAYINADSSIEGNYTLR VDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWT KKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASG RARYTKNWETNKFSGYPLYHSVYETYELVEKFYDP MFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVV LRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKN FTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLER AFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGI YDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAA ETLSEVA.
(20) As used herein, treatment or treating is an approach for obtaining beneficial or desired results, including clinical results. For purposes of the present application, beneficial or desired clinical results include, but are not limited to, one or more of the following: alleviating one or more symptoms resulting from the disease, diminishing the extent of the disease, stabilizing the disease (e.g., preventing or delaying the worsening of the disease), preventing or delaying the spread (e.g., metastasis) of the disease, preventing or delaying the recurrence of the disease, delay or slowing the progression of the disease, ameliorating the disease state, providing a remission (partial or total) of the disease, decreasing the dose of one or more other medications required to treat the disease, delaying the progression of the disease, increasing or improving the quality of life, increasing weight gain, and/or prolonging survival. Also encompassed by treatment is a reduction of pathological consequence of cancer (such as, for example, tumor volume). The methods provided herein contemplate any one or more of these aspects of treatment.
(21) The terms recurrence, relapse or relapsed refers to the return of a cancer or disease after clinical assessment of the disappearance of disease. A diagnosis of distant metastasis or local recurrence can be considered a relapse.
(22) The term refractory or resistant refers to a cancer or disease that has not responded to treatment.
(23) Activation, as used herein in relation to T cells, refers to the state of a T cell that has been sufficiently stimulated to induce detectable cellular proliferation. Activation can also be associated with induced cytokine production, and detectable effector functions.
(24) The term antibody moiety includes full-length antibodies and antigen-binding fragments thereof. A full-length antibody comprises two heavy chains and two light chains. The variable regions of the light and heavy chains are responsible for antigen binding. The variable regions in each chain generally comprise three highly variable loops called the complementarity determining regions (CDRs) (light chain (LC) CDRs including CDR-L1, CDR-L2, and CDR-L3, heavy chain (HC) CDRs including CDR-H1, CDR-H2, and CDR-H3). CDR boundaries for the antibodies and antigen-binding fragments disclosed herein may be defined or identified by the conventions of Kabat, Chothia, or Al-Lazikani (Al-Lazikani 1997; Chothia 1985; Chothia 1987; Chothia 1989; Kabat 1987; Kabat 1991). The three CDRs of the heavy or light chains are interposed between flanking stretches known as framework regions (FRs), which are more highly conserved than the CDRs and form a scaffold to support the hypervariable loops. The constant regions of the heavy and light chains are not involved in antigen binding, but exhibit various effector functions. Antibodies are assigned to classes based on the amino acid sequence of the constant region of their heavy chain. The five major classes or isotypes of antibodies are IgA, IgD, IgE, IgG, and IgM, which are characterized by the presence of ?, ?, ?, ?, and ? heavy chains, respectively. Several of the major antibody classes are divided into subclasses such as IgG1 (?I heavy chain), IgG2 (?2 heavy chain), IgG3 (?3 heavy chain), IgG4 (?4 heavy chain), IgA1 (?1 heavy chain), or IgA2 (?2 heavy chain).
(25) The term antigen-binding fragment as used herein refers to an antibody fragment including, but not limited to, e.g., a diabody, a Fab, a Fab, a F(ab)2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv)2, a bispecific dsFv (dsFv-dsFv), a disulfide stabilized diabody (ds diabody), a single-chain antibody molecule (scFv), an scFv dimer (bivalent diabody), a multispecific antibody formed from a portion of an antibody comprising one or more CDRs, a camelized single domain antibody, a nanobody, a domain antibody, a bivalent domain antibody, or any other antibody fragment that binds to an antigen but does not comprise a complete antibody structure. An antigen-binding fragment is capable of binding to the same antigen to which the parent antibody or a parent antibody fragment (e.g., a parent scFv) binds. In some embodiments, an antigen-binding fragment may comprise one or more CDRs from a particular human antibody grafted to a framework region from one or more different human antibodies.
(26) The term epitope as used herein refers to the specific group of atoms or amino acids on an antigen to which an antibody or antibody moiety binds. Two antibodies or antibody moieties may bind the same epitope (or overlapping epitopes) within an antigen if they exhibit competitive binding for the antigen.
(27) As used herein, a first antibody moiety competes for binding to PSMA with a second antibody moiety when the first antibody moiety inhibits binding of the second antibody moiety to PSMA by at least about 50% (such as at least about any of 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%) in the presence of an equimolar concentration of the first antibody moiety, or vice versa. A high throughput process for binning antibodies based upon their cross-competition is described in PCT Publication No. WO 03/48731.
(28) As use herein, the term specifically binds or is specific for refers to measurable and reproducible interactions (such as binding between a target and an antibody or an antibody moiety) that are determinative of the presence of the target in the presence of a heterogeneous population of molecules, including biological molecules. For example, an antibody or antibody moiety that specifically binds to a target (which can be an epitope) is an antibody or antibody moiety that binds the target with greater affinity, avidity, more readily, and/or with greater duration than it binds to other targets. In some embodiments, an antibody or antibody moiety that specifically binds to an antigen reacts with one or more antigenic determinants of the antigen (for example an epitope on the extracellular domain of PSMA) with a binding affinity that is at least about 10 times its binding affinity for other targets.
(29) An isolated anti-PSMA construct as used herein refers to an anti-PSMA construct that (1) is not associated with proteins found in nature, (2) is free of other proteins from the same source, (3) is expressed by a cell from a different species, or, (4) does not occur in nature.
(30) The term isolated nucleic acid as used herein is intended to mean a nucleic acid of genomic, cDNA, or synthetic origin or some combination thereof, which by virtue of its origin the isolated nucleic acid (1) is not associated with all or a portion of a polynucleotide in which the isolated nucleic acid is found in nature, (2) is operably linked to a polynucleotide which it is not linked to in nature, or (3) does not occur in nature as part of a larger sequence.
(31) As used herein, the term CDR or complementarity determining region is intended to mean the non-contiguous antigen combining sites found within the variable region of both heavy and light chain polypeptides. These particular regions have been described by Kabat et al., J. Biol. Chem. 252:6609-6616 (1977); Kabat et al., U.S. Dept. of Health and Human Services, Sequences of proteins of immunological interest (1991); by Chothia et al., J. Mol. Biol. 196:901-917 (1987); and MacCallum et al., J. Mol. Biol. 262:732-745 (1996), where the definitions include overlapping or subsets of amino acid residues when compared against each other. Nevertheless, application of either definition to refer to a CDR of an antibody or grafted antibodies or variants thereof is intended to be within the scope of the term as defined and used herein. The amino acid residues which encompass the CDRs as defined by each of the above cited references are set forth below in Table 1 as a comparison.
(32) TABLE-US-00003 TABLE 1 CDR Definitions Kabat.sup.1 Chothia.sup.2 MacCallum.sup.3 IMGT.sup.4 AHo.sup.5 V.sub.H CDR1 31-35 26-32 30-35 27-38 25-40 V.sub.H CDR2 50-65 53-55 47-58 56-65 58-77 V.sub.H CDR3 95-102 96-101 93-101 105-117 109-137 V.sub.L CDR1 24-34 26-32 30-36 27-38 25-40 V.sub.L CDR2 50-56 50-52 46-55 56-65 58-77 V.sub.L CDR3 89-97 91-96 89-96 105-117 109-137 .sup.1Residue numbering follows the nomenclature of Kabat et al., J. Biol. Chem. 252: 6609-6616 (1977); Kabat et al., U.S. Dept, of Health and Human Services, Sequences of proteins of immunological interest (1991). .sup.2Residue numbering follows the nomenclature of Chothia et al., J. Mol. Biol. 196: 901-917 (1987); Al-Lazikani B. et al., J. Mol. Biol., 273: 927-948 (1997). .sup.3Residue numbering follows the nomenclature of MacCallum et al., J. Mol. Biol. 262: 732-745 (1996); Abhinandan and Martin, Mol. Immunol., 45: 3832-3839 (2008). .sup.4Residue numbering follows the nomenclature of Lefranc M. P. et al., Dev. Comp. Immunol., 27: 55-77 (2003); and Honegger and Pl?ckthun, J. Mol. Biol., 309: 657-670 (2001). .sup.5Residue numbering follows the nomenclature of Honegger and Pl?ckthun, J. Mol. Biol., 309: 657-670 (2001).
(33) The term chimeric antibodies refer to antibodies in which a portion of the heavy and/or light chain is identical or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit a biological activity of interest (e.g., binding to PSMA, such as human PSMA, on the surface of a cell, e.g., a cancer cell) (see U.S. Pat. No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984)).
(34) The term semi-synthetic in reference to an antibody or antibody moiety means that the antibody or antibody moiety has one or more naturally occurring sequences and one or more non-naturally occurring (i.e., synthetic) sequences or amino acids.
(35) Fv is the minimum antibody fragment which contains a complete antigen-recognition and antigen-binding site. This fragment consists of a dimer of one heavy- and one light-chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (3 loops each from the heavy and light chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
(36) Single-chain Fv, also abbreviated as sFv or scFv, are antibody fragments that comprise the V.sub.H and V.sub.L antibody domains connected into a single polypeptide chain. In some embodiments, the scFv polypeptide further comprises a polypeptide linker between the V.sub.H and V.sub.L domains which permits the scFv to form the desired structure for antigen binding. For a review of scFv, see Pluckthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994).
(37) The term diabodies refers to small antibody fragments prepared by constructing scFv fragments (see preceding paragraph) typically with short linkers (such as about 5 to about 10 residues) between the V.sub.H and V.sub.L domains such that inter-chain but not intra-chain pairing of the V domains is achieved, resulting in a bivalent fragment, i.e., fragment having two antigen-binding sites. Bispecific diabodies are heterodimers of two crossover scFv fragments in which the V.sub.H and V.sub.L domains of the two antibodies are present on different polypeptide chains. Diabodies are described more fully in, for example, EP 404,097; WO 93/11161; and Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993).
(38) Humanized forms of non-human (e.g., rodent) antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a complementarity determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat, rabbit or non-human primate having the desired antibody specificity, affinity, and capability. In some instances, framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, humanized antibodies can comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance (e.g., affinity for the target antigen). In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. For further details, see Jones et al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol. 2:593-596 (1992).
(39) Percent (%) amino acid sequence identity or homology with respect to the polypeptide and antibody sequences identified herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the polypeptide being compared, after aligning the sequences considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, Megalign (DNASTAR), or MUSCLE software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared. For purposes herein, however, % amino acid sequence identity values are generated using the sequence comparison computer program MUSCLE (Edgar, R. C., Nucleic Acids Research 32(5):1792-1797, 2004; Edgar, R. C., BMC Bioinformatics 5(1):113, 2004).
(40) The terms Fc receptor or FcR are used to describe a receptor that binds to the Fc region of an antibody. In some embodiments, an FcR is one that binds an IgG antibody (a ? receptor) and includes receptors of the Fc?RI, Fc?RII, and Fc?RIII subclasses, including allelic variants and alternatively spliced forms of these receptors. Fc?RII receptors include Fc?RIIA (an activating receptor) and Fc?RIIB (an inhibiting receptor), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof. Activating receptor Fc?RIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. Inhibiting receptor Fc?RIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain (see review M. in Daeron, Annu. Rev. Immunol. 15:203-234 (1997)). The term includes allotypes, such as Fc?RIIIA allotypes: Fc?RIIIA-Phe158, Fc?RIIIA-Val158, Fc?RIIA-R131 and/or Fc?RIIA-H131. FcRs are reviewed in Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991); Capel et al., Immunomethods 4:25-34 (1994); and de Haas et al., J. Lab. Clin. Med. 126:330-41 (1995). Other FcRs, including those to be identified in the future, are encompassed by the term FcR herein. The term also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al., J. Immunol. 117:587 (1976) and Kim et al., J. Immunol. 24:249 (1994)).
(41) The term FcRn refers to the neonatal Fc receptor (FcRn). FcRn is structurally similar to major histocompatibility complex (MHC) and consists of an ?-chain noncovalently bound to P2-microglobulin. The multiple functions of the neonatal Fc receptor FcRn are reviewed in Ghetie and Ward (2000) Annu. Rev. Immunol. 18, 739-766. FcRn plays a role in the passive delivery of immunoglobulin IgGs from mother to young and the regulation of serum IgG levels. FcRn can act as a salvage receptor, binding and transporting pinocytosed IgGs in intact form both within and across cells, and rescuing them from a default degradative pathway.
(42) The CH1 domain of a human IgG Fc region (also referred to as C1 of H1 domain) usually extends from about amino acid 118 to about amino acid 215 (EU numbering system).
(43) The hinge region is generally defined as stretching from Glu216 to Pro230 of human IgG1 (Burton, Molec. Immunol. 22:161-206 (1985)). Hinge regions of other IgG isotypes may be aligned with the IgG1 sequence by placing the first and last cysteine residues forming inter-heavy chain SS bonds in the same positions.
(44) The CH2 domain of a human IgG Fc region (also referred to as C2 of H2 domain) usually extends from about amino acid 231 to about amino acid 340. The CH2 domain is unique in that it is not closely paired with another domain. Rather, two N-linked branched carbohydrate chains are interposed between the two CH2 domains of an intact native IgG molecule. It has been speculated that the carbohydrate may provide a substitute for the domain-domain pairing and help stabilize the CH2 domain. Burton, Molec Immunol. 22:161-206 (1985).
(45) The CH3 domain (also referred to as C2 or H3 domain) comprises the stretch of residues C-terminal to a CH2 domain in an Fc region (i.e. from about amino acid residue 341 to the C-terminal end of an antibody sequence, typically at amino acid residue 446 or 447 of an IgG).
(46) A functional Fc fragment possesses an effector function of a native sequence Fc region. Exemplary effector functions include C1q binding; complement dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g. B cell receptor; BCR), etc. Such effector functions generally require the Fc region to be combined with a binding domain (e.g. an antibody variable domain) and can be assessed using various assays known in the art.
(47) An antibody with a variant IgG Fc with altered FcR binding affinity or ADCC activity is one which has either enhanced or diminished FcR binding activity (e.g., Fc?R or FcRn) and/or ADCC activity compared to a parent polypeptide or to a polypeptide comprising a native sequence Fc region. The variant Fc which exhibits increased binding to an FcR binds at least one FcR with higher affinity (e.g., lower apparent K.sub.d or IC.sub.50 value) than the parent polypeptide or a native sequence IgG Fc. According to some embodiments, the improvement in binding compared to a parent polypeptide is about 3 fold, such as about any of 5, 10, 25, 50, 60, 100, 150, 200, or up to 500 fold, or about 25% to 1000% improvement in binding. The polypeptide variant which exhibits decreased binding to an FcR, binds at least one FcR with lower affinity (e.g., higher apparent K.sub.d or higher IC.sub.50 value) than a parent polypeptide. The decrease in binding compared to a parent polypeptide may be about 40% or more decrease in binding.
(48) Antibody-dependent cell-mediated cytotoxicity or ADCC refers to a form of cytotoxicity in which secreted Ig bound to Fc receptors (FcRs) present on certain cytotoxic cells (e.g. Natural Killer (NK) cells, neutrophils, and macrophages) enable these cytotoxic effector cells to bind specifically to an antigen-bearing target cell and subsequently kill the target cell with cytotoxins. The antibodies arm the cytotoxic cells and are absolutely required for such killing. The primary cells for mediating ADCC, NK cells, express Fc?RIII only, whereas monocytes express Fc?RI, Fc?RII and Fc?RIII. FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991). To assess ADCC activity of a molecule of interest, an in vitro ADCC assay, such as that described in U.S. Pat. No. 5,500,362 or 5,821,337 may be performed. Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al. PNAS (USA) 95:652-656 (1998).
(49) The polypeptide comprising a variant Fc region which exhibits increased ADCC or mediates ADCC in the presence of human effector cells more effectively than a polypeptide having wild type IgG Fc or a parent polypeptide is one which in vitro or in vivo is substantially more effective at mediating ADCC, when the amounts of polypeptide with variant Fc region and the polypeptide with wild type Fc region (or the parent polypeptide) in the assay are essentially the same. Generally, such variants will be identified using any in vitro ADCC assay known in the art, such as assays or methods for determining ADCC activity, e.g. in an animal model etc. In some embodiments, the variant is from about 5 fold to about 100 fold, e.g. from about 25 to about 50 fold, more effective at mediating ADCC than the wild type Fc (or parent polypeptide).
(50) Complement dependent cytotoxicity or CDC refers to the lysis of a target cell in the presence of complement. Activation of the classical complement pathway is initiated by the binding of the first component of the complement system (C1q) to antibodies (of the appropriate subclass) which are bound to their cognate antigen. To assess complement activation, a CDC assay, e.g. as described in Gazzano-Santoro et al., J. Immunol. Methods 202:163 (1996), may be performed. Polypeptide variants with altered Fc region amino acid sequences and increased or decreased C1q binding capability are described in U.S. Pat. No. 6,194,551B1 and WO99/51642. The contents of those patent publications are specifically incorporated herein by reference. See, also, Idusogie et al. J. Immunol. 164: 4178-4184 (2000).
(51) Unless otherwise specified, a nucleotide sequence encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence. The phrase nucleotide sequence that encodes a protein or an RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
(52) The term operably linked refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence resulting in expression of the latter. For example, a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence. For instance, a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence. Generally, operably linked DNA sequences are contiguous and, where necessary to join two protein coding regions, in the same reading frame.
(53) Homologous refers to the sequence similarity or sequence identity between two polypeptides or between two nucleic acid molecules. When a position in both of the two compared sequences is occupied by the same base or amino acid monomer subunit, e.g., if a position in each of two DNA molecules is occupied by adenine, then the molecules are homologous at that position. The percent of homology between two sequences is a function of the number of matching or homologous positions shared by the two sequences divided by the number of positions compared times 100. For example, if 6 of 10 of the positions in two sequences are matched or homologous then the two sequences are 60% homologous. By way of example, the DNA sequences ATTGCC and TATGGC share 50% homology. Generally, a comparison is made when two sequences are aligned to give maximum homology.
(54) An effective amount of an anti-PSMA construct or composition as disclosed herein, is an amount sufficient to carry out a specifically stated purpose. An effective amount can be determined empirically and by known methods relating to the stated purpose.
(55) The term therapeutically effective amount refers to an amount of an anti-PSMA construct or composition as disclosed herein, effective to treat a disease or disorder in an individual. In the case of cancer, the therapeutically effective amount of the anti-PSMA construct or composition as disclosed herein can reduce the number of cancer cells; reduce the tumor size or weight; inhibit (i.e., slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the cancer. To the extent the anti-PSMA construct or composition as disclosed herein can prevent growth and/or kill existing cancer cells, it can be cytostatic and/or cytotoxic. In some embodiments, the therapeutically effective amount is a growth inhibitory amount. In some embodiments, the therapeutically effective amount is an amount that extends the survival of a patient. In some embodiments, the therapeutically effective amount is an amount that improves progression free survival of a patient.
(56) As used herein, by pharmaceutically acceptable or pharmacologically compatible is meant a material that is not biologically or otherwise undesirable, e.g., the material may be incorporated into a pharmaceutical composition administered to a patient without causing any significant undesirable biological effects or interacting in a deleterious manner with any of the other components of the composition in which it is contained. Pharmaceutically acceptable carriers or excipients have preferably met the required standards of toxicological and manufacturing testing and/or are included on the Inactive Ingredient Guide prepared by the U.S. Food and Drug administration.
(57) The term label when used herein refers to a detectable compound or composition which can be conjugated directly or indirectly to the anti-PSMA antibody moiety. The label may be detectable by itself (e.g., radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, may catalyze chemical alteration of a substrate compound or composition which is detectable.
(58) The term chimeric antigen receptor (CAR) refers to an artificially constructed hybrid single-chain protein or single-chain polypeptide containing a single-chain variable fragment (scFv) as a part of the extracellular antigen-binding domain, linked directly or indirectly to a transmembrane domain (e.g., a TCR transmembrane domain), which is in turn linked directly or indirectly to an intracellular immune cell (e.g., T cell or NK cell) signaling domain. The intracellular signaling domain (ISD) comprises a primary signaling sequence, or primary immune cell signaling sequence, from an antigen-dependent, TCR-associated T cell activation molecule, e.g., a portion of the intracellular domain of CD3?, TCR?, FcR?, FcR?, CD3?, CD3?, CD3?, CD5, CD22, CD79a, CD79b, or CD66d). The ISD can further comprise a co-stimulatory signaling sequence; e.g., a portion of the intracellular domain of an antigen-independent, co-stimulatory molecule such as CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, or the like. Characteristics of CARs include their ability to redirect immune cell (e.g., T cell or NK cell) specificity and reactivity toward a selected target in either MHC-restricted (in cases of TCR-mimic antibodies) or non-MHC-restricted (in cases of antibodies against cell surface proteins) manners, exploiting the antigen-binding properties of monoclonal antibodies. The non-MHC-restricted antigen recognition gives immune cells (e.g., T cells or NK cells) expressing CARs the ability to recognize antigen independent of antigen processing, thus bypassing a major mechanism of tumor escape.
(59) There are currently three generations of CARs. The first generation CARs are typically single-chain polypeptides composed of a scFv as the antigen-binding domain fused to a transmembrane domain fused to the cytoplasmic/intracellular domain, which comprises a primary immune cell signaling sequence, of a molecule from the T cell receptor (TCR) complex, i.e., an antigen-dependent, TCR-associated T cell activation molecule such as CD3?, TCR?, FcR?, FcR?, CD3?, CD3?, CD3?, CD5, CD22, CD79a, CD79b, or CD66d. The first generation CARs typically have the intracellular domain from the CD3? chain, which is the primary transmitter of signals from endogenous TCRs. The first generation CARs can provide de novo antigen recognition and cause activation of both CD4.sup.+ and CD8.sup.+ T cells through their CD3? chain signaling domain in a single fusion molecule, independent of HLA-mediated antigen presentation. The second generation CARs add intracellular domains from various co-stimulatory molecules (e.g., CD28, 4-1BB, ICOS, OX40) to the primary immune cell signaling sequence of the CAR to provide additional signals to the T cell. Second generation CARs comprise fragments that provide co-stimulation (e.g., CD28 or 4-IBB) and activation (e.g., CD3?). Preclinical studies have indicated that the second generation CARs can improve the antitumor activity of T cells. For example, robust efficacy of the second generation CAR modified T cells was demonstrated in clinical trials targeting the CD19 molecule in patients with chronic lymphoblastic leukemia (CLL) and acute lymphoblastic leukemia (ALL). The third generation CARs comprise those that provide multiple co-stimulation (e.g., CD28 and 4-1BB) and activation (e.g., CD3?).
(60) As used herein, the term chimeric antibody-T cell receptor construct (or caTCR) refers to a functional polypeptide complex comprising two separate polypeptide chains, one including an antibody heavy chain variable region (V.sub.H) and an antibody heavy chain constant region (C.sub.H), and the other including an antibody light chain variable region (V.sub.L) and an antibody light chain constant region (C.sub.L). A caTCR as defined herein is therefore a 2-subunit construct, each subunit substantially resembling a cell membrane-anchored antibody heavy chain or light chain that is fused to a transmembrane domain (e.g., a TCR transmembrane domain) and an intracellular immune cell signaling domain. In some embodiments, a caTCR does not include a co-stimulatory domain (e.g., a portion of the intracellular domain of CD3?, CD3?, CD3?, or CD3?). In some embodiments, a caTCR comprises a) an extracellular domain comprising an antibody moiety and b) a T cell receptor module (TCRM) capable of recruiting at least one TCR-associated signaling module. In some embodiments, an anti-PSMA caTCR comprises a) an extracellular domain comprising an anti-PSMA antibody moiety that specifically binds to an extracellular region of PSMA or a portion thereof (e.g., SEQ ID NO: 44 or a portion thereof) and b) a T cell receptor module (TCRM) capable of recruiting at least one TCR-associated signaling module.
(61) A caTCR as defined herein comprises a first polypeptide chain and a second polypeptide chain, in which the first polypeptide chain comprises an antibody V.sub.H fused to an antibody C.sub.H fused to a transmembrane domain and an intracellular immune cell signaling domain, and the second polypeptide comprises an antibody V.sub.L fused to an antibody C.sub.L fused to a transmembrane domain and an intracellular immune cell signaling domain. In some embodiments, the first and second polypeptide chains are linked, such as by a covalent linkage (e.g., peptide or other chemical linkage) or non-covalent linkage. In some embodiments, the anti-PSMA caTCR is a heterodimer comprising the first polypeptide chain and the second polypeptide chain. In some embodiments, the first polypeptide chain and the second polypeptide chain are linked by at least one disulfide bond. The specificity of the anti-PSMA caTCR derives from an antibody moiety that confers binding specificity to an extracellular region of PSMA or a portion thereof (e.g., SEQ ID NO: 44 or a portion thereof).
(62) The terms chimeric antibody-T cell receptor (caTCR) and antibody-TCR chimeric molecule or construct (abTCR or AbTCR) are used interchangeably herein. Further descriptions and examples of caTCR and abTCR may be found in, e.g., WO 2017/070608 and PCT/US2018/029217 (now published as WO 2018/200582), the contents of which are incorporated by reference herein in their entirety.
(63) It is understood that embodiments of the invention described herein include consisting and/or consisting essentially of embodiments.
(64) Reference to about a value or parameter herein includes (and describes) variations that are directed to that value or parameter per se. For example, description referring to about X includes description of X.
(65) As used herein, reference to not a value or parameter generally means and describes other than a value or parameter. For example, the method is not used to treat cancer of type X means the method is used to treat cancer of types other than X.
(66) Anti-PSMA Constructs
(67) Provided herein are constructs that specifically bind to prostate specific membrane antigen (PSMA) that comprise an antibody moiety that specifically binds to PSMA (e.g., PSMA expressed on the surface of a cell, such as a cancer cell). Such constructs are also referred to herein as anti-PSMA constructs. The specificity of the anti-PSMA construct for PSMA is derived from the anti-PSMA antibody moiety (such as a full-length antibody or antigen-binding fragment thereof) that specifically binds to cell surface-bound PSMA. In some embodiments, the extracellular domain of PSMA comprises the amino acid sequence set forth in SEQ ID NO: 44.
(68) Anti-PSMA constructs within the scope of the present application include, without limitation, e.g., full-length anti-PSMA antibodies, multispecific anti-PSMA constructs, anti-PSMA CARs, anti-PSMA chimeric antibody-T cell receptor constructs (caTCRs), anti-PSMA chimeric signaling receptors (CSRs), anti-PSMA immunoconjugates, and others, as described herein below.
(69) For example, in some embodiments, the anti-PSMA construct (such as an isolated anti-PSMA construct) comprises an anti-PSMA antibody moiety that specifically binds to PSMA (e.g., PSMA expressed on the surface of a cell, such as a cancer cell). In some embodiments, the extent of binding of the anti-PSMA antibody to a non-target polypeptide is less than about 10% of the binding of the anti-PSMA antibody moiety to PSMA as determined by methods known in the art, such as ELISA, fluorescence activated cell sorting (FACS) analysis, or radioimmunoprecipitation (RIA). Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule, which generally is a molecule of similar structure that does not have binding activity. For example, specific binding can be determined by competition with a control molecule that is similar to the target, for example, an excess of nonlabeled target. In this case, specific binding is indicated if the binding of the labeled target to a probe is competitively inhibited by excess unlabeled target. The term specific binding or specifically binds to or is specific for a particular polypeptide or an epitope on a particular polypeptide target as used herein can be exhibited, for example, by a molecule having a K.sub.D for the target of at least about 10.sup.?4 M, alternatively at least about 10.sup.?5 M, alternatively at least about 10.sup.?6 M, alternatively at least about 10.sup.?7 M, alternatively at least about 10.sup.?8 M, alternatively at least about 10.sup.?9 M, alternatively at least about 10.sup.?10 M, alternatively at least about 10.sup.?11 M, alternatively at least about 10.sup.?12 M, or less. In one embodiment, the term specific binding refers to binding where a molecule binds to a particular polypeptide (e.g., PSMA) or epitope on a particular polypeptide (e.g., PSMA) without substantially binding to any other polypeptide or polypeptide epitope.
(70) In some embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that specifically binds to PSMA (e.g., PSMA expressed on the surface of a cell, such as a cancer cell) and competes for binding to PSMA with a second anti-PSMA antibody (or antibody moiety) that specifically binds PSMA (e.g., PSMA expressed on the surface of a cell, such as a cancer cell) and comprises: (a) a CDR-H1 comprising an amino acid sequence set forth in SEQ ID NO: 1 or 2; (b) a CDR-H2 comprising an amino acid sequence set forth in SEQ ID NO: 3 or 4; (c) a CDR-H3 comprising an amino acid sequence set forth in SEQ ID NO: 5 or 6; (d) a CDR-L1 comprising an amino acid sequence set forth in SEQ ID NO: 7 or 8; (e) a CDR-L2 comprising the amino acid sequence GNS or SNN; and (f) a CDR-L3 comprising an amino acid sequence set forth in SEQ ID NO: 9 or 10. In some embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that specifically binds to the same epitope of PSMA (e.g., PSMA expressed on the surface of a cell, such as a cancer cell) as a second anti-PSMA antibody (or antibody moiety) that specifically binds PSMA (e.g., PSMA expressed on the surface of a cell, such as a cancer cell) and comprises (a) a CDR-H1 comprising an amino acid sequence set forth in SEQ ID NO: 1 or 2; (b) a CDR-H2 comprising an amino acid sequence set forth in SEQ ID NO: 3 or 4; (c) a CDR-H3 comprising an amino acid sequence set forth in SEQ ID NO: 5 or 6; (d) a CDR-L1 comprising an amino acid sequence set forth in SEQ ID NO: 7 or 8; (e) a CDR-L2 comprising the amino acid sequence GNS or SNN; and (f) a CDR-L3 comprising an amino acid sequence set forth in SEQ ID NO: 9 or 10.
(71) In some embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that comprises one, two, three, four, five, or six complementarity determining region (CDR) sequences selected from the group consisting of: (a) a CDR-H1 comprising an amino acid sequence set forth in GYX.sub.1FX.sub.2SYW (SEQ ID NO: 11), wherein X.sub.1 is S or N; and X.sub.2 is T or A; (b) a CDR-H2 comprising an amino acid sequence set forth in IYPXIDSDT (SEQ ID NO: 12), wherein X.sub.1 is G or D; (c) a CDR-H3 comprising an amino acid sequence set forth in ARX.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6YX.sub.7X.sub.8X.sub.9DV (SEQ ID NO: 13), wherein X.sub.1 is S or no amino acid; X.sub.2 is M or no amino acid; X.sub.3 is G or no amino acid; X.sub.4 is S or no amino acid; X.sub.5 is S or D; X.sub.6 is L or S; X.sub.7 is A or Y; X.sub.8 is S or G; and X.sub.9 is S or I; (d) a CDR-L1 comprising an amino acid sequence set forth in SSNIGX.sub.1X.sub.2X.sub.3X.sub.4 (SEQ ID NO: 14), wherein X.sub.1 is A or S; X.sub.2 is G or N; X.sub.3 is Y or T; and X.sub.4 is D or no amino acid; (e) a CDR-L2 comprising the amino acid sequence X.sub.1NX.sub.2, wherein X.sub.1 is G or S; and X.sub.2 is S or N; and (f) a CDR-L3 comprising an amino acid sequence set forth in X.sub.1X.sub.2X.sub.3DX.sub.4SLX.sub.5GYV (SEQ ID NO: 15), wherein X.sub.1 is Q or A; X.sub.2 is S or A; X.sub.3 is Y or W; X.sub.4 is S or D; and X.sub.5 is S or N.
(72) In some embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that comprises one, two, three, four, five, or six complementarity determining region (CDR) sequences selected from the group consisting of: (a) a CDR-H1 comprising an amino acid sequence set forth in SEQ ID NO: 1 or 2, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; (b) a CDR-H2 comprising an amino acid sequence set forth in SEQ ID NO:3 or 4, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions (c) a CDR-H3 comprising an amino acid sequence set forth in SEQ ID NO: 5 or 6, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; (d) a CDR-L1 comprising an amino acid sequence set forth in SEQ ID NO: 7 or 8, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; (e) a CDR-L2 comprising the amino acid sequence GNS or SNN, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions; and (f) a CDR-L3 comprising an amino acid sequence set forth in SEQ ID NO: 9 or 10, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
(73) In some embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that comprises (a) a CDR-H1 comprising an amino acid sequence set forth in SEQ ID NO: 1 or 2, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; (b) a CDR-H2 comprising an amino acid sequence set forth in SEQ ID NO:3 or 4, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions (c) a CDR-H3 comprising an amino acid sequence set forth in SEQ ID NO: 5 or 6, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; (d) a CDR-L1 comprising an amino acid sequence set forth in SEQ ID NO: 7 or 8, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; (e) a CDR-L2 comprising the amino acid sequence GNS or SNN, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions; and (f) a CDR-L3 comprising an amino acid sequence set forth in SEQ ID NO: 9 or 10, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
(74) In some embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that comprises one, two, three, four, five, or six complementarity determining region (CDR) sequences selected from the group consisting of: (a) a CDR-H1 comprising an amino acid sequence set forth in SEQ ID NO: 1 or 2; (b) a CDR-H2 comprising an amino acid sequence set forth in SEQ ID NO: 3 or 4; (c) a CDR-H3 comprising an amino acid sequence set forth in SEQ ID NO: 5 or 6; (d) a CDR-L1 comprising an amino acid sequence set forth in SEQ ID NO: 7 or 8; (e) a CDR-L2 comprising the amino acid sequence GNS or SNN; and (f) a CDR-L3 comprising an amino acid sequence set forth in SEQ ID NO: 9 or 10.
(75) In some embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that comprises a) a CDR-H1 comprising an amino acid sequence set forth in SEQ ID NO: 1 or 2; (b) a CDR-H2 comprising an amino acid sequence set forth in SEQ ID NO: 3 or 4; (c) a CDR-H3 comprising an amino acid sequence set forth in SEQ ID NO: 5 or 6; (d) a CDR-L1 comprising an amino acid sequence set forth in SEQ ID NO: 7 or 8; (e) a CDR-L2 comprising the amino acid sequence GNS or SNN; and (f) a CDR-L3 comprising an amino acid sequence set forth in SEQ ID NO: 9 or 10. In some embodiments, the CDRs are human CDRs.
(76) The amino acid sequences of SEQ ID NOs: 1-10 are provided in Table 2 below.
(77) TABLE-US-00004 TABLE2 GYSFTSYW IYPDDSDT SSNIGAGYD AAWDDSLNGYV (SEQID (SEQID (SEQID (SEQID NO:1) NO:4) NO:7) NO:10) GYNFASYW ARSMGSSLYASSDV SSNIGSNT (SEQID (SEQID (SEQID NO:2) NO:5) NO:8) IYPGDSDT ARDSYYGIDV QSYDSSLSGYV (SEQID (SEQID (SEQID NO:3) NO:6) NO:9)
(78) In some embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that comprises one, two, or three CDRs of an antibody heavy chain variable domain (V.sub.H) comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to an amino acid sequence set forth SEQ ID NOs: 16 or 17. Additionally or alternatively, in some embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that comprises one, two, or three CDRs of a light chain variable domain (V.sub.L) comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to an amino acid sequence set forth in SEQ ID NO: 18 or 19.
(79) In some embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that comprises a heavy chain variable domain (V.sub.H) comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to an amino acid sequence set forth SEQ ID NOs: 16 or 17 and/or a light chain variable domain (V.sub.L) comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to an amino acid sequence set forth in SEQ ID NO: 18 or 19. The amino acid sequences of SEQ ID NOs: 16-19 are provided in Table 3 below. The CDR sequences are in underlined bold type.
(80) TABLE-US-00005 TABLE3 EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQM PGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAY LQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTLVTVS S(SEQIDNO:16) EVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVGWVRQM PGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAY LQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSS (SEQIDNO:17) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQ LPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGL QAEDEADYYCQSYDSSLSGYVFGTGTKVTVLG (SEQIDNO:18) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQL PGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQ SEDEADYYCAAWDDSLNGYVFGTGTKVTVLG (SEQIDNO:19)
(81) The heavy and light chain variable domains can be combined in pair-wise combinations to generate additional anti-PSMA antibody moieties that can be incorporated into and/or used with the anti-PSMA constructs of the present disclosure.
(82) In certain embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that comprises: (a) a CDR-H1 comprising GYSFTSYW (SEQ ID NO: 1) or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, (b) a CDR-H2 comprising IYPGDSDT (SEQ ID NO: 3) or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, (c) a CDR-H3 comprising ARSMGSSLYASSDV (SEQ ID NO: 5) or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, (d) a CDR-L1 comprising SSNIGAGYD (SEQ ID NO: 7) or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, (e) a CDR-L2 comprising GNS or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions, and (f) a CDR-L3 comprising QSYDSSLSGYV (SEQ ID NO: 9) or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions. In certain embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that comprises: (a) a CDR-H1 comprising GYSFTSYW (SEQ ID NO: 1), (b) a CDR-H2 comprising 1YPGDSDT (SEQ ID NO: 3), (c) a CDR-H3 comprising ARSMGSSLYASSDV (SEQ ID NO: 5); (d) a CDR-L1 comprising SSNIGAGYD (SEQ ID NO: 7), (e) a CDR-L2 comprising GNS, and (f) a CDR-L3 comprising QSYDSSLSGYV (SEQ ID NO: 9). In some embodiments, the CDRs are human CDRs. In certain embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that comprises one, two, or three CDRs of a V.sub.H domain comprising SEQ ID NO: 16 and one, two, or three CDRs of a V.sub.L domain comprising SEQ ID NO: 18. In certain embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that comprises a V.sub.H domain comprising an amino acid sequence that is at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%) identical to SEQ ID NO: 16 and/or a V.sub.L domain comprising an amino acid sequence that is at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%) identical to SEQ ID NO: 18. In certain embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that comprises a V.sub.H domain comprising SEQ ID NO: 16 and a V.sub.L domain comprising SEQ ID NO: 18. An anti-PSMA antibody moiety comprising SEQ ID NO: 16 and SEQ ID NO: 18 is alternatively referred to herein as a Clone A anti-PSMA antibody moiety.
(83) In certain embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that comprises: (a) a CDR-H1 comprising GYNFASYW (SEQ ID NO: 2) or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, (b) a CDR-H2 comprising 1YPDDSDT (SEQ ID NO: 4) or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, (c) a CDR-H3 comprising ARDSYYGIDV (SEQ ID NO: 6) or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, (d) a CDR-L1 comprising SSNIGSNT (SEQ ID NO: 8) or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, (e) a CDR-L2 comprising SNN or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions, and (f) a CDR-L3 comprising AAWDDSLNGYV (SEQ ID NO: 10) or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions. In certain embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that comprises: (a) a CDR-H1 comprising GYNFASYW (SEQ ID NO: 2), (b) a CDR-H2 comprising IYPDDSDT (SEQ ID NO: 4), (c) a CDR-H3 comprising ARDSYYGIDV (SEQ ID NO: 6); (d) a CDR-L1 comprising SSNIGSNT (SEQ ID NO: 8), (e) a CDR-L2 comprising SNN, and (f) a CDR-L3 comprising AAWDDSLNGYV (SEQ ID NO: 10). In some embodiments, the CDRs are human CDRs. In certain embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that comprises one, two, or three CDRs of a V.sub.H domain comprising SEQ ID NO: 17 and one, two, or three CDRs of a V.sub.L domain comprising SEQ ID NO: 19. In certain embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that comprises a V.sub.H domain comprising an amino acid sequence that is at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%) identical to SEQ ID NO: 17 and/or a V.sub.L domain comprising an amino acid sequence that is at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%) identical to SEQ ID NO: 19. In some embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that comprises a V.sub.H domain comprising SEQ ID NO: 17 and a V.sub.L domain comprising SEQ ID NO: 19. An anti-PSMA antibody moiety comprising SEQ ID NO: 17 and SEQ ID NO: 19 is alternatively referred to herein as a Clone B anti-PSMA antibody moiety.
(84) In some embodiments, the anti-PSMA antibody moiety of the anti-PSMA construct is a full-length antibody. In some embodiments, the anti-PSMA antibody moiety of the anti-PSMA construct is an antigen-binding fragment of an anti-PSMA antibody, for example an antigen-binding fragment selected from the group consisting of a Fab, a Fab, a F(ab)2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), and a single-chain antibody molecule (scFv). In some embodiments, the anti-PSMA antibody moiety of the anti-PSMA construct is an scFv. In some embodiments, the anti-PSMA antibody moiety is human, humanized, or semi-synthetic.
(85) The amino acid sequences of two exemplary anti-PSMA scFvs are provided Table 4 below. The V.sub.L in each scFv is in plain text (i.e., no underline), the V.sub.H in each scFv is underlined, and the linker is in italic type. The CDRs are in bold type and underlined bold type.
(86) TABLE-US-00006 TABLE4 CloneAanti-PSMAscPv QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQ LPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGL QAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSG GGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGY SFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQ VTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYAS SDVWGQGTLVTVSS (SEQIDNO:20) CloneBAnti-PSMAscPv QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQL PGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQ SEDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGG GGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYN FASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQV TISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWG QGTLVTVSS (SEQIDNO:21)
(87) In some embodiments, the anti-PSMA scFv comprises an amino acid sequence that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 20 or SEQ ID NO: 21.
(88) In some embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that binds human PSMA, mouse PSMA, rat PSMA, cynomolgus monkey PSMA, and/or rhesus PSMA. In some embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that specifically binds human PSMA. In some embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that specifically binds to PSMA present on or expressed on the surface of a cell. In some embodiments, the cell is a cancer cell. In some embodiments, the cell expresses abnormally high levels of PSMA, as compared to a reference cell. In some embodiments, the reference cell is a cell obtained from or derived from non-diseased (such as non-cancerous) tissue. In some embodiments, the cell that expresses abnormally high levels of PSMA is a cancer cell. In some embodiments, the cancer cell is in a solid tumor. In some embodiments, the cancer cell is a prostate cancer cell, a renal cell cancer cell, a uterine cancer cell, or a liver cancer cell. In some embodiments, the cancer cell is a metastatic cancer cell.
(89) Anti-PSMA Constructs Comprising Anti-PSMA Antibody Moiety Sequence Variants
(90) In some embodiments, anti-PSMA constructs of the present application comprise variants (such as amino acid sequence variants) of the anti-PSMA antibody moieties described herein. For example, it may be desirable to improve the binding affinity and/or other biological properties of the anti-PSMA antibody moiety of an anti-PSMA construct. Amino acid sequence variants of an anti-PSMA antibody moiety may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody moiety, or by peptide synthesis. Such modifications include, for example, deletions from, insertions into, and/or substitutions of residues within the amino acid sequences of the anti-PSMA antibody moiety. Any combination of deletion(s), insertion(s), and substitution(s) can be made to arrive at the final anti-PSMA antibody moiety, provided that the final antibody moiety possesses the desired characteristics, e.g., binding to PSMA (such as PSMA expressed on the surface of a cell, e.g., a cancer cell).
(91) In some embodiments, an anti-PSMA antibody moiety sequence variant comprises one or more amino acid substitutions. Sites of interest for substitutional mutagenesis include the CDRs and/or the framework regions (FRs). Amino acid substitutions may be introduced into an anti-PSMA antibody moiety of interest and the products screened for a desired activity, e.g., retained/improved binding to PSMA (e.g., cell surface-bound PSMA), decreased immunogenicity, or improved ADCC or CDC, etc. Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an anti-PSMA antibody moiety with an N-terminal methionyl residue. Other insertional variants of the anti-PSMA antibody moiety include the fusion to the N- or C-terminus of the antibody moiety to an enzyme (e.g. for ADEPT) or a polypeptide which increases the serum half-life of the anti-PSMA antibody moiety.
(92) In some embodiments, an anti-PSMA antibody moiety sequence variant comprises one or more conservative amino acid substitutions, as shown in Table 5 below.
(93) TABLE-US-00007 TABLE 5 Conservative Substitutions Original Exemplary Preferred Residue Substitutions Substitutions Ala (A) Val; Leu; Ile Val Arg (R) Lys; Gln; Asn Lys Asn (N) Gln; His; Asp, Lys; Arg Gln Asp (D) Glu; Asn Glu Cys (C) Ser; Ala Ser Gln (Q) Asn; Glu Asn Glu (E) Asp; Gln Asp Gly (G) Ala Ala His (H) Asn; Gln; Lys; Arg Arg Ile (I) Leu; Val; Met; Ala; Phe; Norleucine Leu Leu (L) Norleucine; Ile; Val; Met; Ala; Phe Ile Lys (K) Arg; Gln; Asn Arg Met (M) Leu; Phe; Ile Leu Phe (F) Trp; Leu; Val; Ile; Ala; Tyr Tyr Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Val; Ser Ser Trp (W) Tyr; Phe Tyr Tyr (Y) Trp; Phe; Thr; Ser Phe Val (V) Ile; Leu; Met; Phe; Ala; Norleucine Leu
(94) Amino acids may be grouped into different classes according to common side-chain properties:
(95) TABLE-US-00008 a) Hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile; b) Neutral hydrophilic: Cys, Ser, Thr, Asn, Gln; c) Acidic: Asp, Glu; d) Basic: His, Lys, Arg; e) Residues that influence Gly, Pro; chain orientation: f) Aromatic: Trp, Tyr, Phe.
(96) Non-conservative substitutions entail exchanging a member of one of these classes for another class.
(97) An exemplary substitutional variant is an affinity matured antibody moiety, which may be conveniently generated, e.g., using phage display-based affinity maturation techniques. Briefly, one or more CDR residues are mutated and the variant antibody moieties displayed on phage and screened for a particular biological activity (e.g. binding affinity). Alterations (e.g., substitutions) may be made in CDRs, e.g., to improve antibody moiety affinity. Such alterations may be made in CDR hotspots, i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g., Chowdhury, Methods Mol. Biol. 207:179-196 (2008)), and/or specificity determining residues (SDRs), with the resulting variant V.sub.H or V.sub.L being tested for binding affinity. Affinity maturation by constructing and reselecting from secondary libraries has been described, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178:1-37 (O'Brien et al., ed., Human Press, Totowa, NJ, (2001).)
(98) In some embodiments, one or more CDR sequences provided herein is either is unaltered, or contains no more than one, two, three, four, or five amino acid substitutions. In some embodiments a V.sub.H and/or V.sub.L sequence provided herein is either is unaltered, or contains no more than one, two, three, four, or five amino acid substitutions. In some embodiments one or more CDR sequences within a V.sub.H and/or V.sub.L sequence provided herein is either is unaltered, or contains no more than one, two, three, four, or five amino acid substitutions.
(99) Diversity may be introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis). A secondary library is then created. The library is then screened to identify any antibody moiety variants with the desired affinity. Another method to introduce diversity involves CDR-directed approaches, in which several CDR residues (e.g., 4-6 residues at a time) are randomized. CDR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling. CDR-H3 and CDR-L3 in particular are often targeted.
(100) The anti-PSMA antibodies or anti-PSMA antibody moieties may also be identified by screening combinatorial libraries for antibodies with the desired activity or activities. For example, a variety of methods are known in the art for generating polypeptide display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, e.g., in Hoogenboom et al., Methods in Molecular Biology 178:1-37 (O'Brien et al., ed., Human Press, Totowa, N.J., 2001) and further described, e.g., in McCafferty et al., Nature 348:552-554; Clackson et al., Nature 352: 624-628 (1991); Marks et al., J Mol. Biol. 222: 581-597 (1992); Marks and Bradbury, Methods in Molecular Biology 248:161-175 (Lo, ed., Human Press, Totowa, N.J., 2003); Sidhu et al., J Mol. Biol. 338(2): 299-310 (2004); Lee et al., J Mol. Biol. 340(5): 1073-1093 (2004); Fellouse, Proc. Natl. Acad. Sci. USA 101(34): 12467-12472 (2004); and Lee et al., J Immunol. Methods 284(1-2): 119-132(2004).
(101) In certain phage display methods, repertoires of V.sub.H and V.sub.L genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et al., Ann. Rev. Immunol., 12: 433-455 (1994). Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments. Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas. Alternatively, the naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies to a wide range of non-self as well as self antigens without any immunization as described by Griffiths et al., EMBO J, 12: 725-734 (1993). Finally, naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom and Winter, J Mol. Biol., 227: 381-388 (1992). Patent publications describing human antibody phage libraries include, for example: U.S. Pat. No. 5,750,373, and US Patent Publication Nos. 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126, 2007/0160598, 2007/0237764, 2007/0292936, and 2009/0002360.
(102) Anti-PSMA antibody moiety sequence variants can be prepared using phage display to screen libraries for antibodies specific to PSMA (e.g., a cell surface-bound PSMA). The library can be a human scFv phage display library having a diversity of at least 1?10.sup.9 (such as at least about any one of 1?10.sup.9, 2.5?10.sup.9, 5?10.sup.9, 7.5?10.sup.9, 1?10.sup.10, 2.5?10.sup.10, 5?10.sup.10, 7.5?10.sup.10, or 1?10.sup.11) unique human antibody fragments. In some embodiments, the library is a na?ve human library constructed from DNA extracted from human PMBCs and spleens from healthy donors, encompassing all human heavy and light chain subfamilies. In some embodiments, the library is a na?ve human library constructed from DNA extracted from PBMCs isolated from patients with various diseases, such as patients with autoimmune diseases, cancer patients, and patients with infectious diseases. In some embodiments, the library is a semi-synthetic human library, wherein heavy chain CDR3 is completely randomized, with all amino acids (with the exception of cysteine) equally likely to be present at any given position (see, e.g., Hoet, R. M. et al., Nat. Biotechnol. 23(3):344-348, 2005). In some embodiments, the heavy chain CDR3 of the semi-synthetic human library has a length from about 5 to about 24 amino acids (such as about any of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24 amino acids). In some embodiments, the library is a non-human phage display library.
(103) Phage clones that bind to PSMA (e.g., a cell surface-bound human PSMA) with high affinity can be selected by iterative binding of phage to PSMA, which is bound to a solid support (such as, for example, beads for solution panning or mammalian cells for cell panning), followed by removal of non-bound phage and by elution of specifically bound phage. In an example of solution panning, the PSMA can be biotinylated for immobilization to a solid support. The biotinylated PSMA is mixed with the phage library and a solid support, such as streptavidin-conjugated Dynabeads M-280, and then PSMA-phage-bead complexes are isolated. The bound phage clones are then eluted and used to infect an appropriate host cell, such as E. coli XL1-Blue, for expression and purification.
(104) In another example of cell panning, mammalian cells expressing cell surface-bound PSMA (such as Jurkat cells expressing human PSMA) are mixed with the phage library, after which the cells are collected and the bound clones are eluted and used to infect an appropriate host cell for expression and purification. The panning can be performed for multiple (such as about any of 2, 3, 4, 5, 6 or more) rounds via solution panning, cell panning, or a combination of both, to enrich for phage clones binding specifically to the PSMA. Enriched phage clones can be tested for specific binding to PSMA by any methods known in the art, including for example ELISA and FACS.
(105) A useful method of identification of residues or regions of an anti-PSMA antibody moiety that may be targeted for mutagenesis is called alanine scanning mutagenesis as described by Cunningham and Wells (1989) Science, 244:1081-1085. In this method, a residue or group of target residues (e.g., charged residues such as Arg, Asp, His, Lys, and Glu) are identified and replaced by a neutral or negatively charged amino acid (e.g., alanine or polyalanine) to determine whether the interaction of the antibody moiety with antigen is affected. Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions. Alternatively, or additionally, a crystal structure of an antigen-antibody moiety complex can be determined to identify contact points between the antibody moiety and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution. Variants may be screened to determine whether they contain the desired properties.
(106) An anti-PSMA antibody moiety provided herein may additionally comprise one or more peptide tag sequences, peptide linker sequences (including self-cleaving linkers), cleavage sites, or other peptide sequences (e.g., signal peptides). An exemplary signal peptide sequence is METDTLLLWVLLLWVPGSTG (SEQ ID NO: 128). Exemplary peptide linker sequences, cleavage sites, and peptide tag sequences are shown in Tables 6A and 6B below.
(107) TABLE-US-00009 TABLE6A ExemplaryPeptideLinkers andCleavageSites SRGGGGSG GGGGS SGGG GGSGGSGG GGGSGGGG (SEQID (SEQID SGGS SLEMA NO:140) NO: (SEQID (SEQID 147) NO: NO:24) 154) RAKRS GGGGSGGG GSGS GGSG (SEQID GS (SEQID (SEQID NO:129) (SEQID NO: NO: NO: 148) 155) 141) GSGAPVKQ GGGGSGGG GSGSGS GGSGGGSG TLNFDLLK GSGGGGS (SEQID LAGDVESN (SEQID NO: (SEQID PGP NO: 149) NO: (SEQID 142) 156) NO:130) RAKRSGSG AAATG GSGSGSGS GGSGGGSG APVKQTLN (SEQID GGSG FDLLKLAG NO: (SEQID (SEQID DVESNPGP 143) NO: NO: (SEQID 150) 157) NO:131) GSGATNFS TPLGDTTH GSGSGSGS LLKQAGDV TSG GS EENPGP (SEQID (SEQID (SEQID NO: NO: NO:132) 144) 151) RAKRSGSG AAA GGSGGS ATNFSLLK (SEQID (SEQID QAGDVEEN NO: NO: PGP 145) 152) (SEQID NO:133) GSRGGGGS GGSG GGSGGSGG GGGGSGGG (SEQID S GSLEMA NO: (SEQID (SEQID 146) NO: NO:139) 153)
(108) TABLE-US-00010 TABLE6B ExemplaryPeptideTags EQKLISEEDL HHHHHH (SEQIDNO:136) (SEQIDNO:158) DYKDHDGDYKDHDIDYKDDDDK YPYDVPDYA (SEQIDNO:137) (SEQIDNO:159) DYKDDDDK YPYDVPDYAS (SEQIDNO138) (SEQIDNO:160)
Full-Length Anti-PSMA Antibodies
(109) In some embodiments, the anti-PSMA construct provided herein is or comprises a full-length antibody, e.g., a full-length antibody comprising an anti-PSMA antibody moiety, also referred to herein as a full-length anti-PSMA antibody. In some embodiments, the full-length antibody is a monoclonal antibody, as described in further detail elsewhere herein.
(110) In some embodiments, the full-length anti-PSMA antibody comprises an Fc sequence from an immunoglobulin, e.g., a human immunoglobulin such as IgA, IgD, IgE, IgG, or IgM. In some embodiments, the full-length anti-PSMA antibody comprises an Fc sequence of IgG, e.g., a human IgG, such as any of IgG1, IgG2, IgG3, or IgG4. In some embodiments, the full-length anti-PSMA antibody comprises an Fc sequence of a rabbit, rat, or mouse immunoglobulin. In some embodiments, the full-length anti-PSMA antibody comprises an Fc sequence of a non-human primate (e.g., a rhesus monkey or cynomolgus monkey). In some embodiments, the full-length anti-PSMA antibody comprises an Fc sequence that has been altered or otherwise changed so that it has enhanced antibody dependent cellular cytotoxicity (ADCC) function and/or enhanced complement dependent cytotoxicity (CDC) effector function, as described in further detail elsewhere herein.
(111) The amino acid sequences of exemplary full length anti-PSMA antibodies that comprise an human IgG1 Fc region are provided in Table 7 below. The V.sub.L in each light chain is underlined, and the V.sub.H in each heavy chain is underlined. The CDRs are in bold type.
(112) TABLE-US-00011 TABLE7 ExemplaryfulllengthCloneAanti-PSMA antibodycomprisingahumanIgG1Fc E2212EL Heavychain: EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIG WVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTI SADKSISTAYLQWSSLKASDTAMYYCARSMGSSLY ASSDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTS GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKP SNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEW ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQIDNO:39) LightChain: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDV HWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSG TSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTG TKVTVLGQPKANPTVTLFPPSSEELQANKATLVCL ISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNN KYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKT VAPTECS (SEQIDNO:40) ExemplaryfulllengthCloneBanti-PSMA antibodycomprisingahumanIgG1Fc E2.912LU Heavychain: EVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVG WVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTI SADKSISTAYLQWSSLKASDTAMYYCARDSYYGID VWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTA ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK VDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGK (SEQIDNO:41) LightChain: QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVN WYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGT SASLAISGLQSEDEADYYCAAWDDSLNGYVFGTGT KVTVLGQPKANPTVTLFPPSSEELQANKATLVCLI SDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNK YAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTV APTECS (SEQIDNO:42)
(113) In some embodiments, the full length anti-PSMA IgG1 antibody comprises a heavy chain that comprises a V.sub.H described herein and a light chain that comprises a V.sub.L described herein. In some embodiments, the full length anti-PSMA IgG1 antibody comprises a heavy chain that comprises an amino acid sequence that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 39 and a light chain that comprises an amino acid sequence that has at least about 850% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 40. In some embodiments, the full length anti-PSMA IgG1 antibody comprises a heavy chain that comprises an amino acid sequence that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 970, 980%, or 990%) sequence identity to SEQ ID NO: 41 and a light chain that comprises an amino acid sequence that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 42.
(114) Human and Humanized Anti-PSMA Antibodies and Antibody Moieties
(115) In some embodiments, the anti-PSMA construct comprises an anti-PSMA antibody moiety that is a human or humanized. Humanized forms of non-human (e.g., murine) antibody moieties are chimeric immunoglobulins, immunoglobulin chains, or fragments thereof (such as Fv, Fab, Fab, F(ab).sub.2, scFv, or other antigen-binding subsequences of full-length antibodies that typically contain minimal sequence derived from non-human immunoglobulin. Humanized antibody moieties include human immunoglobulins (recipient antibodies) in which residues from one or more CDRs of the recipient are replaced by residues (import residues) from a CDR of a non-human species (donor antibody) such as a mouse, rat, or rabbit antibody having the desired specificity, affinity, and capacity. In some instances, Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues. Humanized antibodies can also comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences. In general, the humanized antibody can comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin, and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. In some embodiments, the humanized antibody will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. See, e.g., Jones et al., Nature, 321: 522-525 (1986); Riechmann et al., Nature, 332: 323-329 (1988); Presta, Curr. Op. Struct. Biol., 2:593-596 (1992), Verhoeyen et al., Science, 239: 1534-1536 (1988), and U.S. Pat. No. 4,816,567.
(116) As an alternative to humanization, human antibodies can be generated. For example, it is now possible to produce transgenic animals (e.g., mice) that are capable, upon immunization, of producing a full repertoire of human antibodies in the absence of endogenous immunoglobulin production. For example, it has been described that the homozygous deletion of the antibody heavy-chain joining region (JH) gene in chimeric and germ-line mutant mice results in complete inhibition of endogenous antibody production. Transfer of the human germ-line immunoglobulin gene array into such germ-line mutant mice will result in the production of human antibodies upon antigen challenge. See, e.g., Jakobovits et al., PNAS USA, 90:2551 (1993); Jakobovits et al., Nature, 362:255-258 (1993); Bruggemann et al., Year in Immunol., 7:33 (1993); U.S. Pat. Nos. 5,545,806, 5,569,825, 5,591,669; 5,545,807; and WO 97/17852. Alternatively, human antibodies can be made by introducing human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed that closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; and 5,661,016, and Marks et al., Bio Technology, 10: 779-783 (1992); Lonberg et al., Nature, 368: 856-859 (1994); Morrison, Nature, 368: 812-813 (1994); Fishwild et al., Nature Biotechnology, 14: 845-851 (1996); Neuberger, Nature Biotechnology, 14: 826 (1996); Lonberg and Huszar, Intern. Rev. Immunol., 13: 65-93 (1995).
(117) Human antibodies may also be generated by in vitro activated B cells (see U.S. Pat. Nos. 5,567,610 and 5,229,275) or by using various techniques known in the art, including phage display libraries. Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991). The techniques of Cole et al. and Boerner et al. are also available for the preparation of human monoclonal antibodies. Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985) and Boerner et al., J. Immunol., 147(1): 86-95 (1991).
(118) Monoclonal Anti-PSMA Antibodies and Antibody Moieties
(119) In some embodiments, an anti-PSMA construct of the present disclosure comprises a monoclonal anti-PSMA antibody or a monoclonal anti-PSMA antibody moiety. Monoclonal antibodies can be prepared, e.g., using hybridoma methods, such as those described by Kohler and Milstein, Nature, 256:495 (1975) and Sergeeva et al., Blood, 117(16):4262-4272, using the phage display methods described herein and in the Examples below, or using recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567).
(120) In a hybridoma method, a hamster, mouse, or other appropriate host animal is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent. Alternatively, the lymphocytes can be immunized in vitro. The immunizing agent can include a polypeptide or a fusion protein of the protein of interest, or a complex comprising at least two molecules. Generally, peripheral blood lymphocytes (PBLs) are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired. The lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell. See, e.g., Goding, Monoclonal Antibodies: Principles and Practice (New York: Academic Press, 1986), pp. 59-103. Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine, and human origin. Usually, rat or mouse myeloma cell lines are employed. The hybridoma cells can be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells. For example, if the parental cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which prevents the growth of HGPRT-deficient cells.
(121) In some embodiments, the immortalized cell lines fuse efficiently, support stable high-level expression of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium. In some embodiments, the immortalized cell lines are murine myeloma lines, which can be obtained, for instance, from the Salk Institute Cell Distribution Center, San Diego, California and the American Type Culture Collection, Manassas, Virginia Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies. Kozbor, J. Immunol., 133:3001 (1984); Brodeur et al. Monoclonal Antibody Production Techniques and Applications (Marcel Dekker, Inc.: New York, 1987) pp. 51-63.
(122) The culture medium in which the hybridoma cells are cultured can then be assayed for the presence of monoclonal antibodies directed against the polypeptide. The binding specificity of monoclonal antibodies produced by the hybridoma cells can be determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA). Such techniques and assays are known in the art. The binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson and Pollard, Anal. Biochem., 107:220 (1980).
(123) After the desired hybridoma cells are identified, the clones can be sub cloned by limiting dilution procedures and grown by standard methods. Goding, supra. Suitable culture media for this purpose include, for example, Dulbecco's Modified Eagle's Medium and RPMI-1640 medium. Alternatively, the hybridoma cells can be grown in vivo as ascites in a mammal.
(124) The monoclonal antibodies secreted by the sub clones can be isolated or purified from the culture medium or ascites fluid by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
(125) In certain embodiments, the anti-PSMA antibody or antibody moiety is monovalent. Methods for preparing monovalent antibodies are known in the art. One exemplary method involves recombinant expression of immunoglobulin light chain and modified heavy chain. The heavy chain is truncated generally at any point in the Fc region so as to prevent heavy-chain crosslinking. Alternatively, the relevant cysteine residues are substituted with another amino acid residue or are deleted so as to prevent crosslinking.
(126) In vitro methods are also suitable for preparing monovalent antibodies. Digestion of antibodies to produce fragments thereof, particularly Fab fragments, can be accomplished using any method known in the art.
(127) Antibody variable domains with the desired binding specificities (antibody-antigen combining sites) can be fused to immunoglobulin constant-domain sequences. The fusion preferably is with an immunoglobulin heavy-chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. In some embodiments, the first heavy-chain constant region (CH1) containing the site necessary for light-chain binding is present in at least one of the fusions. DNAs encoding the immunoglobulin heavy-chain fusions and, if desired, the immunoglobulin light chain, are inserted into separate expression vectors, and are co-transfected into a suitable host organism. For further details of generating bispecific antibodies, see, for example, Suresh et al., Methods in Enzymology, 121: 210 (1986).
(128) Monoclonal antibodies can also be made by recombinant DNA methods, such as those described in U.S. Pat. No. 4,816,567. DNA encoding the monoclonal anti-PSMA antibodies can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies). Hybridoma cells as described above or PSMA-specific phage clones can serve as a source of such DNA. Once isolated, the DNA can be placed into expression vectors, which are then transfected into host cells such as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. The DNA also can be modified, for example, by substituting the coding sequence for human heavy- and light-chain constant domains and/or framework regions in place of the homologous non-human sequences (U.S. Pat. No. 4,816,567; Morrison et al., supra) or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide. Such a non-immunoglobulin polypeptide can be substituted for the constant domains of an anti-PSMA antibody, or can be substituted for the variable domains of one antigen-combining site of an anti-PSMA antibody to create a chimeric bivalent antibody.
(129) Multispecific Anti-PSMA Constructs
(130) In some embodiments, the anti-PSMA construct is multispecific. Multispecific anti-PSMA constructs provided herein demonstrate binding specificities for at least two different antigens or two different epitopes (e.g., two different epitopes on the same antigen). Multispecific constructs comprising more than two valencies and/or antigen specificities are also contemplated. For example, trispecific antibodies can be prepared. See, e.g., Tutt et al. J. Immunol. 147: 60 (1991). Thus, in some embodiments, the multispecific anti-PSMA construct comprises an anti-PSMA antibody moiety and at least one additional binding moiety, such as an antigen-binding moiety, e.g., an antibody moiety.
(131) In some embodiments, the multispecific (e.g., bispecific) anti-PSMA construct comprises a) an anti-PSMA antibody moiety (such as described herein) that specifically binds to PSMA (e.g., a cell surface-bound PSMA), and b) a second binding moiety (such as an antigen-binding moiety). In some embodiments, the second binding moiety specifically binds to an epitope on PSMA (e.g., PSMA expressed on the surface of a cell, such as a cancer cell) that does not overlap with the epitope bound by the anti-PSMA antibody moiety. In some embodiments, the second binding moiety specifically binds to a different antigen (i.e., an antigen other than PSMA). In some embodiments, the second binding moiety specifically binds to an antigen on the surface of a cell, such as a cancer cell or an immune cell. In some embodiments, the second binding moiety specifically binds to an antigen on the surface of a lymphocyte, such as a T cell, an NK cell, a neutrophil, a monocyte, a macrophage, or a dendritic cell. In some embodiments, the second binding moiety specifically binds to an effector T cell, such as a cytotoxic T cell (also known as cytotoxic T lymphocyte (CTL) or T killer cell). In some embodiments, the second binding moiety is an antibody moiety.
(132) In some embodiments, the multispecific anti-PSMA construct comprises a) an anti-PSMA antibody moiety (such as described herein) that specifically binds to PSMA (e.g., PSMA expressed on the surface of a cell, such as a cancer cell), and b) a second binding moiety that binds specifically to CD3. In some embodiments, the second binding moiety is an antibody moiety that binds CD3. In some embodiments, the second antigen-binding moiety is a human, humanized, or semi-synthetic antibody moiety. In some embodiments, the second binding moiety specifically binds to CD3?. In some embodiments, the second binding moiety specifically binds to an agonistic epitope of CD3?. In some embodiments, the term agonistic epitope refers to an epitope that, upon binding of the multispecific molecule, optionally upon binding of several multispecific molecules on the same cell, allows said multispecific molecules to activate TCR signaling and induce T cell activation. In some embodiments, the term agonistic epitope refers to an epitope that is solely composed of amino acid residues of the epsilon chain of CD3 and is accessible for binding by the multispecific molecule, when presented in its natural context on T cells (i.e. surrounded by the TCR, the CD3? chain, etc.). In some embodiments, the term agonistic epitope refers to an epitope that, upon binding of the multispecific molecule, does not lead to stabilization of the spatial position of CD3? relative to CD3?. In some embodiments, the multispecific anti-PSMA construct further comprises at least one (such as at least about any of 2, 3, 4, 5, or more) additional antigen-binding moieties.
(133) In some embodiments, the multispecific anti-PSMA construct comprises a) an anti-PSMA antibody moiety (such as described herein) that specifically binds to PSMA (e.g., PSMA expressed on the surface of a cell, such as a cancer cell), and b) a second binding moiety that binds specifically to an antigen on the surface of an effector cell, including for example CD3?, CD3?, CD3?, CD3?, CD28, CD16a, CD56, CD68, and GDS2D. In some embodiments, the second binding moiety is an antibody moiety. In some embodiments, the second antigen-binding moiety is a human, humanized, or semi-synthetic antibody moiety. In some embodiments, the multispecific anti-PSMA construct further comprises at least one (such as at least about any of 2, 3, 4, 5, or more) additional antigen-binding moieties.
(134) In some embodiments, the multispecific anti-PSMA construct comprises a) an anti-PSMA antibody moiety (such as described herein) that specifically binds to PSMA (e.g., PSMA expressed on the surface of a cell, such as a cancer cell), and b) a second binding moiety that binds specifically to a component of the complement system, such as C1q. C1q is a subunit of the C1 enzyme complex that activates the serum complement system. In some embodiments, the second binding moiety is an antibody moiety. In some embodiments, the second antigen-binding moiety is a human, humanized, or semi-synthetic antibody moiety. In some embodiments, the multispecific anti-PSMA construct further comprises at least one (such as at least about any of 2, 3, 4, 5, or more) additional antigen-binding moieties.
(135) In some embodiments, the multispecific anti-PSMA construct comprises a) an anti-PSMA antibody moiety (such as described herein) that specifically binds to PSMA (e.g., PSMA expressed on the surface of a cell, such as a cancer cell), and b) a second binding moiety that specifically binds to an Fc receptor, e.g., an Fc? receptor (Fc?R). The Fc?R may be an Fc?RIII present on the surface of natural killer (NK) cells or one of Fc?RI, Fc?RIIA, Fc?RIIBI, Fc?RIIB2, and Fc?RIIIB present on the surface of macrophages, monocytes, neutrophils and/or dendritic cells. In some embodiments, the second binding moiety is an antibody moiety. In some embodiments, the second antigen-binding moiety is a human, humanized, or semi-synthetic antibody moiety. In some embodiments, the second binding moiety that is an Fc region or functional fragment thereof. In some embodiments, functional fragment refers to a fragment of an antibody Fc region that is still capable of binding to an FcR, in particular to an Fc?R, with sufficient specificity and affinity to allow an Fc?R bearing effector cell, in particular a macrophage, a monocyte, a neutrophil and/or a dendritic cell, to kill the target cell by cytotoxic lysis or phagocytosis. A functional Fc fragment is capable of competitively inhibiting the binding of the original, full-length Fc portion to an FcR such as Fc?RI, Fc?RIIA, Fc?RIIBI, Fc?RIIB2, or Fc?RIIIB. In some embodiments, a functional Fc fragment retains at least 30%, 40%, 50%, 60%, 70%, 80%, 90% or 95% of its affinity to an Fc?R, such as an activating Fc?R. In some embodiments, the Fc region or functional fragment thereof is an enhanced Fc region or functional fragment thereof. As used herein, enhanced Fc region refers to an Fc region that is modified to enhance Fc receptor-mediated effector-functions, in particular antibody-dependent cell-mediated cytotoxicity (ADCC), complement-dependent cytotoxicity (CDC), and antibody-mediated phagocytosis. For example, an Fc region can be altered in a way that leads to an increased affinity for an activating receptor (e.g. Fc?RIIIA (CD16A) expressed on natural killer (NK) cells) and/or a decreased binding to an inhibitory receptor (e.g. Fc?RIIB1/B2 (CD32B)). In some embodiments, the second antigen-binding moiety is an antibody or antigen-binding fragment thereof that specifically binds to an FcR, in particular to an Fc?R, with sufficient specificity and affinity to allow an Fc?R bearing effector cell, in particular a macrophage, a monocyte, a neutrophil and/or a dendritic cell, to kill the target cell by cytotoxic lysis or phagocytosis. In some embodiments, the multispecific anti-PSMA construct further comprises at least one (such as at least about any of 2, 3, 4, 5, or more) additional antigen-binding moieties.
(136) In some embodiments, the multispecific anti-PSMA construct allows killing of target cells (such as cancer cells) expressing PSMA on their surfaces. In some embodiments, the multispecific anti-PSMA construct effectively redirects cytotoxic T lymphocytes (CTLs) to lyse target cells (such as cancer cells) expressing (such as overexpressing) PSMA on their surfaces. In some embodiments, the multispecific (e.g., bispecific) anti-PSMA construct has an in vitro EC.sub.50 value ranging from 10 to 500 ng/ml. In some embodiments, the multispecific (e.g., bispecific) anti-PSMA construct capable of inducing redirected lysis of about 50% of the target cells through CTLs at a ratio of CTLs:target cells of from about 1:1 to about 50:1 (such as from about 1:1 to about 15:1, or from about 2:1 to about 10:1).
(137) In some embodiments, the multispecific (e.g., bispecific) anti-PSMA construct is capable of cross-linking a stimulated or unstimulated CTL and the target cell (such as a cancer cell) in such a way that the target cell is lysed. This offers the advantage that no generation of target-specific T cell clones or common antigen presentation by dendritic cells is required for the multispecific anti-PSMA construct to exert its desired activity. In some embodiments, a multispecific anti-PSMA construct provided herein is capable of redirecting CTLs to lyse the target cells (such as cancer cells) in the absence of other activating signals. In some embodiments, the second antigen-binding moiety of the multispecific anti-PSMA construct specifically binds to CD3 (e.g., CD3R), and signaling through CD28 and/or IL-2 is not required for redirecting CTLs to lyse the target cells (e.g., cancer cells).
(138) Methods for measuring the preference of the multispecific anti-PSMA construct to simultaneously bind to two antigens (e.g., two different antigens on two different cells or, alternatively two different antigens of the same cell) are within the capabilities of a person of ordinary skill in the art. For example, when the second binding moiety of a multispecific anti-PSMA construct specifically binds to CD3, the multispecific anti-PSMA construct may be contacted with a mixture of CD3.sup.+/PSMA.sup.? cells and CD3.sup.?/PSMA.sup.+ cells. The number of single cells bound by the multispecific anti-PSMA constructs and the number of cross-linked cells bound by the multispecific anti-PSMA constructs may then be assessed by fluorescence microscopy, fluorescence-activated cell sorting (FACS), and/or other methods known in the art.
(139) In some embodiments, the multispecific anti-PSMA construct is, for example, a bispecific antibody, a diabody (Db), a single-chain diabody (scDb), a tandem scDb (Tandab), a linear dimeric scDb (LD-scDb), a circular dimeric scDb (CD-scDb), a di-diabody, a tandem scFv, a tandem di-scFv, a tandem tri-scFv, a tri(a)body, a bispecific Fab2, a di-miniantibody, a tetrabody, an scFv-Fc-scFv fusion, a dual-affinity retargeting (DART) antibody, a dual variable domain (DVD) antibody, an IgG-scFab, an scFab-ds-scFv, an Fv2-Fc, an IgG-scFv fusion, a dock and lock (DNL) antibody, a knob-into-hole (KiH) antibody (bispecific IgG prepared by the KiH technology), a DuoBody (bispecific IgG prepared by the Duobody technology), a heteromultimeric antibody, or a heteroconjugate antibody. In some embodiments, the multispecific anti-PSMA molecule is a tandem scFv (e.g., a tandem di-scFv). It is to be appreciated that one of ordinary skill in the art could select appropriate features of various multispecific constructs known in the art and combine them with one another to form a further multispecific anti-PSMA construct within the scope of this disclosure.
(140) Suitable methods for making multispecific constructs (e.g., bispecific antibodies) are well known in the art. For example, the production of bispecific antibodies can based on the co-expression of two immunoglobulin heavy-chain/light-chain pairs, where the two pairs each have different specificities, and upon association result in a heterodimeric antibody (see, e.g., Milstein and Cuello, Nature, 305: 537-539 (1983); WO 93/08829, and Traunecker et al., EMBO J. 10: 3655 (1991)). Because of the random assortment of immunoglobulin heavy and light chains, these hybridomas (quadromas) produce a potential mixture of ten different antibody molecules, of which only one has the correct bispecific structure. The purification of the correct molecule is usually accomplished by affinity chromatography steps. Similar procedures are disclosed in WO 93/08829 and in Traunecker et al., EMBO, 10: 3655-3659 (1991). Alternatively, the combining of heavy and light chains can be directed by taking advantage of species-restricted pairing (see, e.g., Lindhofer et al., J. Immunol., 155:219-225 (1995)) and the pairing of heavy chains can be directed by use of knob-into hole engineering of CH3 domains (see, e.g., U.S. Pat. No. 5,731,168; Ridgway et al., Protein Eng., 9(7):617-621 (1996)). Multispecific antibodies may also be made by engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules (see, e.g., WO 2009/089004A1). In yet another method, stable bispecific antibodies can be generated by controlled Fab-arm exchange, where two parental antibodies having distinct antigen specificity and matched point mutations in the CH3 domains are mixed in reducing condition to allow for separation, reassembly, and reoxidation to form highly pure bispecific antibodies. Labrigin et al., Proc. Natl. Acad. Sci., 110(13):5145-5150 (2013). Such antibodies, comprising a mixture of heavy-chain/light-chain pairs, are also referred to herein as heteromultimeric antibodies.
(141) Antibodies or antigen-binding fragments thereof having different specificities can also be chemically cross-linked to generate multispecific heteroconjugate antibodies. For example, two F(ab)2 molecules, each having specificity for a different antigen, can be chemically linked. Pullarkat et al., Trends Biotechnol., 48:9-21 (1999). Such antibodies have, for example, been proposed to target immune-system cells to unwanted cells (U.S. Pat. No. 4,676,980), and for treatment of HIV infection. WO 91/00360; WO 92/200373; EP 03089. It is contemplated that the antibodies can be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents. For example, immunotoxins can be constructed using a disulfide-exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include iminothiolate and methyl-4-mercaptobutyrimidate and those disclosed, for example, in U.S. Pat. No. 4,676,980.
(142) In some embodiments, multispecific anti-PSMA constructs can be prepared using recombinant DNA techniques. For example, a bispecific antibody can be engineered by fusing two scFvs, such as by fusing them through a peptide linker, resulting in a tandem scFv (such as a tandem di-scFv). The terms anti-PSMA tandem di-scFv and bispecific anti-PSMA antibody are used interchangeably herein. In some embodiments, the tandem scFv comprises an anti-CD3 scFv to an scFv comprising an anti-PSMA binding moiety described herein, resulting in the redirection of T cells to target cells that express (such as overexpress) PSMA. Additional details regarding the construction and expression of tandem scFvs are provided in, e.g., Mack et al., Proc. Natl. Acad. Sci., 92:7021-7025 (1995); Brischwein et al., Mol. Immunol., 43(8):1129-1143 (2006). Additional details regarding tandem scFvs of the present disclosure are provided elsewhere herein.
(143) By shortening the length of a peptide linker between two variable domains, the variable domains can be prevented from self-assembling and forced to pair with domains on a second polypeptide, resulting in a compact bispecific antibody called a diabody (Db). Holliger et al., Proc. Natl. Acad. Sci., 90:6444-6448 (1993). The two polypeptides of a Db each comprise a V.sub.H connected to a V.sub.L by a linker which is too short to allow pairing between the two domains on the same chain. Accordingly, the V.sub.H and V.sub.L domains of one polypeptide are forced to pair with the complementary V.sub.L and V.sub.H domains of another polypeptide, thereby forming two antigen-binding sites. In a modification of this format, the two polypeptides are linked by another peptide linker, resulting in a single chain diabody (scDb). In yet another modification of the Db format, dual-affinity retargeting (DART) bispecific antibodies can be generated by introducing a disulfide linkage between cysteine residues at the C-terminus of each polypeptide, optionally including domains prior to the C-terminal cysteine residues that drive assembly of the desired heterodimeric structure. Veri et al., Arthritis Rheum., 62(7):1933-1943 (2010). Dual-variable-domain immunoglobulins (DVD-Ig?), in which the target-binding variable domains of two monoclonal antibodies are combined via naturally occurring linkers to yield a tetravalent, bispecific antibody, are also known in the art. Gu and Ghayur, Methods Enzymol., 502:25-41 (2012). In yet another format, Dock and Lock (DNL), bispecific antibodies are prepared by taking advantage of the dimerization of a peptide (DDD2) derived from the regulatory subunit of human cAMP-dependent protein kinase (PKA) with a peptide (AD2) derived from the anchoring domains of human A kinase anchor proteins (AKAPs). Rossi et al., Proc. Natl. Acad. Sci., 103:6841-6846 (2006).
(144) Various techniques for making and isolating bispecific antibody fragments directly from recombinant cell culture have also been described. For example, bispecific antibodies have been produced using leucine zippers. Kostelny et al., J. Immunol., 148(5):1547-1553 (1992). This method can also be utilized for the production of antibody homodimers.
(145) Tandem scFv Constructs
(146) In some embodiments, the multispecific anti-PSMA construct is a tandem scFv construct (anti-PSMA tandem scFv) comprising a first scFv that comprises an anti-PSMA antibody moiety (such as described herein) and a second scFv that binds to a second target. In some embodiments, the tandem scFv is a di-scFv (comprising two scFv) or a tandem tri-scFv (comprising three scFv). In some embodiments, the anti-PSMA tandem scFv further comprises at least 3, 4, 5, 6, 7, 8, 9, 10, or more scFv. In some embodiments, the second scFv specifically binds to PSMA (such as an epitope that does not overlap the epitope bound by the anti-PSMA antibody moiety of the first scFv. In some embodiments, the second scFv specifically binds to another antigen (i.e., an antigen other than PSMA). In some embodiments, the second scFv specifically binds to an antigen on the surface of a cell, such as a cell that expresses PSMA (e.g., a cancer cell). In some embodiments, the second scFv specifically binds to an antigen on the surface of a cell that does not express PSMA. In some embodiments, the second scFv specifically binds to an antigen on the surface of a cytotoxic cell. In some embodiments, the second scFv specifically binds to an antigen on the surface of a lymphocyte, such as a T cell, an NK cell, a neutrophil, a monocyte, a macrophage, or a dendritic cell. In some embodiments, the second scFv specifically binds to an antigen on the surface of an effector T cell, such as a cytotoxic T cell. In some embodiments, the second scFv specifically binds to an antigen on the surface of an effector cell, including for example CD3?, CD3?, CD3?, CD3?, CD28, CD16a, CD56, CD68, and GDS2D. In some embodiments, the first scFv and/or the second scFv is human, humanized, or semi-synthetic.
(147) In some embodiments, the anti-PSMA tandem scFv comprises a) a first scFv that comprises an anti-PSMA antibody moiety (such as described herein) that specifically binds to PSMA (e.g., a cell surface-bound PSMA), and b) a second scFv that specifically binds to an antigen on the surface of a T cell. In some embodiments, the second scFv specifically binds to an antigen on the surface of an effector T cell, such as a cytotoxic T cell. In some embodiments, the second scFv specifically binds to, e.g., CD3?, CD3?, CD3?, CD3?, CD28, OX40, GITR, CD137, CD27, CD40L, or HVEM. In some embodiments, the second scFv specifically binds to an agonistic epitope on an antigen on the surface of a T cell, wherein the binding of the second scFv to the agonistic epitope enhances T cell activation. In some embodiments, the first scFv and/or the second scFv is human, humanized, or semi-synthetic.
(148) In some embodiments, the anti-PSMA tandem scFv comprises a) a first scFv that comprises an anti-PSMA antibody moiety (such as described herein) that specifically binds to PSMA (e.g., a cell surface-bound PSMA), and b) a second scFv that specifically binds to CD3?. In some embodiments, the first scFv is fused to the second scFv via a peptide linker. In some embodiments, the peptide linker is between about 5 to about 20 amino acids in length (such as about any of 5, 10, 15, or 20, including any ranges between these values). In some embodiments, the peptide linker comprises (such as consists of or consists essentially of) the amino acid sequence GGGGS (SEQ ID NO: 140), although alternative linkers (such as those in Table 6A) may be used. In some embodiments, the first scFv and/or the second scFv is human, humanized, or semi-synthetic.
(149) In some embodiments, the PSMA-binding scFv of an anti-PSMA tandem scFv provided herein binds to PSMA (e.g., a cell surface-bound PSMA) with a K.sub.d between about 0.1 pM to about 500 nM (such as about any one of 0.1 pM, 2.5 pM, 1.0 pM, 5 pM, 10 pM, 25 pM, 50 pM, 75 pM, 100 pM, 250 pM, 500 pM, 750 pM, 1 nM, 5 nM, 10 nM, 25 nM, 50 nM, 75 nM, 100 nM, 250 nM, or 500 nM, including any ranges between these values). In some embodiments, the PSMA-binding scFv of an anti-PSMA tandem scFv provided herein binds to PSMA (e.g., a cell surface-bound PSMA) with a K.sub.d between about 1 nM to about 500 nM (such as about any of 1, 5, 10, 25, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, or 500 nM, including any ranges between these values).
(150) The amino acid sequences of exemplary anti-PSMA anti-CD3 tandem di-scFvs are provided in Table 8 below. The anti-PSMA scFv in each tandem di-scFv is in plain text (i.e., not underlined). The anti-CD3 scFv in each tandem di-scFv is underlined. The linker connecting the anti-PSMA scFv and the anti-CD3 scFv is in bold italic type.
(151) TABLE-US-00012 TABLE8 CloneAanti-PSMAanti-CD3tandem di-scFv(withHistag): QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDV HWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSG TSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTG TKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQS GAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPG KGLEWMGITYPGDSDTRYSPSFQGQVTISADKSIS TAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWG QGTLVTVSS DVQLVQSGAEVKKPGASVK VSCKASGYTFTRYTMHWVRQAPGQGLEWIGYINPS RGYTNYADSVKGRFTITTDKSTSTAYMELSSLRSE DTATYYCARYYDDHYCLDYWGQGTTVTVSSGEGTS TGSGGSGGSGGADDIVLTQSPATLSLSPGERATLS CRASQSVSYMNWYQQKPGKAPKRWIYDTSKVASGV PARFSGSGSGTDYSLTINSLEAEDAATYYCQQWSS NPLTFGGGTKVEIKHHHHHH (SEQIDNO:25) CloneAanti-PSMAanti-CD3tandem di-scFv: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDV HWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSG TSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTG TKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQS GAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPG KGLEWMGITYPGDSDTRYSPSFQGQVTISADKSIS TAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWG QGTLVTVSS
DVQLVQSGAEVKKPGASVK VSCKASGYTFTRYTMHWVRQAPGQGLEWIGYINPS RGYTNYADSVKGRFTITTDKSTSTAYMELSSLRSE DTATYYCARYYDDHYCLDYWGQGTTVTVSSGEGTS TGSGGSGGSGGADDIVLTQSPATLSLSPGERATLS CRASQSVSYMNWYQQKPGKAPKRWIYDTSKVASGV PARFSGSGSGTDYSLTINSLEAEDAATYYCQQWSS NPLTFGGGTKVEIK (SEQIDNO:26) CloneBanti-PSMAanti-CD3tandem di-scEv(withHistag): QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVN WYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGT SASLAISGLQSEDEADYYCAAWDDSLNGYVFGTGT KVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSG AEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGK GLEWMGTIYPDDSDTRYGPAFQGQVTISADKSIST AYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLV TVSS
DVQLVQSGAEVKKPGASVKVSCKA SGYTFTRYTMHWVRQAPGQGLEWIGYINPSRGYTN YADSVKGRFTITTDKSTSTAYMELSSLRSEDTATY YCARYYDDHYCLDYWGQGTTVTVSSGEGTSTGSGG SGGSGGADDIVLTQSPATLSLSPGERATLSCRASQ SVSYMNWYQQKPGKAPKRWIYDTSKVASGVPARFS GSGSGTDYSLTINSLEAEDAATYYCQQWSSNPLTF GGGTKVEIKHHHHHH (SEQIDNO:27) CloneBanti-PSMAanti-CD3tandem di-scFv: QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVN WYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGT SASLAISGLQSEDEADYYCAAWDDSLNGYVFGTGT KVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSG AEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGK GLEWMGTIYPDDSDTRYGPAFQGQVTISADKSIST AYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLV TVSS
DVQLVQSGAEVKKPGASVKVSCKA SGYTFTRYTMHWVRQAPGQGLEWIGYINPSRGYTN YADSVKGRFTITTDKSTSTAYMELSSLRSEDTATY YCARYYDDHYCLDYWGQGTTVTVSSGEGTSTGSGG SGGSGGADDIVLTQSPATLSLSPGERATLSCRASQ SVSYMNWYQQKPGKAPKRWIYDTSKVASGVPARFS GSGSGTDYSLTINSLEAEDAATYYCQQWSSNPLTF GGGTKVEIK (SEQIDNO:28)
(152) Although the sequences in Table 8 comprise specific peptide linkers and peptide tags, any linker or tag (see, e.g., Tables 6A and 6B) may be used.
(153) In some embodiments, the anti-PSMA anti-CD3 tandem di-scFv comprises an amino acid sequence that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 25, 26, 27, or 28.
(154) Anti-PSMA Chimeric Antigen Receptors (Anti-PSMA CARs)
(155) In some embodiments, the anti-PSMA construct provided herein in is a chimeric antigen receptor (CAR) (also referred to herein as an anti-PSMA CAR) comprising an anti-PSMA antibody moiety (such as an anti-PSMA antibody moiety described herein). As described in further detail elsewhere herein, the present disclosure also provides CAR effector cells (e.g., T cells) that comprise, express, or as associated with an anti-PSMA CAR. Such effector cells are also referred to herein as an anti-PSMA CAR effector cells, e.g., anti-PSMA CAR immune cells or anti-PSMA CAR T cells).
(156) In some embodiments, an anti-PSMA CAR comprises a) an extracellular domain comprising an anti-PSMA antibody moiety (such as described herein) that specifically binds to PSMA (e.g., a cell surface-bound PSMA) and b) an intracellular signaling domain. In some embodiments, the anti-PSMA CAR comprises a transmembrane domain between the extracellular domain and the intracellular domain. In some embodiments, the anti-PSMA CAR further comprises a spacer. In some embodiments, the spacer connects the extracellular domain and the transmembrane domain of the anti-PSMA CAR. In some embodiments, the spacer connects the intracellular domain and the transmembrane domain of the anti-PSMA CAR. In some embodiments, the spacer domain is any oligo- or polypeptide that functions to link the transmembrane domain to the extracellular domain or the intracellular domain in the polypeptide chain. For example, a spacer domain may comprise up to about 300 amino acids, including for example between about 10 and about 100 amino acids, or between about 25 and about 50 amino acids.
(157) The transmembrane domain of the anti-PSMA CAR may be derived from a natural source or a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. For example, in some embodiments, the anti-PSMA CAR comprises a transmembrane domain (e.g., at least one transmembrane domain or at least one transmembrane region) derived from, without limitation, the ?, ?, ?, or ? chain of the T-cell receptor, CD28, CD3?, CD3?, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, or CD154. In some embodiments, the anti-PSMA CAR comprises a synthetic transmembrane domain, in which case the transmembrane domain may comprise predominantly hydrophobic residues such as leucine and valine. In some embodiments, a triplet of phenylalanine, tryptophan and valine may be found at each end of a synthetic transmembrane domain. In some embodiments, a short oligo- or polypeptide linker, having a length of, e.g., between about 2 and about 10 amino acids in length (such as about any of 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids in length) may form the linkage between the transmembrane domain and the intracellular signaling domain of the anti-PSMA CAR. In some embodiments, the linker is a glycine-serine doublet.
(158) In some embodiments, the anti-PSMA CAR comprises transmembrane domain that naturally is associated with one of the sequences in the anti-PSMA CAR's intracellular domain of. For example, if an anti-PSMA CAR intracellular domain comprises a CD28 co-stimulatory sequence, the transmembrane domain of the anti-PSMA CAR is derived from the CD28 transmembrane domain. In some embodiments, the anti-PSMA CAR comprises a transmembrane domain that has been selected or modified by amino acid substitution to minimize interactions with other members of the receptor complex and/or to avoid binding to the transmembrane domains of the same or different surface membrane proteins.
(159) The intracellular signaling domain of the anti-PSMA CAR is responsible for activation of at least one of the normal effector functions of the immune cell in which the anti-PSMA CAR is expressed. Effector function of a T cell, for example, may be cytolytic activity or helper activity, including the secretion of cytokines. Thus, in some embodiments, the term intracellular signaling domain refers to the portion of an anti-PSMA CAR that transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain. To the extent that a truncated portion of the intracellular signaling domain is used, such truncated portion may be used in place of the intact chain as long as it transduces the effector function signal. In some embodiments, the term intracellular signaling sequence refers to any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal.
(160) In some embodiments, the anti-PSMA CAR comprises an intracellular signaling that comprises the cytoplasmic sequences of the T cell receptor (TCR) and co-receptors that act in concert to initiate signal transduction following antigen receptor engagement. In some embodiments, the anti-PSMA CAR comprises an intracellular signaling domain that comprises a derivative or variant of the T cell receptor (TCR) and co-receptors, and/or any synthetic sequence that has the same functional capability.
(161) It is known that signals generated through the TCR alone are insufficient for full activation of the T cell and that a secondary or co-stimulatory signal is also required. Thus, T cell activation can be said to be mediated by two distinct classes of intracellular signaling sequences: those that initiate antigen-dependent primary activation through the TCR (primary signaling sequences or primary immune cell signaling sequences) and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal (co-stimulatory signaling sequences).
(162) Primary signaling sequences, or primary immune cell signaling sequences, regulate primary activation of the TCR complex in a stimulatory way or in an inhibitory way. Primary signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs (or ITAMs). Thus, in some embodiments, the anti-PSMA CAR comprises one or more ITAMs. In some embodiments, the anti-PSMA CAR comprises a primary immune cell signaling sequence derived from, without limitation, TCR?, FcR?, FcRO, CD3?, CD3?, CD3?, CD5, CD22, CD79a, CD79b, and CD66d. In some embodiments, the anti-PSMA CAR further comprises a costimulatory signaling sequence. In some embodiments, the costimulatory signaling sequence is a portion of the intracellular domain of a costimulatory molecule including, for example, CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and the like. In some embodiments, the anti-PSMA CAR comprises more than one costimulatory signaling sequence.
(163) In some embodiments, the anti-PSMA CAR comprises a primary immune cell signaling sequence derived from CD3?. In some embodiments, the anti-PSMA CAR comprises a primary immune cell signaling sequence derived from CD3? by itself or combined with any other desired intracellular signaling sequence(s) useful in the context of the anti-PSMA CAR provided herein. For example, in some embodiments, the anti-PSMA CAR comprises an intracellular domain that comprises a primary immune cell signaling sequence derived from CD3? and a costimulatory signaling sequence. In some embodiments, the costimulatory signaling sequence is a portion of the intracellular domain of a costimulatory molecule including, for example, CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and the like. In some embodiments, the costimulatory signaling sequence is derived from, e.g., CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and the like. In some embodiments, the anti-PSMA CAR comprises more than one costimulatory signaling sequence.
(164) In some embodiments, the anti-PSMA CAR comprises the intracellular signaling domain that comprises a primary immune cell signaling sequence derived from CD3? and a costimulatory signaling sequence derived from CD28. In some embodiments, the anti-PSMA CAR comprises the intracellular signaling domain that comprises a primary immune cell signaling sequence derived from CD3? and a costimulatory signaling sequence derived from 4-1BB. In some embodiments, the intracellular signaling domain of the anti-PSMA CAR comprises a primary immune cell signaling sequence derived from CD3? and costimulatory signaling sequences derived from CD28 and 4-1BB.
(165) In some embodiments, the anti-PSMA CAR comprises a) an extracellular domain comprising an anti-PSMA antibody moiety (such as described herein) that specifically binds to PSMA (e.g., a cell surface-bound PSMA), b) a transmembrane domain, and c) an intracellular signaling domain capable of activating an immune cell. In some embodiments, the intracellular signaling domain comprises a primary immune cell signaling sequence and a co-stimulatory signaling sequence. In some embodiments, the primary immune cell signaling sequence comprises a CD3? intracellular signaling sequence. In some embodiments, the co-stimulatory signaling sequence comprises a CD28 or 4-1BB intracellular signaling sequence. In some embodiments, the intracellular domain comprises a CD3? intracellular signaling sequence and a CD28 or 4-1BB intracellular signaling sequence. In some embodiments, the anti-PSMA CAR comprises the anti-PSMA antibody moiety (such as described herein) fused to the amino acid sequence of SEQ ID NO: 22 (see below) which comprises a CD3? intracellular signaling sequence and a CD28 intracellular signaling sequence. In some embodiments, the anti-PSMA CAR comprises the anti-PSMA antibody moiety (such as described herein) fused to the amino acid sequence of SEQ ID NO: 23 (see below) which comprises a CD3? intracellular signaling sequence and a 4-1BB intracellular signaling sequence.
(166) TABLE-US-00013 (SEQIDNO:22) AAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPS KPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSD YMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADA PAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLY QGLSTATKDTYDALHMQALPPR (SEDIDNO:23) TGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTR GLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLY IFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRS ADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGG KPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHD GLYQGLSTATKDTYDALHMQALPPR
(167) In some embodiments, the anti-PSMA antibody moiety is an scFv (such as a multispecific anti-PSMA scFv, e.g., an anti-PSMA tandem di-scFv). In some embodiments, the scFv comprises heavy and light chain variable regions linked by a peptide linker, including, but not limited to, a peptide linker comprising the amino acid sequence of SRGGGGSGGGGSGGGGSLEMA (SEQ ID NO: 24).
(168) The amino acid sequences of exemplary anti-PSMA CARs are provided Table 9 below. Each CAR comprises (sequentially, from the N-terminus to the C-terminus) an anti-PSMA scFv (plain text, i.e., no underline), a myc tag (bold underlined), a linker (bold italic type), sequences derived from CD28 (underlined), and sequences derived from CD3? (bold type and underlined).
(169) TABLE-US-00014 TABLE9 CloneAanti-PSMACAR: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQ LPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGL QAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSG GGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGY SFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQ VTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYAS SDVWGQGTLVTVSS IEVMYPPPYLDNE KSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACY SLLVTVAFTIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHY QPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNL GRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDK MAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHM QALPPR (SEQIDNO:29) CloneBanti-PSMACAR: QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQL PGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQ SEDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGG GGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYN FASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQV TISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWG QGTLVTVSS
IEVMYPPPYLDNEKSNGT IIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVT VAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAP PRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREE YDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAY SEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPP R (SEQIDNO:30)
(170) Although the sequences in Table 9 comprise specific peptide linkers and peptide tags, any linker or tag (see, e.g., Tables 6A and 6B) may be used.
(171) In some embodiments, the anti-PSMA CAR comprises an amino acid sequence that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 29 or 30.
(172) Anti-PSMA Chimeric Antibody-T Cell Receptor (TCR) Constructs (caTCRs)
(173) In some embodiments, the anti-PSMA construct is a chimeric antibody-T cell receptor construct (caTCR) comprising an anti-PSMA antibody moiety (such as an anti-PSMA antibody moiety described herein). Such construct is also referred to herein as an anti-PSMA caTCR. Exemplary caTCRs are discussed in PCT/US2016/058305 (now published as WO 2017/070608), the contents of which are incorporated herein by reference in their entirety. In some embodiments, the anti-PSMA caTCR specifically bind to PSMA (such as PSMA expressed on the surface of a cell, e.g., a cancer cell) and is capable of recruiting at least one TCR-associated signaling molecule (such as CD3??, CD3??, and/or CD3??).
(174) As described in further detail below, the present disclosure also provides an effector cell (e.g., T cell) that comprises, expresses, or is associated with an anti-PSMA-caTCR. Such effector cells are also referred to herein as an anti-PSMA caTCR effector cells e.g., anti-PSMA caTCR T cells).
(175) In some embodiments, the anti-PSMA caTCR comprises a) an antigen-binding module comprising an anti-PSMA antibody moiety (such as described herein) that specifically recognizes PSMA (e.g., cell surface-bound human PSMA), and b) a T cell receptor module (TCRM) comprising a first TCR domain (TCRD) comprising a first TCR transmembrane domain (TCR-TM) derived from one of the transmembrane domains of a naturally occurring TCR (such as an ??TCR or a ??TCR) and a second TCRD comprising a second TCR-TM derived from the other transmembrane domain of the naturally occurring TCR (such as an ??TCR or a ??TCR), wherein the TCRM facilitates recruitment of at least one TCR-associated signaling molecule (such as CD3??, CD3??, and/or CD3??), and wherein the antibody moiety is linked to the first and/or second TCRDs. In some embodiments, the first TCR-TM and the second TCR-TM are derived from a ?/? TCR. In some embodiments, the first TCR-TM is derived from a TCR ? chain and the second TCR-TM is derived from a TCR ? chain. In some embodiments, the first TCR-TM is derived from a TCR ? chain and the second TCR-TM is derived from a TCR ? chain. In some embodiments, the first TCR-TM and the second TCR-TM are derived from an ?/? TCR. In some embodiments, the first TCR-TM is derived from a TCR ? chain and the second TCR-TM is derived from a TCR ? chain. In some embodiments, the first TCR-TM is derived from a TCR ? chain and the second TCR-TM is derived from a TCR ? chain. In some embodiments, the anti-PSMA caTCR comprises naturally occurring TCR domains. In some embodiments, the anti-PSMA caTCR comprises at least one non-naturally occurring TCR domain. For example, the ?/? TCR, the ?/? TCR, the TCR ? chain, the TCR ? chain, the TCR ? chain, and/or the TCR ? chain may ne naturally occurring or non-naturally occurring. The antigen-binding module of the anti-PSMA caTCR provides the antigen specificity and a TCRM that allows for CD3 recruitment and signaling. In some embodiments, the antigen-binding module is not a naturally occurring T cell receptor antigen-binding moiety. In some embodiments, the antigen-binding module is linked to the N-terminus of a polypeptide chain in the TCRM. In some embodiments, the antigen binding module is an anti-PSMA antibody moiety selected from the group consisting of: a Fab, a Fab, a F(ab)2, an Fv, or an scFv. The TCRM comprises a transmembrane module derived from the transmembrane domains of one or more TCRs (TCR-TMs), such as an ?? and/or ?? TCR, and optionally further comprises one or both of the connecting peptides or fragments thereof of a TCR and/or one or more TCR intracellular domains or fragments thereof. In some embodiments, the TCRM comprises two polypeptide chains, each polypeptide chain comprising, from N-terminus to C-terminus, a connecting peptide, a transmembrane domain, and optionally a TCR intracellular domain. In some embodiments, the TCRM comprises one or more non-naturally occurring TCR domains. For example, in some embodiments, the TCRM comprises one or two non-naturally occurring TCR transmembrane domains. A non-naturally occurring TCR domain may be a corresponding domain of a naturally occurring TCR modified by substitution of one or more amino acids, and/or by replacement of a portion of the corresponding domain with a portion of an analogous domain from another TCR. In some embodiments, the anti-PSMA caTCR comprises a first polypeptide chain and a second polypeptide chain, wherein the first and second polypeptide chains together form the antigen-binding module and the TCRM. In some embodiments, the first and second polypeptide chains are separate polypeptide chains, and the caTCR is a multimer, such as a dimer. In some embodiments, the first and second polypeptide chains are covalently linked, such as by a peptide linkage, or by another chemical linkage, such as a disulfide linkage. In some embodiments, the first polypeptide chain and the second polypeptide chain are linked by at least one disulfide bond. In some embodiments, the anti-PSMA caTCR further comprises one or more T cell co-stimulatory signaling sequences. The one or more co-stimulatory signaling sequences can be, individually, all or a portion of the intracellular domain of a co-stimulatory molecule including, for example, CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and the like. In some embodiments, the one or more co-stimulatory signaling sequences are between the first TCR-TM and the first TCR intracellular domain and/or between the second TCR-TM and the second TCR intracellular domain. In some embodiments, the one or more co-stimulatory signaling sequences are C-terminal to the first TCRD and/or the second TCRD. In some embodiments, the anti-PSMA caTCR lacks a T cell co-stimulatory signaling sequence. In some embodiments, the caTCR lacks a functional primary immune cell signaling domain. In some embodiments, the caTCR lacks any primary immune cell signaling sequences. In some embodiments, the anti-PSMA caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the anti-PSMA caTCR. In some embodiments, the stabilization module is located between the antigen-binding module and the TCRM. In some embodiments, the anti-PSMA caTCR further comprises a spacer module between any two caTCR modules or domains. In some embodiments, the spacer module comprises one or more peptide linkers connecting two caTCR modules or domains.
(176) In some embodiments, the anti-PSMA caTCR comprises: a) a first polypeptide chain comprising a first antigen-binding domain comprising V.sub.H and C.sub.H1 antibody domains and a first T cell receptor domain (TCRD) comprising a first transmembrane domain of a first TCR subunit; and b) a second polypeptide chain comprising a second antigen-binding domain comprising V.sub.L and C.sub.L antibody domains and a second TCRD comprising a second transmembrane domain of a second TCR subunit, wherein the V.sub.H and C.sub.H1 domains of the first antigen-binding domain and the V.sub.L and C.sub.L domains of the second antigen-binding domain form an antigen-binding module that specifically binds to PSMA, and wherein the first TCRD and the second TCRD form a T cell receptor module (TCRM) that is capable of recruiting at least one TCR-associated signaling module. In some embodiments, the antigen-binding module comprises a disulfide bond between a residue in the C.sub.H1 domain and a residue in the C.sub.L domain.
(177) In some embodiments, the anti-PSMA caTCR comprises: a) a first polypeptide chain comprising a first antigen-binding domain comprising a V.sub.H antibody domain and a first TCRD comprising a first transmembrane domain of a first TCR subunit; and b) a second polypeptide chain comprising a second antigen-binding domain comprising a V.sub.L antibody domains and a second TCRD comprising a second transmembrane domain of a second TCR subunit, wherein the V.sub.H domain of the first antigen-binding domain and the V.sub.L domain of the second antigen-binding domain form an antigen-binding module that specifically binds to PSMA, wherein the first TCRD and the second TCRD form a T cell receptor module (TCRM) that is capable of recruiting at least one TCR-associated signaling module.
(178) In some embodiments, the anti-PSMA caTCR comprises a TCRM that comprises a) a first T cell receptor domain (TCRD) comprising a first TCR transmembrane domain (TCR-TM) and b) a second TCRD comprising a second TCR-TM, wherein the TCRM facilitates recruitment of at least one TCR-associated signaling molecule. In some embodiments, both of the TCR-TMs are naturally occurring. In some embodiments, at least one of the TCR-TMs is non-naturally occurring. In some embodiments, both of the TCR-TMs are non-naturally occurring. In some embodiments, the first TCR-TM is derived from one of the transmembrane domains of a T cell receptor (such as an ?? TCR or a ?? TCR) and the second TCR-TM is derived from the other transmembrane domain of the T cell receptor. In some embodiments, the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising the transmembrane domains of the T cell receptor. Recruitment of TCR-associated signaling molecules can be determined by methods known in the art, such as FACS analysis for TCR-CD3 complex surface expression or co-immunoprecipitation of CD3 subunits with the caTCR.
(179) In some embodiments, the anti-PSMA caTCR comprises an antigen-binding module that comprises a first antigen-binding domain comprising a V.sub.H antibody domain (e.g., a V.sub.H antibody domain described herein) and a second antigen-binding domain comprising a V.sub.L antibody domain (e.g., a V.sub.L antibody domain described herein). In some embodiments, the V.sub.H antibody domain and V.sub.L antibody domain CDRs are derived from the same anti-PSMA antibody moiety. In some embodiments, some of the V.sub.H antibody domain and V.sub.L antibody domain CDRs are derived from different anti-PSMA antibody moieties. In some embodiments, the V.sub.H antibody domain and/or V.sub.L antibody domain are human, humanized, chimeric, semi-synthetic, or fully synthetic.
(180) In some embodiments, the anti-PSMA caTCR comprises an antigen-binding module described herein linked to a TCRM described herein, optionally including a stabilization module. For example, in the some embodiments, the anti-PSMA caTCR comprises the antigen-binding module linked to the N-terminus of one or both of the TCRDs. In some embodiments, the anti-PSMA caTCR comprises a stabilization module between a TCRM and an antigen-binding module. In some embodiments, the anti-PSMA caTCR further comprises a spacer module between any two anti-PSMA caTCR modules or domains. In some embodiments, the spacer module comprises one or more peptide linkers between about 5 to about 70 (such as about any of 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, or 70, including any ranges between these values) amino acids in length. In some embodiments, the anti-PSMA caTCR further comprises one or more accessory intracellular domains. In some embodiments, the one or more accessory intracellular domains are carboxy-terminal to the first and/or second TCRD. In some embodiments, the one or more accessory intracellular domains are between the first TCR-TM and the first TCR intracellular domain and/or between the second TCR-TM and the second TCR intracellular domain. In some embodiments, the one or more accessory intracellular domains comprise, individually, a TCR co-stimulatory domain. In some embodiments, the TCR co-stimulatory domain comprises all or a portion of the intracellular domain of an immune co-stimulatory molecule (such as CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and the like).
(181) In some embodiments, the anti-PSMA caTCR comprises a) an antigen-binding module comprising an antibody moiety (such as described herein) that recognizes a cell surface-bound PSMA, and b) a T cell receptor module (TCRM) comprising a first TCR domain (TCRD) comprising a first TCR transmembrane domain (TCR-TM) derived from one of the transmembrane domains of a naturally occurring TCR (such as an ??TCR or a ??TCR) and a second TCRD comprising a second TCR-TM derived from the other transmembrane domain of the naturally occurring TCR (such as an ??TCR or a ??TCR), wherein the TCRM facilitates recruitment of at least one TCR-associated signaling molecule (such as CD3??, CD3??, and/or CD3??), and wherein the antibody moiety is linked to the first and/or second TCRDs.
(182) In some embodiments, the anti-PSMA caTCR comprises: a) a first polypeptide chain comprising a first antigen-binding domain comprising V.sub.H and C.sub.H1 antibody domains and a first T cell receptor domain (TCRD) comprising a first transmembrane domain of a first TCR subunit; and b) a second polypeptide chain comprising a second antigen-binding domain comprising V.sub.L and C.sub.L antibody domains and a second TCRD comprising a second transmembrane domain of a second TCR subunit, wherein the V.sub.H and C.sub.H1 domains of the first antigen-binding domain and the V.sub.L and C.sub.L domains of the second antigen-binding domain form an antigen-binding module that specifically binds to PSMA (e.g., cell surface bound-PSMA), and wherein the first TCRD and the second TCRD form a T cell receptor module (TCRM) that is capable of recruiting at least one TCR-associated signaling module. In some embodiments, the anti-PSMA caTCR comprises an antigen-binding module that comprises a disulfide bond between a residue in the C.sub.H1 domain and a residue in the C.sub.L domain.
(183) In some embodiments, the anti-PSMA caTCR comprises: a) a first polypeptide chain comprising a first antigen-binding domain comprising a V.sub.H antibody domain and a first TCRD comprising a first transmembrane domain of a first TCR subunit; and b) a second polypeptide chain comprising a second antigen-binding domain comprising a V.sub.L antibody domain and a second TCRD comprising a second transmembrane domain of a second TCR subunit, wherein the V.sub.H domain of the first antigen-binding domain and the V.sub.L domain of the second antigen-binding domain form an antigen-binding module that specifically binds to PSMA (e.g., cell surface bound-PSMA), wherein the first TCRD and the second TCRD form a T cell receptor module (TCRM) that is capable of recruiting at least one TCR-associated signaling module.
(184) The amino acid sequences of exemplary anti-PSMA caTCRs are provided in Table 10A below. The anti-PSMA V.sub.H/C.sub.H sequence in each Chain 1 is in plain text (i.e., no underlining). The TCR delta chain sequence in each Chain 1 is underlined. The anti-PSMA V.sub.L/C.sub.L sequence in each Chain 2 is bold underlined. The TCR gamma chain sequence in each Chain 2 is in italic type.
(185) TABLE-US-00015 TABLE10A CloneAanti-PSMAcaTCRCloneA Chain1: EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMP GKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYL QWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTLVTVSSA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI CNVNHKPSNTKVDKRVEPKSCEVKTDSTDHVKPKETENTK QPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFL LTAKLFFL (SEQIDNO:31) Chain2:
PIKTDVITMDPEDNCSKDANDTLLLQ LTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTA FCCNGEKS (SEQIDNO:32) CloneBanti-PSMAcaTCR Chain1: EVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVGWVRQMP GKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYL QWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSASTKG PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN HKPSNTKVDKRVEPKSCEVKTDSTDHVKPKETENTKQPSK SCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAK LFFL (SEQIDNO:34) Chain2:
PIKTDVITMDPKDNCSEDANDTLLLQL TNTSAYYMYLLLLLKSVVYFAIITCCLLRRIA FCCNGEKS (SEQIDNO:35)
(186) In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 31 and a Chain 2 that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 32. In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 34 and a Chain 2 that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 35.
(187) In some embodiments, a nucleic acid encoding exemplary anti-PSMA caTCR Clone A expresses a polypeptide comprising the amino acid sequence (with markings corresponding to those shown in Table 9):
(188) TABLE-US-00016 (SEQIDNO:33) METDTLLLWVLLLWVPGSTGEVQLVQSGAEVKKPGESLKISC KGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSF QGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYA SSDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV TVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTDSTD HVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRML FAKTVAVNFLLTAKLFFLRAKRSGSGAPVKQTLNFDLLKLAG DVESNPGPMETDTLLLWVLLLWVPGSTG
PIKTDVITMDPRDNCS KDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRR TAFCCNGEKS
In some embodiments, a nucleic acid encoding exemplary anti-PSMA caTCR Clone B expresses a polypeptide comprising the amino acid sequence (with markings corresponding to those shown in Table 9):
(189) TABLE-US-00017 (SEQIDNO:36) METDTLLLWVLLLWVPGSTGEVQLVQSGAEMKKPGESLKISCKGSGYNF ASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSIST AYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSASTKGPSVFP LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTD STDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKT VAVNFLLTAKLFFLRAKRSGSGAPVKQTLNFDLLKLAGDVESNPGPMET DTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCSGSSSNIGSN TVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQ ANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAAS SYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIKTDVITMDPK DNCSRDANDTLLLQQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAF CCNGEKS
The sequences in bold type in SEQ ID NOs: 33 and 36 correspond to signal peptides and/or self-cleaving peptides. Although SEQ ID NOs: 33 and 36 comprise specific peptide linkers any cleavable linker (see, e.g., Table 6A) may be used.
(190) In some embodiments, the nucleic acid encoding an anti-PSMA caTCR expresses a polypeptide that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 33 or SEQ ID NO: 36.
(191) In some embodiments, the anti-PSMA caTCR is a bivalent caTCR. In some embodiments, the bivalent anti-PSMA caTCR is a homobivalent anti-PSMA caTCR that comprises two anti-PSMA antibody moieties that comprise identical V.sub.H sequences and identical V.sub.L sequences. The amino acid sequences of exemplary homobivalent anti-PSMA caTCRs are provided in Table 10B below. SEQ ID NO: 165 comprises a Clone A scFv and a Clone A V.sub.H-C.sub.H1, and SEQ ID NO: 166 comprises a Clone A V.sub.L-CL. SEQ ID NO: 167 comprises a Clone A V.sub.H and Clone A V.sub.H-C.sub.H1, and SEQ ID NO: 168 comprises a Clone A V.sub.L and a Clone A V.sub.L-CL. SEQ ID NO: 169 comprises a Clone B scFv and a Clone B V.sub.H-C.sub.H1, and SEQ ID NO: 170 comprises a Clone A V.sub.L-CL. SEQ ID NO: 171 comprises a Clone B V.sub.H and Clone B V.sub.H-C.sub.H1, and SEQ ID NO: 168 comprises a Clone B V.sub.L and a Clone B V.sub.L-CL.
(192) TABLE-US-00018 TABLE10B ExemplaryhomobivalentCloneAanti-PSMAcaTCR#1 Chain1: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSSGGGGSEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQ GQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAAL GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVK TDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFL(SEQIDNO: 165) Chain2: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKA GVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIKTDVITMDPKDNCSKDANDTLLLQ LTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS(SEQIDNO:166) ExemplaryhomobivalentCloneAanti-PSMAcaTCR#2 Chain1: EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYL QWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTLVTVSSGGGGSGGGGSEVQLVQSGAEVKKPGESLKISCKGSGYSFTS YWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWG QGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP SSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRML FAKTVAVNFLLTAKLFFL(SEQIDNO:167) Chain2: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGGGGGSGGGGSQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQ LPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGQPKANPTVT LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTH EGSTVEKTVAPTECSPIKTDVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEK S(SEQIDNO:168) ExemplaryhomobivalentCloneBanti-PSMAcaTCR#1 Chain1: QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFA SYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGT LVTVSSGGGGSEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTI SADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTDSTDHVKP KETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFL(SEQIDNO:169) Chain2: QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAG VETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIKTDVITMDPKDNCSKDANDTLLLQL TNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS(SEQIDNO:170) ExemplaryhomobivalentCloneBanti-PSMAcaTCR#2 Chain1: EVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYL QWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSGGGGSGGGGSEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVG WVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVS SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT YICNVNHKPSNTKVDKRVEPKSCEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVN FLLTAKLFFL(SEQIDNO:171) Chain2: QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGGGGGSGGGGSQAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLP GTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKANPTVTLF PPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEG STVEKTVAPTECSPIKTDVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS (SEQIDNO:172)
(193) In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that has at least about 85% (e.g., at least about anyone of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 165 and a Chain 2 that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 166. In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 167 and a Chain 2 that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 168. In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 169 and a Chain 2 that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 170. In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 171 and a Chain 2 that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 172.
(194) In some embodiments, a nucleic acid encoding exemplary homobivalent Clone A anti-PSMA caTCR #1 expresses a polypeptide comprising SEQ ID NO: 47.
(195) TABLE-US-00019 (SEQIDNO:47) METDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNI GAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAIT GLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGG GSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGK GLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTA MYYCARSMGSSLYASSDVWGQGTLVTVSSGGGGSEVQLVQSGAEVKKPG ESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSF QGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQ GTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPS NTKVDKRVEPKSCEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEK VNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFLRAKRSGSGAPVKQTLNF DLLKLAGDVESNPGPMETDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAP GQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDR FSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLG QPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVK AGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKT VAPTECSPIKTDVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLK SVVYFAIITCCLLRRTAFCCNGEKS
(196) In some embodiments, a nucleic acid encoding exemplary homobivalent Clone A anti-PSMA caTCR #2 expresses a polypeptide comprising SEQ ID NO: 48.
(197) TABLE-US-00020 (SEQIDNO:48) METDTLLLWVLLLWVPGSTGEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSIST AYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTLVTVSSGGGGSG GGGSEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGL EWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMY YCARSMGSSLYASSDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGT AALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTV PSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTDSTDHVKPKETEN TKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLF FLRAKRSGSGAPVKQTLNFDLLKLAGDVESNPGPMETDTLLLWVLLLWV PGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGT APKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSY DSSLSGYVFGTGTKVTVLGGGGGSGGGGSQSVLTQPPSVSGAPGQRVTI SCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKS GTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGQPKANP TVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETT KPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC SPIKTDVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFA IITCCLLRRTAFCCNGEKS
(198) In some embodiments, a nucleic acid encoding exemplary homobivalent Clone B anti-PSMA caTCR #1 expresses a polypeptide comprising SEQ ID NO: 49.
(199) TABLE-US-00021 (SEQIDNO:49) METDTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCSGSSSNI GSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISG LQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGG SLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGKG LEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAM YYCARDSYYGIDVWGQGTLVTVSSGGGGSEVQLVQSGAEMKKPGESLKI SCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVT ISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVE PKSCEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVL GLRMLFAKTVAVNFLLTAKLFFLRAKRSGSGAPVKQTLNFDLLKLAGDV ESNPGPMETDTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCS GSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSA SLAISGLQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKANPTVTL FPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSK QSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIK TDVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITC CLLRRTAFCCNGEKS
(200) In some embodiments, a nucleic acid encoding exemplary homobivalent Clone B anti-PSMA caTCR #1 expresses a polypeptide comprising SEQ ID NO: 50.
(201) TABLE-US-00022 (SEQIDNO:50) METDTLLLWVLLLWVPGSTGEVQLVQSGAEMKKPGESLKISCKGSGYNF ASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSIST AYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSGGGGSGGGGS EVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMG TIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCAR DSYYGIDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ TYICNVNHKPSNTKVDKRVEPKSCEVKTDSTDHVKPKETENTKQPSKSC HKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFLRAKRSG SGAPVKQTLNFDLLKLAGDVESNPGPMETDTLLLWVLLLWVPGSTGQAV LTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSN NQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGYVF GTGTKVTVLGGGGGSGGGGSQAVLTQPPSASGTPGQRVTISCSGSSSNI GSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISG LQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKANPTVTLFPPSSE ELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKY AASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIKTDVITM DPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRT AFCCNGEKS
(202) Although SEQ ID NOs: 47-50 comprise specific peptide linkers, any linker (see, e.g., Table 6A) may be used.
(203) In some embodiments, the nucleic acid encoding a homobivalent anti-PSMA caTCR expresses a polypeptide that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to any one of SEQ ID NOs: 47-50.
(204) In some embodiments, the bivalent anti-PSMA caTCR is a heterobivalent anti-PSMA caTCR that comprises two anti-PSMA antibody moieties, where each anti-PSMA antibody moiety comprises a different V.sub.H sequence and/or different VL sequence. The amino acid sequences of exemplary heterobivalent anti-PSMA caTCRs are provided in Table #1C below. SEQ ID NO 173 comprises a Clone A scFv and a Clone B V.sub.H-C.sub.H1, and SEQ ID NO: 174 comprises a Clone B V.sub.L-CL. SEQ ID NO: 175 comprises a Clone B V.sub.L-CL, and SEQ ID NO: 176 comprises a Clone A scFv and a Clone B V.sub.H-C.sub.H1. SEQ ID NO 177 comprises a Clone A V.sub.H and a Clone B V.sub.H-C.sub.H1, and SEQ ID NO: 178 comprises a Clone A V.sub.L and a Clone B V.sub.L-CL. SEQ ID NO 179 comprises a Clone A V.sub.L and a Clone B V.sub.L-CL, and SEQ ID NO: 178 comprises a Clone A V.sub.H and a Clone B V.sub.H-CH1.
(205) TABLE-US-00023 TABLE10C ExemplaryheterobivalentCloneA/CloneBanti-PSMAcaTCR#1 Chain1: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSSGGGGSEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQ GQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTDST DHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFL(SEQIDNO:173) Chain2: QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAG VETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIKTDVITMDPKDNCSKDANDTLLLQL TNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS(SEQIDNO:174) ExemplaryheterobivalentCloneB/CloneAanti-PSMAcaTCR#1 Chain1: QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAG VETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSEVKTDSTDHVKPKETENTKQPSKSCHK PKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFL(SEQIDNO:175) Chain2: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSSGGGGSEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQ GQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCPIKTDVI TMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS(SEQIDNO:176) ExemplaryheterobivalentCloneA/CloneBanti-PSMAcaTCR#2 Chain1: EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYL QWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTLVTVSSGGGGSGGGGSEVQLVQSGAEMKKPGESLKISCKGSGYNFAS YWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTL VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL GTQTYICNVNHKPSNTKVDKRVEPKSCEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKT VAVNFLLTAKLFFL(SEQIDNO:177) Chain2: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGGGGGSGGGGSQAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQL PGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKANPTVTL FPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHE GSTVEKTVAPTECSPIKTDVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS (SEQIDNO:178) ExemplaryheterobivalentCloneB/CloneAanti-PSMAcaTCR#2 Chain1: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGGGGGSGGGGSQAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQL PGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKANPTVTL FPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHE GSTVEKTVAPTECSEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFF L(SEQIDNO:179) Chain2: EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYL QWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTLVTVSSGGGGSGGGGSEVQLVQSGAEMKKPGESLKISCKGSGYNFAS YWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTL VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL GTQTYICNVNHKPSNTKVDKRVEPKSCPIKTDVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCL LRRTAFCCNGEKS(SEQIDNO:180)
(206) In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 960%, 970, 980%, or 990%) sequence identity to SEQ ID NO: 173 and a Chain 2 that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 174. In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that has at least about 85% (e.g., at least about any one of 850%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 175 and a Chain 2 that has at least about 850% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 176. In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 177 and a Chain 2 that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 940, 950%, 960%, 970, 980%, or 990%) sequence identity to SEQ ID NO: 178. In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that has at least about 850% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 179 and a Chain 2 that has at least about 850% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 180.
(207) In some embodiments, a nucleic acid encoding exemplary heterobivalent Clone A/Clone B anti-PSMA caTCR #1 expresses a polypeptide comprising SEQ ID NO: 91.
(208) TABLE-US-00024 (SEQIDNO:91) METDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNI GAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAIT GLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGG GSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGK GLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTA MYYCARSMGSSLYASSDVWGQGTLVTVSSGGGGSEVQLVQSGAEMKKPG ESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAF QGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLV TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKV DKRVEPKSCEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMM SLTVLGLRMLFAKTVAVNFLLTAKLFFLRAKRSGSGAPVKQTLNFDLLK LAGDVESNPGPMETDTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRV TISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSK SGTSASLAISGLQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKAN PTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVET TKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE CSPIKTDVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYF AIITCCLLRRTAFCCNGEKS
(209) In some embodiments, a nucleic acid encoding exemplary heterobivalent Clone B/Clone A anti-PSMA caTCR #1 expresses a polypeptide comprising SEQ ID NO: 181.
(210) TABLE-US-00025 (SEQIDNO:181) METDTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCSGSSSNI GSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISG LQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKANPTVTLFPPSSE ELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKY AASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIKTDVITM DPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRT AFCCNGEKSRAKRSGSGAPVKQTLNFDLLKLAGDVESNPGPMETDTLLL WVLLLWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHW YQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEA DYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEV QLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGII YPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSM GSSLYASSDVWGQGTLVTVSSGGGGSEVQLVQSGAEMKKPGESLKISCK GSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISA DKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSASTK GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS CEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLR MLFAKTVAVNFLLTAKLFFL
(211) In some embodiments, a nucleic acid encoding exemplary heterobivalent Clone A/Clone B anti-PSMA caTCR #2 expresses a polypeptide comprising the amino acid sequence SEQ ID NO: 92.
(212) TABLE-US-00026 (SEDIDNO:92) METDTLLLWVLLLWVPGSTGEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSIST AYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTLVTVSSGGGGSG GGGSEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGKGL EWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMY YCARDSYYGIDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALG CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS LGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTDSTDHVKPKETENTKQP SKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFLRA KRSGSGAPVKQTLNFDLLKLAGDVESNPGPMETDTLLLWVLLLWVPGST GQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKL LIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSL SGYVFGTGTKVTVLGGGGGSGGGGSQAVLTQPPSASGTPGQRVTISCSG SSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSAS LAISGLQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKANPTVTLF PPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQ SNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIKT DVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCC LLRRTAFCCNGEKS
(213) In some embodiments, a nucleic acid encoding exemplary heterobivalent Clone B/Clone A anti-PSMA caTCR #2 expresses a polypeptide comprising the amino acid sequence SEQ ID NO: 182.
(214) TABLE-US-00027 (SEDIDNO:182) METDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNI GAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAIT GLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGGGGGSGGGGSQAVLT QPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQ RPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGYVFGT GTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAW KADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTH EGSTVEKTVAPTECSPIKTDVITMDPKDNCSKDANDTLLLQLTNTSAYY MYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKSRAKRSGSGAPVKQTLN FDLLKLAGDVESNPGPMETDTLLLWVLLLWVPGSTGEVQLVQSGAEVKK PGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSP SFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVW GQGTLVTVSSGGGGSGGGGSEVQLVQSGAEMKKPGESLKISCKGSGYNF ASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSIST AYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSASTKGPSVFP LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTD STDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKT VAVNFLLTAKLFFL
(215) Although SEQ ID NOs: 91-92 and 181-182 comprise specific peptide linkers, any linker (see, e.g., Table 6A) may be used.
(216) In some embodiments, the nucleic acid encoding a heterobivalent anti-PSMA caTCR expresses a polypeptide that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity any one of SEQ ID NOs: 91-92 and 181-182.
(217) While the exemplary caTCRs discussed above that comprise a CH1 sequence comprise the CH1 sequence set forth in ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC NVNHKPSNTKVDKRVEPKSC (SEQ ID NO: 122), alternative CH1 sequences may be used. For example, ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYELVSVVTVPSSSLGTQTYIC NVNHKPSNTKVDKRVEPKSC (SEQ ID NO 123), which comprises S64E and S66V mutations (EU numbering) may be used. While the exemplary caTCRs discussed above that comprise a CL sequence comprise the CL sequence set forth in GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHR SYSCQVTHEGSTVEKTVAPTECS (SEQ ID NO: 124), i.e., the constant region of a ? light chain, alternative CL sequences may be used. For example, TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV YACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 125), i.e., the constant region of the ? light chain, or TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLLSSLTLSKADYEKHKV YACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 126), the constant region of the ? light chain that comprises S69L and T71S mutations (EU numbering) may be used.
(218) Anti-PSMA Chimeric Co-Stimulatory Receptor Constructs (CSRs)
(219) Also provided herein are PSMA-specific chimeric co-stimulatory receptor constructs, which are alternatively referred to herein as chimeric signaling receptor constructs (i.e., anti-PSMA CSRs). Exemplary CSRs are discussed in PCT/US2018/029218 (now published as WO 2018/200583), the contents of which are incorporated herein by reference in their entirety. In some embodiments, the anti-PSMA CSR is expressed on the surface of an immune cell (such as a T cell). The anti-PSMA CSR binds to PSMA expressed on or associated with the surface of a cell (such as a cancer cell) and, upon binding to PSMA, is capable of stimulating the immune cell on which the anti-PSMA CSR is expressed. An anti-PSMA CSR comprises a PSMA-binding module (e.g. that comprises an anti-PSMA antibody moiety described herein), a transmembrane (TM) module, and a co-stimulatory immune cell signaling module that allows for stimulating the immune cell in or on which the anti-PSMA CSR is expressed. In some embodiments, the anti-PSMA CSR lacks a functional primary immune cell signaling sequence. In some embodiments, the anti-PSMA CSR lacks a primary immune cell signaling sequence. In some embodiments, the anti-PSMA CSR comprises a single polypeptide chain comprising the PSMA-binding module (e.g. that comprises an anti-PSMA antibody moiety described herein), transmembrane module, and co-stimulatory signaling module. In some embodiments, the anti-PSMA CSR comprises a first polypeptide chain and a second polypeptide chain, wherein the first and second polypeptide chains together form the PSMA-binding module (e.g. that comprises an anti-PSMA antibody moiety described herein), the transmembrane module, and the co-stimulatory signaling module. In some embodiments, the first and second polypeptide chains are separate polypeptide chains, and the anti-PSMA CSR is a multimer, such as a dimer. In some embodiments, the first and second polypeptide chains are covalently linked, such as by a peptide linkage, or by another chemical linkage, such as a disulfide linkage. In some embodiments, the first polypeptide chain and the second polypeptide chain are linked by at least one disulfide bond.
(220) Also provided are effector cells (such as T cells) expressing an anti-PSMA CSR of the present disclosure. Such effector cells (such as T cells) are produced by introducing (e.g., transducing or transfecting) a nucleic acid encoding an anti-PSMA CSR described herein (or a vector comprising such a nucleic acid) into the effector cell (e.g., T cell).
(221) Examples of co-stimulatory immune cell signaling domains for use in an anti-PSMA CSR include, but are not limited to, the cytoplasmic sequences of co-receptors of the T cell receptor (TCR), which can act in concert with a caTCR to initiate signal transduction following caTCR engagement, as well as any derivative or variant of these sequences and any synthetic sequence that has the same functional capability. Thus, in some embodiments provided is an effector cell (such as a T cell) that expresses a caTCR and an anti-PSMA CSR. Effector cells (such as T cells) expressing a caTCR and an anti-PSMA CSR (i.e., caTCR plus anti-PSMA CSR effector cells) are described in further detail below.
(222) It is known that signals generated through the TCR alone are insufficient for full activation of the T cell and that a secondary or co-stimulatory signal is also required. Thus, T cell activation can be said to be mediated by two distinct classes of intracellular (IC) signaling sequence: those that initiate antigen-dependent primary activation through the TCR (referred to herein as primary T cell signaling sequences) and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal (referred to herein as co-stimulatory T cell signaling sequences).
(223) Primary immune cell signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs. Examples of ITAM-containing primary immune cell signaling sequences include those derived from CD3?, TCR?, FcR?, FcR?, CD3?, CD3?, CD3?, CD5, CD22, CD79a, CD79b, and CD66d. A functional primary immune cell signaling sequence is a sequence that is capable of transducing an immune cell activation signal when operably coupled to an appropriate receptor. Non-functional primary immune cell signaling sequences, which may comprise fragments or variants of primary immune cell signaling sequences, are unable to transduce an immune cell activation signal. Thus, in some embodiments, an anti-PSMA CSRs described herein lacks a functional primary immune cell signaling sequence, such as a functional signaling sequence comprising an ITAM. In some embodiments, the anti-PSMA CSR described herein lack any primary immune cell signaling sequence.
(224) In some embodiments, the anti-PSMA CSR comprises a co-stimulatory signaling module that comprises (such as consists of or consists essentially of) all or a portion of the intracellular (IC) domain of an immune cell co-stimulatory molecule including, for example, CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and the like. In some embodiments, the CSR comprises a fragment of an immune cell co-stimulatory molecule (fCSM), wherein the fCSM comprises the CSR transmembrane (TM) domain and CSR intracellular (IC) co-stimulatory signaling domain. Exemplary IC co-stimulatory immune cell signaling module sequences are provided below:
(225) TABLE-US-00028 4-1BBICsignalingsequence: (SEQIDNO:100) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL CD27ICsignalingsequence: (SEQIDNO:101) QRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP CD28ICsignalingsequence: (SEQIDNO:102) RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS CD30ICsignalingsequence: (SEQIDNO:183) HRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASP AGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCS DVMLSVEEEGKEDPLPTAASGK OX40ICsignalingsequence: (SEQIDNO:103) ALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI myctag+truncatedCD28sequence: (SEQIDNO:104) EQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKR SRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS truncatedCD28sequence: (SEQIDNO:105) IEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFTIFWVRSKRSRLLHSDYMNMTP RRPGPTRKHYQPYAPPRDFAAYRS myctag+truncated4-1BBsequence: (SEQIDNO:106) EQKLISEEDLAAATGPADLSPGASSVTPPAPAREPGHSPQIISFFLALTSTALLFLLFFLTLRFSVVKRGRKKLLYIFKQPFM RPVQTTQEEDGCSCRFPEEEEGGCEL truncated4-1BBsequence: (SEQIDNO:107) AAATGPADLSPGASSVTPPAPAREPGHSPQIISFFLALTSTALLFLLFFLTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEED GCSCRFPEEEEGGCEL myctag+truncatedCD27sequence: (SEQIDNO:108) EQKLISEEDLAAATGPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMFLVFTLAGAL FLHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP truncatedCD27sequence: (SEQIDNO:109) AAATGPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMFLVFTLAGALFLHQRRKYRS NKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP myctag+truncatedCD30sequence: (SEQIDNO:110) EQKLISEEDLAAATGAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVIL VLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVG AAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPH YPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK truncatedCD30sequence: (SEQIDNO:111) AAATGAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSA FLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQ DASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPL GSCSDVMLSVEEEGKEDPLPTAASGK myctag+truncatedOX40sequence: (SEQIDNO:112) EQKLISEEDLAAATGDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILL ALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI truncatedOX40sequence: (SEQIDNO:113) AAATGDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILLALYLLRRDQR LPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI myctag+CD8TMsequenceandCD27ICsignalingsequence: (SEQIDNO:114) EQKLISEEDLAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLY CQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP CD8TMsequenceandCD27ICsignalingsequence: (SEQIDNO:115) AAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCQRRKYRSNK GESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP myctag+CD8TMsequenceandCD30ICsignalingsequence: (SEQIDNO:116) EQKLISEEDLAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLY CHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDAS PAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSC SDVMLSVEEEGKEDPLPTAASGK CD8TMsequenceandCD30ICsignalingsequence: (SEQIDNO:117) AAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCHRRACRKRI RQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRD LPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEE GKEDPLPTAASGK myctag+CD8TMsequenceandOX40ICsignalingsequence: (SEQIDNO:118) EQKLISEEDLAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLY CALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI CD8TMsequenceandOX40ICsignalingsequence: (SEQIDNO:119) AAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCALYLLRRDQ RLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI myctag+CD8TMsequenceand4-1BBICsignalingsequence: (SEQIDNO:120) EQKLISEEDLAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLY CKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL CD8TMsequenceand4-1BBICsignalingsequence: (SEQIDNO:121) AAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLY IFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
(226) In some embodiments, the PSMA-binding module of an anti-PSMA CSR of the present disclosure is an anti-PSMA antibody moiety. In some embodiments, the anti-PSMA antibody moiety is a Fab, a Fab, a (Fab)2, an Fv, or a single chain Fv (scFv). In some embodiments, the anti-PSMA antibody moiety comprises the CDRs or variables domains (V.sub.H and/or V.sub.L domains) of an antibody moiety specific for PSMA (e.g., PSMA expressed on or associated with the surface of a cell, e.g., a cancer cell), such as any of anti-PSMA antibody moieties described elsewhere herein.
(227) In some embodiments, the transmembrane module of an anti-PSMA CSR of the present disclosure comprises one or more transmembrane domains derived from, for example, CD28, CD3?, CD3?, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, or CD154. In some embodiments, the CSR comprises a fragment of a transmembrane protein (fTMP), wherein the fTMP comprises the CSR transmembrane domain. Exemplary transmembrane domain (TM) sequences are provided below:
(228) TABLE-US-00029 CD8TMsequence: (SEQIDNO:94) IYIWAPLAGTCGVLLLSLVIT 4-1BBTMsequence: (SEQIDNO:95) IISFFLALTSTALLFLLFFLTLRFSVV CD27TMsequence: (SEQIDNO:96) ILVIFSGMFLVFTLAGALFLH CD28TMsequence: (SEQIDNO:97) FWVLVVVGGVLACYSLLVTVAFIIFWV CD30TMsequence: (SEQIDNO:98) PVLDAGPVLFWVILVLVVVVGSSAFLLC OX40TMsequence: (SEQIDNO:99) VAAILGLGLVLGLLGPLAILL
(229) In some embodiments, the anti-PSMA CSR further comprises a spacer module between any of the ligand-binding module, the transmembrane module, and the co-stimulatory signaling module. In some embodiments, the spacer module comprises one or more peptide linkers connecting two CSR modules. In some embodiments, the spacer module comprises one or more peptide linkers between about 5 to about 70 (such as about any of 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, or 70, including any ranges between these values) amino acids in length.
(230) The amino acid sequences of exemplary anti-PSMA CSRs are provided in Table 11 below. The anti-PSMA sequences are in plain text (i.e., no underline), and sequences derived from CD28 (see SEQ ID NOs: 37-38, 51-55, and 70), 4-1BB (see SEQ ID NOs: 56, 57, 71, and 72), CD27 (see SEQ ID NOs: 58, 59, 73, and 74), CD30 (see SEQ ID NOs: 60, 61, 75, and 76), OX40 (see SEQ ID NOs: 62, 63, 77, and 78), CD8 and CD27 (see SEQ ID NO: 64, 65, 79, and 80), CD8 and CD30 (see SEQ ID NOs: 66, 67, 81, and 82), CD8 and OX40 (see SEQ ID NOs: 68, 69, 83, and 84), are underlined.
(231) TABLE-US-00030 TABLE11 QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSSAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFTIFWVR SKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS(SEQIDNO:37) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFA SYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGT LVTVSSAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFTIFWVRSKRSR LLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS(SEQIDNO:38)
QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVP DRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGA EVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASD TAMYYCARSMGSSLYASSDVWGQGTLVTVSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPS KPFWVLVVVGGVLACYSLLVTVAFTIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS(SEQID NO:51)
QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVP DRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGA EVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASD TAMYYCARSMGSSLYASSDVWGQGTLVTVSSAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVG GVLACYSLLVTVAFTIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS(SEQIDNO:52)
QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPD RFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAE MKKPGESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDT AMYYCARDSYYGIDVWGQGTLVTVSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWV LVVVGGVLACYSLLVTVAFTIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS(SEQIDNO: 53)
QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPD RFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAE MKKPGESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDT AMYYCARDSYYGIDVWGQGTLVTVSSAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLAC YSLLVTVAFTIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS(SEQIDNO:54) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLV TVAFTIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS(SEQIDNO:55) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSSEQKLISEEDLAAATGPADLSPGASSVTPPAPAREPGHSPQIISFFLALTSTALLFLLFFLTLRFSVVKRG RKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL(SEQIDNO:56) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSSAAATGPADLSPGASSVTPPAPAREPGHSPQIISFFLALTSTALLFLLFFLTLRFSVVKRGRKKLLYIFKQ PFMRPVQTTQEEDGCSCRFPEEEEGGCEL(SEQIDNO:57) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSSEQKLISEEDLAAATGPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIF SGMFLVFTLAGALFLHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP(SEQIDNO:58) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSSAAATGPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMFLVFTLA GALFLHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP(SEQIDNO:59) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSSEQKLISEEDLAAATGAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKP VLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEER GLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAG PAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK(SEQIDNO:60) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSSAAATGAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFW VILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMET CHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEEL EADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK(SEQIDNO:61) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSSEQKLISEEDLAAATGDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLG LVLGLLGPLAILLALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI(SEQIDNO:62) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSSAAATGDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLA ILLALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI(SEQIDNO:63) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSSEQKLISEEDLAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGT CGVLLLSLVITLYCQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP(SEQIDNO:64) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSSAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVI TLYCQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP(SEQIDNO:65) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSSEQKLISEEDLAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGT CGVLLLSLVITLYCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHS VGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEAD HTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK(SEQIDNO:66) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSSAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVI TLYCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLP LQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQET EPPLGSCSDVMLSVEEEGKEDPLPTAASGK(SEQIDNO:67) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSSEQKLISEEDLAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGT CGVLLLSLVITLYCALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI(SEQIDNO:68) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSSAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVI TLYCALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI(SEQIDNO:69) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFA SYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGT LVTVSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFI IFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS(SEQIDNO:70) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFA SYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGT LVTVSSEQKLISEEDLAAATGPADLSPGASSVTPPAPAREPGHSPQIISFFLALTSTALLFLLFFLTLRFSVVKRGRKKLL YIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL(SEQIDNO:71) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFA SYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGT LVTVSSAAATGPADLSPGASSVTPPAPAREPGHSPQIISFFLALTSTALLFLLFFLTLRFSVVKRGRKKLLYIFKQPFMRP VQTTQEEDGCSCRFPEEEEGGCEL(SEQIDNO:72) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFA SYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGT LVTVSSEQKLISEEDLAAATGPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMFL VFTLAGALFLHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP(SEQIDNO:73) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFA SYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGT LVTVSSAAATGPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMFLVFTLAGALFL HQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP(SEQIDNO:74) YYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVG WVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVS SEQKLISEEDLAAATGAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFW VILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMET CHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEEL EADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK(SEQIDNO:75) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFA SYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGT LVTVSSAAATGAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVL VVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVG AAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHT PHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK(SEQIDNO:76) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFA SYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGT LVTVSSEQKLISEEDLAAATGDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGL LGPLAILLALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI(SEQIDNO:77) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFA SYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGT LVTVSSAAATGDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILLAL YLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI(SEQIDNO:78) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFA SYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGT LVTVSSEQKLISEEDLAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLL LSLVITLYCQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP(SEQIDNO:79) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFA SYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGT LVTVSSAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCQ RRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP(SEQIDNO:80) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFA SYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGT LVTVSSEQKLISEEDLAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLL LSLVITLYCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAY LESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHY PEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK(SEQIDNO:81) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFA SYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGT LVTVSSAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCH RRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDAS PAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLG SCSDVMLSVEEEGKEDPLPTAASGK(SEQIDNO:82) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFA SYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGT LVTVSSEQKLISEEDLAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLL LSLVITLYCALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI(SEQIDNO:83) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFA SYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGT LVTVSSAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCA LYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI(SEQIDNO:84)
(232) The sequences in bold type in Table 11 correspond to the myc tag EQKLISEEDL (SEQ ID NO: 136). The sequences in bold italic type in Table 11 correspond to the signal peptide METDTLLLWVLLLWVPGSTG (SEQ ID NO: 128).
(233) In some embodiments, the CSR is a bivalent anti-PSMA CSR that comprises two anti-PSMA antibody moieties. In some embodiments, the bivalent anti-PSMA CSR is homobivalent, e.g., comprising two anti-PSMA antibody moieties that comprise identical V.sub.H sequences and identical V.sub.L sequences. In some embodiments, the bivalent anti-PSMA CSR is heterobivalent, e.g., comprising two different anti-PSMA antibody moieties, where each anti-PSMA antibody moiety comprises a different VH sequence and/or different VL sequence. The amino acid sequences of four exemplary heterobivalent anti-PSMA CSRs are shown below (i.e., SEQ ID NO: 93 and SEQ ID NOs: 183-185). The Clone A anti-PSMA scFv sequence is in plain text (i.e., no underlining), the Clone B anti-PSMA scFv is underlined, a linker sequence is in bold text, a myc tag sequence (when present) is in bold text and underlined, and sequences derived from CD28 are italicized.
(234) TABLE-US-00031 (SEQIDNO:93) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAE DEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYW IGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTL VTVSSGGGGSGGGGSQAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKS GTSASLAISGLQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLK ISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYY GIDVWGQGTLVTVSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSL LVTVAFIIFWVRSERSRLLHSDYMNMTPRRPGPTREHYQPYAPPRDFAAYRS (SEQIDNO:185) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAE DEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYW IGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTL VTVSSGGGGSGGGGSQAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKS GTSASLAISGLQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLK ISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYY GIDVWGQGTLVTVSSAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFW VRSERSRLLHSDYMNMTPRRPGPTREHYQPYAPPRDFAAYRS (SEQIDNO:184) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSED EADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWV GWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSS GGGGSGGGGSQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSA SLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCK GSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYA SSDVWGQGTLVTVSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSL LVITAFIIFWVRSERSRLLHSDYMNMTPRRPGPTREHYQPYAPPRDFAAYRS (SEQIDNO:186) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSED EADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWV GWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSS GGGGSGGGGSQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSA SLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCK GSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYA SSDVWGQGTLVTVSSAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFW VRSERSRLLHSDYMNMTPRRPGPTREHYQPYAPPRDFAAYRS
(235) In some embodiments, any one of SEQ ID NOs: 37-38, 55-84 and 93 further comprises an N-terminal signal peptide, e.g., the signal peptide of SEQ ID NO: 128. In some embodiments, any one of SEQ ID NOs: 37-38, 51-84, and 93 further comprises a peptide linker and/or peptide tag (see, e.g. Tables 6A and 6B). In some embodiments, the anti-PSMA CSR comprises an amino acid sequence that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to any one of SEQ ID NOs: 37-38, 51-84, and 93.
(236) The present disclosure also provides effector cells (such as T cells) that express a caTCR or a CAR and an anti-PSMA CSR (such as an anti-PSMA CSR described herein). Such effector cells are also referred to herein as caTCR plus anti-PSMA CSR effector cells. In some embodiments, the caTCR plus anti-PSMA CSR effector cell (such as a T cell) comprises a nucleic acid sequence encoding the anti-PSMA CSR operably linked to an inducible promoter, including any of the inducible promoters described herein. In some embodiments, the expression of the anti-PSMA CSR in the caTCR plus anti-PSMA CSR effector cell (such as a T cell) is inducible upon signaling through the caTCR. In some such embodiments, the caTCR plus anti-PSMA CSR effector cell (such as a T cell) comprises a nucleic acid sequence encoding the anti-PSMA CSR operably linked to a promoter or regulatory element that is responsive to signaling through the caTCR. In some embodiments, the nucleic acid sequence encoding the anti-PSMA CSR is operably linked to a nuclear-factor of the activated T-cell (NFAT)-derived promoter. In some embodiments, the NFAT-derived promoter is an NFAT-derived minimal promoter (see for example Durand, D. et. al., Molec. Cell. Biol. 8, 1715-1724 (1988); Clipstone, N A, Crabtree, G R. Nature. 1992 357(6380): 695-7; Chmielewski, M., et al. Cancer research 71.17 (2011): 5697-5706; and Zhang, L., et al. Molecular therapy 19.4 (2011): 751-759). In some embodiments, the caTCR expressed by the caTCR plus anti-PSMA CSR effector cell (such as a T cell) is an anti-PSMA caTCR. In some embodiments the caTCR expressed by the caTCR plus anti-PSMA CSR effector cell (such as a T cell) is not an anti-PSMA caTCR and targets a different antigen. Further description of CSRs may be found in U.S. Application No. 62/490,578, filed Apr. 26, 2017, which is incorporated by reference herein in its entirety.
(237) Construct Combinations
(238) Also provided are construct combinations that comprise at least two different anti-PSMA constructs described herein. In some embodiments, the at least two different anti-PSMA constructs are the same format, e.g., at least two different antibodies (e.g., two different full-length IgG antibodies or two different bispecific antibodies), at least two different CARs, at least two different caTCRs, or at least two different CSRs. In some embodiments, the at least two different anti-PSMA constructs are different formats, e.g., an antibody and a CAR; an antibody and a caTCR; a CAR and a CSR; a caTCR and a CSR, etc.
(239) In some embodiments, the construct combination comprises an anti-PSMA caTCR and an anti-PSMA CSR (i.e., an anti-PSMA caTCR+anti-PSMA CSR construct combination), wherein the anti-PSMA caTCR comprises a Chain 1 that comprises:
(240) an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 31 and a Chain 2 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 32;
(241) an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 34 and a Chain 2 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 35;
(242) an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 165 and a Chain 2 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 166;
(243) an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 167 and a Chain 2 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 168;
(244) an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 169 and a Chain 2 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 170;
(245) an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 171 and a Chain 2 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 172;
(246) an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 173 and a Chain 2 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 174;
(247) an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 175 and a Chain 2 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 176;
(248) an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 177 and a Chain 2 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 178;
(249) an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 179 and a Chain 2 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 180;
(250) and wherein the anti-PSMA CSR comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%) sequence identity to any one of SEQ ID NOs: 37-38, 55-84, and 93.
(251) In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 31 and a Chain 2 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 32, and the anti-PSMA CSR comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 55. In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that comprises SEQ ID NO: 31 and a Chain 2 that comprises SEQ ID NO: 32, and the anti-PSMA CSR comprises the amino acid sequence of SEQ ID NO: 55.
(252) In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 31 and a Chain 2 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 32, and the anti-PSMA CSR comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 70. In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that comprises SEQ ID NO: 31 and a Chain 2 that comprises SEQ ID NO: 32, and the anti-PSMA CSR comprises the amino acid sequence of SEQ ID NO: 70.
(253) In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 34 and a Chain 2 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 35, and the anti-PSMA CSR comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 55. In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that comprises SEQ ID NO: 34 and a Chain 2 that comprises SEQ ID NO: 35, and the anti-PSMA CSR comprises the amino acid sequence of SEQ ID NO: 55.
(254) In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 34 and a Chain 2 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 35, and the anti-PSMA CSR comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 70. In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that comprises SEQ ID NO: 34 and a Chain 2 that comprises SEQ ID NO: 35, and the anti-PSMA CSR comprises the amino acid sequence of SEQ ID NO: 70.
(255) In some embodiments, the anti-PSMA caTCR is a homobivalent anti-PSMA caTCR that comprises a Chain 1 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 165 and a Chain 2 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 166, and the anti-PSMA CSR comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 70. In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that comprises SEQ ID NO: 165 and a Chain 2 that comprises SEQ ID NO: 166, and the anti-PSMA CSR comprises the amino acid sequence of SEQ ID NO: 70.
(256) In some embodiments, the anti-PSMA caTCR is a homobivalent anti-PSMA caTCR that comprises a Chain 1 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 165 and a Chain 2 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 166, and the anti-PSMA CSR that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to any one of SEQ ID NOs: 38 and 70-84. In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that comprises SEQ ID NO: 165 and a Chain 2 that comprises SEQ ID NO: 166, and the anti-PSMA CSR comprises the amino acid sequence of any one of SEQ ID NOs: 38 and 70-84.
(257) In some embodiments, the anti-PSMA caTCR is a homobivalent anti-PSMA caTCR that comprises a Chain 1 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 169 and a Chain 2 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 170, and the anti-PSMA CSR comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 55. In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that comprises SEQ ID NO: 169 and a Chain 2 that comprises SEQ ID NO: 170, and the anti-PSMA CSR comprises the amino acid sequence of SEQ ID NO: 55.
(258) In some embodiments, the anti-PSMA caTCR is a homobivalent anti-PSMA caTCR that comprises a Chain 1 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 169 and a Chain 2 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 170, and the anti-PSMA CSR that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to any one of SEQ ID NOs: 37 and 55-69. In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that comprises SEQ ID NO: 169 and a Chain 2 that comprises SEQ ID NO: 170, and the anti-PSMA CSR comprises the amino acid sequence of any one of SEQ ID NOs: 37 and 55-69.
(259) In some embodiments, the anti-PSMA caTCR is a homobivalent anti-PSMA caTCR that comprises a Chain 1 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 167 and a Chain 2 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 168, and the anti-PSMA CSR that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to any one of SEQ ID NOs: 38 and 70-84. In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that comprises SEQ ID NO: 167 and a Chain 2 that comprises SEQ ID NO: 168, and the anti-PSMA CSR comprises the amino acid sequence of any one of SEQ ID NOs: 38 and 70-84.
(260) In some embodiments, the anti-PSMA caTCR is a homobivalent anti-PSMA caTCR that comprises a Chain 1 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 171 and a Chain 2 that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 172, and the anti-PSMA CSR that comprises an amino acid sequence that has at least 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to any one of SEQ ID NOs: 37 and 55-69. In some embodiments, the anti-PSMA caTCR comprises a Chain 1 that comprises SEQ ID NO: 171 and a Chain 2 that comprises SEQ ID NO: 172, and the anti-PSMA CSR comprises the amino acid sequence of any one of SEQ ID NOs: 37 and 55-69.
(261) In some embodiments, the anti-PSMA caTCR and the anti-PSMA CSR of a construct combination provided herein are encoded on separate nucleic acids. In some embodiments, the separate nucleic acids are each expressed (e.g., separately) and translated (e.g., separately) in a cell (such as an anti-PSMA effector cell, which is described in further detail elsewhere herein). In some embodiments, the anti-PSMA caTCR and the anti-PSMA CSR of a construct combination provided herein are encoded on the same nucleic acid (e.g., a single nucleic acid). In some embodiments, the single nucleic acid encoding the anti-PSMA caTCR and anti-PSMA CSR construct combination is expressed and translated to generate a single polypeptide which is subsequently processed (e.g., such as cleaved during or following translation) into separate polypeptides, e.g., the anti-PSMA caTCR polypeptide(s) and anti-PSMA CSR polypeptide.
(262) In some embodiments, a single nucleic acid encoding an anti-PSMA caTCR+anti-PSMA CSR construct combination expresses a polypeptide comprising any one of SEQ ID NOs: 85-90, the amino acid sequences of which are provided below:
(263) TABLE-US-00032 (SEQIDNO:85) METDTLLLWVLLLWVPGSTGEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSIST AYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTLVTVSSASTKGP SVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCE VKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRML FAKTVAVNFLLTAKLFFLRAKRSGSGAPVKQTLNFDLLKLAGDVESNPG PMETDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSN IGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAI TGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGQPKANPTVTLFPPS SEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNN KYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIKTDVI TMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLR RTAFCCNGEKSGSGATNFSLLKQAGDVEENPGPMETDTLLLWVLLLWVP GSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTA PKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYD SSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAE VKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTR YSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASS DVWGQGTLVTVSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVK GKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFTIFWVRSKRSR LLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQIDNO:86) METDTLLLWVLLLWVPGSTGEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSIST AYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTLVTVSSASTKGP SVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCE VKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRML FAKTVAVNFLLTAKLFFLRAKRSGSGAPVKQTLNFDLLKLAGDVESNPG PMETDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSN IGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAI TGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGQPKANPTVTLFPPS SEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNN KYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIKTDVI TMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLR RTAFCCNGEKSGSGATNFSLLKQAGDVEENPGPMETDTLLLWVLLLWVP GSTGQAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAP KLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDD SLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEM KKPGESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRY GPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQ GTLVTVSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLC PSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFTIFWVRSKRSRLLHSD YMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQIDNO:87) METDTLLLWVLLLWVPGSTGEVQLVQSGAEMKKPGESLKISCKGSGYNF ASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSIST AYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSASTKGPSVFP LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTD STDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKT VAVNFLLTAKLFFLRAKRSGSGAPVKQTLNFDLLKLAGDVESNPGPMET DTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCSGSSSNIGSN TVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQ ANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAAS SYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIKTDVITMDPE DNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFC CNGEKSGSGATNFSLLKQAGDVEENPGPMETDTLLLWVLLLWVPGSTGQ SVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLI YGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSG YVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPG ESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSF QGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQ GTLVTVSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLC PSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFTIFWVRSKRSRLLHSD YMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQIDNO:88) METDTLLLWVLLLWVPGSTGEVQLVQSGAEMKKPGESLKISCKGSGYNF ASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSIST AYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSASTKGPSVFP LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTD STDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKT VAVNFLLTAKLFFLRAKRSGSGAPVKQTLNFDLLKLAGDVESNPGPMET DTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCSGSSSNIGSN TVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQ ANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAAS SYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIKTDVITMDPK DNCSRDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFC CNGEKSGSGATNFSLLKQAGDVEENPGPMETDTLLLWVLLLWVPGSTGQ AVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMY SNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGY VFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGE SLKISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQ GQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVT VSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLF PGPSKPFWVLVVVGGVLACYSLLVTVAFTIFWVRSKRSRLLHSDYMNMT PRRPGPTRKHYQPYAPPRDFAAYRS (SEQIDNO:89) METDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNI GAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAIT GLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGG GSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGK GLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTA MYYCARSMGSSLYASSDVWGQGTLVTVSSGGGGSEVQLVQSGAEVKKPG ESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSF QGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQ GTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPS NTKVDKRVEPKSCEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEK VNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFLRAKRSGSGAPVKQTLNF DLLKLAGDVESNPGPMETDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAP GQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDR FSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLG QPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVK AGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKT VAPTECSPIKTDVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLK SVVYFAIITCCLLRRTAFCCNGEKSGSGATNFSLLKQAGDVEENPGPME TDTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCSGSSSNIGS NTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQ SEDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSL EMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGKGLE WMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYY CARDSYYGIDVWGQGTLVTVSSEQKLISEEDLAAAIEVMYPPPYLDNEK SNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFTI FWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQIDNO:90) METDTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCSGSSSNI GSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISG LQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGG SLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGKG LEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAM YYCARDSYYGIDVWGQGTLVTVSSGGGGSEVQLVQSGAEMKKPGESLKI SCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVT ISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVE PKSCEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVL GLRMLFAKTVAVNFLLTAKLFFLRAKRSGSGAPVKQTLNFDLLKLAGDV ESNPGPMETDTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCS GSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSA SLAISGLQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKANPTVTL FPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSK QSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIK TDVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITC CLLRRTAFCCNGEKSGSGATNFSLLKQAGDVEENPGPMETDTLLLWVLL LWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQL PGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYC QSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQ SGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYPGD SDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSL YASSDVWGQGTLVTVSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTI IHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFTIFWVRS KRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
(264) In some embodiments, the single nucleic acid encoding an anti-PSMA caTCR+anti-PSMA CSR construct combination expresses a polypeptide that has at least about 85% (e.g., at least about any one of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to any one of SEQ ID NOs: 91-92 and 181-182.
(265) In some embodiments, a single nucleic acid encoding an anti-PSMA caTCR+anti-PSMA CSR construct combination expresses a polypeptide comprising (from N-terminus to C-terminus) the amino acid sequence(s) of an anti-PSMA caTCR construct, a peptide linker, and the amino acid sequence of an anti-PSMA CSR construct. In some embodiments, a single nucleic acid encoding anti-PSMA caTCR+anti-PSMA CSR construct combination expresses a polypeptide comprising (from N-terminus to C-terminus) the amino acid sequence of an anti-PSMA CSR construct, a peptide linker, and the amino acid sequence(s) of an anti-PSMA caTCR construct. In some embodiments, the nucleic acid further encodes, e.g., one or more peptide linkers, peptide spacers, peptide tags, signal peptides and/or other amino acid sequences (see, e.g., Tables 6A and 6B for exemplary linker sequences and tag sequences).
(266) In some embodiments, the single nucleic acid encoding an anti-PSMA caTCR+anti-PSMA CSR construct combination expresses a polypeptide comprising the sequences listed in each of rows 1-128 in Table 12 below.
(267) TABLE-US-00033 TABLE 12 Order of Components (from N-Terminus caTCR + CSR to C-Terminus) Combination in Polypeptide Exemplary Exemplary Encoded by encoded by the anti-PSMA anti-PSMA Nucleic Acid Nucleic Acid caTCR CSR Exemplary Linker 1 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-1A P2A self-cleaving B-CSR-1A (see, e.g., (SEQ ID NO: 47) (SEQ ID NO: 70) peptide SEQ ID NO: 89) (SEQ ID NO: 132) 2 B-CSR-1A + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-1A furin cleavage Ax2-caTCR-1 (see, e.g., (SEQ ID NO: 47) (SEQ ID NO: 70) site + P2A self- paragraph [0441]) cleaving peptide (SEQ ID NO: 133) 3 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-1B P2A self-cleaving B-CSR-1B (see, e.g., (SEQ ID NO: 47) (SEQ ID NO: 38) peptide paragraph [0442]) (SEQ ID NO: 132) 4 B-CSR-1B + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-1B furin cleavage Ax2-caTCR-1 (see, e.g., (SEQ ID NO: 47) (SEQ ID NO: 38) site + P2A self- paragraph [0443]) cleaving peptide (SEQ ID NO: 133) 5 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-2A P2A self-cleaving B-CSR-2A (SEQ ID NO: 47) (SEQ ID NO: 71) peptide (SEQ ID NO: 132) 6 B-CSR-2A + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-2A furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 71) site + P2A self- cleaving peptide (SEQ ID NO: 133) 7 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-2B P2A self-cleaving B-CSR-2B (SEQ ID NO: 47) (SEQ ID NO: 72) peptide (SEQ ID NO: 132) 8 B-CSR-2B + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-2B furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 72) site + P2A self- cleaving peptide (SEQ ID NO: 133) 9 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-3A P2A self-cleaving B-CSR-3A (SEQ ID NO: 47) (SEQ ID NO: 73) peptide (SEQ ID NO: 132) 10 B-CSR-3A + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-3A furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 73) site + P2A self- cleaving peptide (SEQ ID NO: 133) 11 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-3B P2A self-cleaving B-CSR-3B (SEQ ID NO: 47) (SEQ ID NO: 74) peptide (SEQ ID NO: 132) 12 B-CSR-3B + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-3B furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 74) site + P2A self- cleaving peptide (SEQ ID NO: 133) 13 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-4A P2A self-cleaving B-CSR-4A (SEQ ID NO: 47) (SEQ ID NO: 75) peptide (SEQ ID NO: 132) 14 B-CSR-4A + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-4A furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 75) site + P2A self- cleaving peptide (SEQ ID NO: 133) 15 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-4B P2A self-cleaving B-CSR-4B (SEQ ID NO: 47) (SEQ ID NO: 76) peptide (SEQ ID NO: 132) 16 B-CSR-4B + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-4B furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 76) site + P2A self- cleaving peptide (SEQ ID NO: 133) 17 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-5A P2A self-cleaving B-CSR-5A (SEQ ID NO: 47) (SEQ ID NO: 77) peptide (SEQ ID NO: 132) 18 B-CSR-5A + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-5A furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 77) site + P2A self- cleaving peptide (SEQ ID NO: 133) 19 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-5B P2A self-cleaving B-CSR-5B (SEQ ID NO: 47) (SEQ ID NO: 78) peptide (SEQ ID NO: 132) 20 B-CSR-5B + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-5B furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 78) site + P2A self- cleaving peptide (SEQ ID NO: 133) 21 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-6A P2A self-cleaving B-CSR-6A (SEQ ID NO: 47) (SEQ ID NO: 79) peptide (SEQ ID NO: 132) 22 B-CSR-6A + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-6A furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 79) site + P2A self- cleaving peptide (SEQ ID NO: 133) 23 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-6B P2A self-cleaving B-CSR-6B (SEQ ID NO: 47) (SEQ ID NO: 80) peptide (SEQ ID NO: 132) 24 B-CSR-6B + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-6B furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 80) site + P2A self- cleaving peptide (SEQ ID NO: 133) 25 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-7A P2A self-cleaving B-CSR-7A (SEQ ID NO: 47) (SEQ ID NO: 81) peptide (SEQ ID NO: 132) 26 B-CSR-7A + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-7A furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 81) site + P2A self- cleaving peptide (SEQ ID NO: 133) 27 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-7B P2A self-cleaving B-CSR-7B (SEQ ID NO: 47) (SEQ ID NO: 82) peptide (SEQ ID NO: 132) 28 B-CSR-7B + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-7B furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 82) site + P2A self- cleaving peptide (SEQ ID NO: 133) 29 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-8A P2A self-cleaving B-CSR-8A (SEQ ID NO: 47) (SEQ ID NO: 83) peptide (SEQ ID NO: 132) 30 B-CSR-8A + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-8A furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 83) site + P2A self- cleaving peptide (SEQ ID NO: 133) 31 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-8B P2A self-cleaving B-CSR-8B (SEQ ID NO: 47) (SEQ ID NO: 84) peptide (SEQ ID NO: 132) 32 B-CSR-8B + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-8B furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 84) site + P2A self- cleaving peptide (SEQ ID NO: 133) 33 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-1A P2A self-cleaving A-CSR-1A (e.g., SEQ ID NO: 90) (SEQ ID NO: 49) (SEQ ID NO: 55) peptide (SEQ ID NO: 132) 34 A-CSR-1A + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-1A furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 55) site + P2A self- cleaving peptide (SEQ ID NO: 133) 35 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-1B P2A self-cleaving A-CSR-1B (SEQ ID NO: 49) (SEQ ID NO: 37) peptide (SEQ ID NO: 132) 36 A-CSR-1B + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-1B furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 37) site + P2A self- cleaving peptide (SEQ ID NO: 133) 37 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-2A P2A self-cleaving A-CSR-2A (SEQ ID NO: 49) (SEQ ID NO: 56) peptide (SEQ ID NO: 132) 38 A-CSR-2A + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-2A furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 56) site + P2A self- cleaving peptide (SEQ ID NO: 133) 39 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-2B P2A self-cleaving A-CSR-2B (SEQ ID NO: 49) (SEQ ID NO: 57) peptide (SEQ ID NO: 132) 40 A-CSR-2B + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-2B furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 57) site + P2A self- cleaving peptide (SEQ ID NO: 133) 41 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-3A P2A self-cleaving A-CSR-3A (SEQ ID NO: 49) (SEQ ID NO: 58) peptide (SEQ ID NO: 132) 42 A-CSR-3A + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-3A furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 58) site + P2A self- cleaving peptide (SEQ ID NO: 133) 43 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-3B P2A self-cleaving A-CSR-3B (SEQ ID NO: 49) (SEQ ID NO: 59) peptide (SEQ ID NO: 132) 44 A-CSR-3B + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-3B furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 59) site + P2A self- cleaving peptide (SEQ ID NO: 133) 45 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-4A P2A self-cleaving A-CSR-4A (SEQ ID NO: 49) (SEQ ID NO: 60) peptide (SEQ ID NO: 132) 46 A-CSR-4A + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-4A furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 60) site + P2A self- cleaving peptide (SEQ ID NO: 133) 47 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-4B P2A self-cleaving A-CSR-4B (SEQ ID NO: 49) (SEQ ID NO: 61) peptide (SEQ ID NO: 132) 48 A-CSR-4B + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-4B furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 61) site + P2A self- cleaving peptide (SEQ ID NO: 133) 49 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-5A P2A self-cleaving A-CSR-5A (SEQ ID NO: 49) (SEQ ID NO: 62) peptide (SEQ ID NO: 132) 50 A-CSR-5A + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-5A furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 62) site + P2A self- cleaving peptide (SEQ ID NO: 133) 51 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-5B P2A self-cleaving A-CSR-5B (SEQ ID NO: 49) (SEQ ID NO: 63) peptide (SEQ ID NO: 132) 52 A-CSR-5B + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-5B furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 63) site + P2A self- cleaving peptide (SEQ ID NO: 133) 53 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-6A P2A self-cleaving A-CSR-6A (SEQ ID NO: 49) (SEQ ID NO: 64) peptide (SEQ ID NO: 132) 54 A-CSR-6A + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-6A furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 64) site + P2A self- cleaving peptide (SEQ ID NO: 133) 55 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-6B P2A self-cleaving A-CSR-6B (SEQ ID NO: 49) (SEQ ID NO: 65) peptide (SEQ ID NO: 132) 56 A-CSR-6B + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-6B furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 65) site + P2A self- cleaving peptide (SEQ ID NO: 133) 57 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-7A P2A self-cleaving A-CSR-7A (SEQ ID NO: 49) (SEQ ID NO: 66) peptide (SEQ ID NO: 132) 58 A-CSR-7A + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-7A furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 66) site + P2A self- cleaving peptide (SEQ ID NO: 133) 59 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-7B P2A self-cleaving A-CSR-7B (SEQ ID NO: 49) (SEQ ID NO: 67) peptide (SEQ ID NO: 132) 60 A-CSR-7B + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-7B furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 67) site + P2A self- cleaving peptide (SEQ ID NO: 133) 61 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-8A P2A self-cleaving A-CSR-8A (SEQ ID NO: 49) (SEQ ID NO: 68) peptide (SEQ ID NO: 132) 62 A-CSR-8A + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-8A furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 68) site + P2A self- cleaving peptide (SEQ ID NO: 133) 63 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-8B P2A self-cleaving A-CSR-8B (SEQ ID NO: 49) (SEQ ID NO: 69) peptide (SEQ ID NO: 132) 64 A-CSR-8B + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-8B furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 69) site + P2A self- cleaving peptide (SEQ ID NO: 133) 65 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-1A P2A self-cleaving B-CSR-1A (SEQ ID NO: 48) (SEQ ID NO: 70) peptide (SEQ ID NO: 132) 66 B-CSR-1A + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-1A furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 70) site + P2A self- cleaving peptide (SEQ ID NO: 133) 67 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-1B P2A self-cleaving B-CSR-1B (SEQ ID NO: 48) (SEQ ID NO: 38) peptide (SEQ ID NO: 132) 68 B-CSR-1B + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-1B furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 38) site + P2A self- cleaving peptide (SEQ ID NO: 133) 69 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-2A P2A self-cleaving B-CSR-2A (SEQ ID NO: 48) (SEQ ID NO: 71) peptide (SEQ ID NO: 132) 70 B-CSR-2A + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-2A furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 71) site + P2A self- cleaving peptide (SEQ ID NO: 133) 71 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-2B P2A self-cleaving B-CSR-2B (SEQ ID NO: 48) (SEQ ID NO: 72) peptide (SEQ ID NO: 132) 72 B-CSR-2B + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-2B furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 72) site + P2A self- cleaving peptide (SEQ ID NO: 133) 73 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-3A P2A self-cleaving B-CSR-3A (SEQ ID NO: 48) (SEQ ID NO: 73) peptide (SEQ ID NO: 132) 74 B-CSR-3A + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-3A furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 73) site + P2A self- cleaving peptide (SEQ ID NO: 133) 75 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-3B P2A self-cleaving B-CSR-3B (SEQ ID NO: 48) (SEQ ID NO: 74) peptide (SEQ ID NO: 132) 76 B-CSR-3B + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-3B furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 74) site + P2A self- cleaving peptide (SEQ ID NO: 133) 77 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-4A P2A self-cleaving B-CSR-4A (SEQ ID NO: 48) (SEQ ID NO: 75) peptide (SEQ ID NO: 132) 78 B-CSR-4A + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-4A furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 75) site + P2A self- cleaving peptide (SEQ ID NO: 133) 79 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-4B P2A self-cleaving B-CSR-4B (SEQ ID NO: 48) (SEQ ID NO: 76) peptide (SEQ ID NO: 132) 80 B-CSR-4B + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-4B furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 76) site + P2A self- cleaving peptide (SEQ ID NO: 133) 81 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-5A P2A self-cleaving B-CSR-5A (SEQ ID NO: 48) (SEQ ID NO: 77) peptide (SEQ ID NO: 132) 82 B-CSR-5A + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-5A furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 77) site + P2A self- cleaving peptide (SEQ ID NO: 133) 83 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-5B P2A self-cleaving B-CSR-5B (SEQ ID NO: 48) (SEQ ID NO: 78) peptide (SEQ ID NO: 132) 84 B-CSR-5B + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-5B furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 78) site + P2A self- cleaving peptide (SEQ ID NO: 133) 85 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-6A P2A self-cleaving B-CSR-6A (SEQ ID NO: 48) (SEQ ID NO: 79) peptide (SEQ ID NO: 132) 86 B-CSR-6A + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-6A furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 79) site + P2A self- cleaving peptide (SEQ ID NO: 133) 87 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-6B P2A self-cleaving B-CSR-6B (SEQ ID NO: 48) (SEQ ID NO: 80) peptide (SEQ ID NO: 132) 88 B-CSR-6B + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-6B furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 80) site + P2A self- cleaving peptide (SEQ ID NO: 133) 89 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-7A P2A self-cleaving B-CSR-7A (SEQ ID NO: 48) (SEQ ID NO: 81) peptide (SEQ ID NO: 132) 90 B-CSR-7A + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-7A furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 81) site + P2A self- cleaving peptide (SEQ ID NO: 133) 91 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-7B P2A self-cleaving B-CSR-7B (SEQ ID NO: 48) (SEQ ID NO: 82) peptide (SEQ ID NO: 132) 92 B-CSR-7B + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-7B furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 82) site + P2A self- cleaving peptide (SEQ ID NO: 133) 93 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-8A P2A self-cleaving B-CSR-8A (SEQ ID NO: 48) (SEQ ID NO: 83) peptide (SEQ ID NO: 132) 94 B-CSR-8A + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-8A furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 83) site + P2A self- cleaving peptide (SEQ ID NO: 133) 95 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-8B P2A self-cleaving B-CSR-8B (SEQ ID NO: 48) (SEQ ID NO: 84) peptide (SEQ ID NO: 132) 96 B-CSR-8B + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-8B furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 84) site + P2A self- cleaving peptide (SEQ ID NO: 133) 97 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-1A P2A self-cleaving A-CSR-1A (SEQ ID NO: 50) (SEQ ID NO: 55) peptide (SEQ ID NO: 132) 98 A-CSR-1A + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-1A furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 55) site + P2A self- cleaving peptide (SEQ ID NO: 133) 99 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-1B P2A self-cleaving A-CSR-1B (SEQ ID NO: 50) (SEQ ID NO: 37) peptide (SEQ ID NO: 132) 100 A-CSR-1B + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-1B furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 37) site + P2A self- cleaving peptide (SEQ ID NO: 133) 101 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-2A P2A self-cleaving A-CSR-2A (SEQ ID NO: 50) (SEQ ID NO: 56) peptide (SEQ ID NO: 132) 102 A-CSR-2A + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-2A furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 56) site + P2A self- cleaving peptide (SEQ ID NO: 133) 103 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-2B P2A self-cleaving A-CSR-2B (SEQ ID NO: 50) (SEQ ID NO: 57) peptide (SEQ ID NO: 132) 104 A-CSR-2B + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-2B furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 57) site + P2A self- cleaving peptide (SEQ ID NO: 133) 105 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-3A P2A self-cleaving A-CSR-3A (SEQ ID NO: 50) (SEQ ID NO: 58) peptide (SEQ ID NO: 132) 106 A-CSR-3A + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-3A furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 58) site + P2A self- cleaving peptide (SEQ ID NO: 133) 107 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-3B P2A self-cleaving A-CSR-3B (SEQ ID NO: 50) (SEQ ID NO: 59) peptide (SEQ ID NO: 132) 108 A-CSR-3B + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-3B furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 59) site + P2A self- cleaving peptide (SEQ ID NO: 133) 109 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-4A P2A self-cleaving A-CSR-4A (SEQ ID NO: 50) (SEQ ID NO: 60) peptide (SEQ ID NO: 132) 110 A-CSR-4A + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-4A furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 60) site + P2A self- cleaving peptide (SEQ ID NO: 133) 111 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-4B P2A self-cleaving A-CSR-4B (SEQ ID NO: 50) (SEQ ID NO: 61) peptide (SEQ ID NO: 132) 112 A-CSR-4B + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-4B furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 61) site + P2A self- cleaving peptide (SEQ ID NO: 133) 113 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-5A P2A self-cleaving A-CSR-5A (SEQ ID NO: 50) (SEQ ID NO: 62) peptide (SEQ ID NO: 132) 114 A-CSR-5A + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-5A furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 62) site + P2A self- cleaving peptide (SEQ ID NO: 133) 115 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-5B P2A self-cleaving A-CSR-5B (SEQ ID NO: 50) (SEQ ID NO: 63) peptide (SEQ ID NO: 132) 116 A-CSR-5B + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-5B furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 63) site + P2A self- cleaving peptide (SEQ ID NO: 133) 117 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-6A P2A self-cleaving A-CSR-6A (SEQ ID NO: 50) (SEQ ID NO: 64) peptide (SEQ ID NO: 132) 118 A-CSR-6A + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-6A furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 64) site + P2A self- cleaving peptide (SEQ ID NO: 133) 119 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-6B P2A self-cleaving A-CSR-6B (SEQ ID NO: 50) (SEQ ID NO: 65) peptide (SEQ ID NO: 132) 120 A-CSR-6B + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-6B furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 65) site + P2A self- cleaving peptide (SEQ ID NO: 133) 121 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-7A P2A self-cleaving A-CSR-7A (SEQ ID NO: 50) (SEQ ID NO: 66) peptide (SEQ ID NO: 132) 122 A-CSR-7A + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-7A furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 66) site + P2A self- cleaving peptide (SEQ ID NO: 133) 123 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-7B P2A self-cleaving A-CSR-7B (SEQ ID NO: 50) (SEQ ID NO: 67) peptide (SEQ ID NO: 132) 124 A-CSR-7B + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-7B furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 67) site + P2A self- cleaving peptide (SEQ ID NO: 133) 125 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-8A P2A self-cleaving A-CSR-8A (SEQ ID NO: 50) (SEQ ID NO: 68) peptide (SEQ ID NO: 132) 126 A-CSR-8A + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-8A furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 68) site + P2A self- cleaving peptide (SEQ ID NO: 133) 127 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-8B P2A self-cleaving A-CSR-8B (SEQ ID NO: 50) (SEQ ID NO: 69) peptide (SEQ ID NO: 132) 128 A-CSR-8B + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-8B furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 69) site + P2A self- cleaving peptide (SEQ ID NO: 133)
(268) In some embodiments, the single nucleic acid encoding the anti-PSMA caTCR+anti-PSMA CSR of any one of rows 1-128 in Table 12 further encodes a signal peptide (e.g., upstream of the sequence(s) encoding Chain 1 and/or Chain 2 of the caTCR and/or upstream of the sequence encoding the anti-PSMA CSR). In some embodiments, the signal peptide comprises the amino acid sequence of SEQ ID NO: 128. Although specific linkers are listed in rows 1-128 in Table 12, an alternative linker may be use (see e.g., Table 6A) may be used. In some embodiments, the single nucleic acid encoding the anti-PSMA caTCR+anti-PSMA CSR of any one of rows 1-128 in Table 12 further encodes one or more peptide linkers (e.g., cleavable linkers) and/or peptide tags (see e.g., Tables 6A and 6B).
(269) Anti-PSMA Effector Cells
(270) Provided herein is an effector cell (e.g., an immune cell, such as a T cell, e.g., an ?? T cell, a ?? T cell, a cytotoxic T cell, a helper T cell, or a natural killer T cell) that comprises, expresses, or is associated with an anti-PSMA CAR, an anti-PSMA caTCR, an anti-PSMA multispecific construct (e.g., a tandem scFv, such as a tandem di-scFv), an anti-PSMA CSR, or an anti-PSMA construct combination described herein. Such cells are also referred to as anti-PSMVA effector cells.
(271) In some embodiments, the anti-PSMA effector cells (also referred to herein as anti-PSMA immune cells or anti-PSMA T cells) of the present disclosure are able to replicate in vivo, resulting in long-term persistence that can lead to sustained control of a disease associated with PSMA (such as cancer, e.g., prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer).
(272) In some embodiments, the anti-PSMA effector cell (such as a lymphocyte, e.g., a T cell) comprises (such as expresses) is an anti-PSMA CAR effector cell that comprises, expresses, or is associated with an anti-PSMA CAR described herein. In some embodiments, the anti-PSMA CAR effector cell further comprises (such as expresses) a multispecific construct. Such effector cells are referred to herein as anti-PSMA CAR plus multispecific construct effector cells. In some embodiments, the expression of the multispecific construct is inducible. In some embodiments, the expression of the multispecific construct is inducible upon signaling by the anti-PSMA CAR. In some embodiments, the multispecific construct is selected from the group consisting of a tandem scFv, a diabody (Db), a single chain diabody (scDb), a dual-affinity retargeting (DART) antibody, and a dual variable domain (DVD) antibody. In some embodiments, the multispecific construct is a tandem scFv. Such effector cells are also referred to herein as anti-PSMA CAR plus tandem scFv effector cells. In some embodiments the tandem scFv is a tandem di-scFv, e.g., a tandem di-scFv comprising a first scFv and a second scFv, optionally connected by a peptide linker. In some embodiments, the first scFv targets a T cell surface antigen (e.g., CD3 or CD16a), a soluble immunosuppressive agent (e.g., TGF-? 1 to 4, IL-4, or IL-10), or an immune checkpoint inhibitor. In some embodiments, the second scFv targets a disease-associated antigen. In some embodiments, the disease-associated antigen is an antigen other than PSMA. In some embodiments, the disease-associated antigen is PSMA. In some embodiments, the tandem di-scFv is an anti-PSMA anti-CD3 tandem di-scFv that comprises an antibody moiety (such as described herein) that specifically binds PSMA (such as PSMA expressed on the surface of a cell, e.g., a cancer cell) and a second binding moiety that specifically binds CD3. In some embodiments, the anti-PSMA anti-CD3 tandem di-scFv comprises an amino acid sequence set forth in any one of SEQ ID NOs: 25-28. In some embodiments, the anti-PSMA anti-CD3 tandem di-scFv is encoded by a nucleic acid that is operably linked to an NFAT-derived promoter. In some embodiments, the NFAT-derived promoter is an NFAT-derived minimal promoter. In some embodiments, the anti-PSMA anti-CD3 tandem di-scFv is encoded by a nucleic acid that is operably linked to an IL-2 promoter.
(273) In some embodiments, the anti-PSMA CAR effector cell further comprises (such as expresses) a CSR (see, e.g., U.S. Application No. 62/490,578, filed Apr. 26, 2017, which is incorporated by reference herein in its entirety). Such effector cells are referred to as anti-PSMA CAR plus CSR effector cells. In some embodiments, the CSR is an anti-PSMA CSR (i.e., a CSR that comprises a PSMA-binding module), e.g., such as described herein. In some embodiments, the CSR binds to a target ligand other than PSMA.
(274) In some embodiments, the anti-PSMA effector cell (such as a lymphocyte, e.g., a T cell) comprises (such as expresses) is an anti-PSMA caTCR effector cell that comprises, expresses, or is associated with an anti-PSMA caTCR described herein. In some embodiments, the anti-PSMA caTCR effector cell comprises (such as expresses) a multispecific construct. Such effector cells are referred to herein as anti-PSMA caTCR plus multispecific construct effector cells. In some embodiments, the expression of the multispecific construct is inducible. In some embodiments, the expression of the multispecific construct is inducible upon signaling by the anti-PSMA caTCR. In some embodiments, the multispecific construct is selected from the group consisting of a tandem scFv, a diabody (Db), a single chain diabody (scDb), a dual-affinity retargeting (DART) antibody, and a dual variable domain (DVD) antibody. In some embodiments, the multispecific construct is a tandem scFv. Such effector cells are also referred to herein as anti-PSMA caTCR plus tandem scFv effector cells. In some embodiments the tandem scFv is a tandem di-scFv, e.g., a tandem di-scFv comprising a first scFv and a second scFv, optionally connected by a peptide linker. In some embodiments, the first scFv targets a T cell surface antigen (e.g., CD3 or CD16a), a soluble immunosuppressive agent (e.g., TGF-? 1 to 4, IL-4, or IL-10), or an immune checkpoint inhibitor. In some embodiments, the second scFv targets a disease-associated antigen. In some embodiments, the disease-associated antigen is an antigen other than PSMA. In some embodiments, the disease-associated antigen is PSMA. In some embodiments, the tandem di-scFv is an anti-PSMA anti-CD3 tandem di-scFv that comprises an antibody moiety (such as described herein) that specifically binds PSMA (such as PSMA expressed on the surface of a cell, e.g., a cancer cell) and a second binding moiety that specifically binds CD3. In some embodiments, the anti-PSMA anti-CD3 tandem di-scFv comprises an amino acid sequence set forth in any one of SEQ ID NOs: 25-28. In some embodiments, the anti-PSMA anti-CD3 tandem di-scFv is encoded by a nucleic acid that is operably linked to an NFAT-derived promoter. In some embodiments, the NFAT-derived promoter is an NFAT-derived minimal promoter. In some embodiments, the anti-PSMA anti-CD3 tandem di-scFv is encoded by a nucleic acid that is operably linked to an IL-2 promoter.
(275) In some embodiments, the anti-PSMA caTCR effector cell comprises (such as expresses) a CSR (see, e.g., U.S. Application No. 62/490,578, filed Apr. 26, 2017, which is incorporated by reference herein in its entirety). Such effector cells are referred to as anti-PSMA caTCR plus CSR effector cells. In some embodiments, the CSR is an anti-PSMA CSR (i.e., a CSR that comprises a PSMA-binding module), e.g., such as described herein. In some embodiments, the CSR binds to a target ligand other than PSMA. In some embodiments, the anti-PSMA caTCR plus CSR effector cell comprises (such as expresses) any of the anti-PSMA caTCR plus anti-PSMA CSR construct combinations described elsewhere herein.
(276) In some embodiments, the effector cell (such as a lymphocyte, e.g., a T cell) comprises a CAR or a caTCR that does not target PSMA and anti-PSMA multispecific construct (i.e., an anti-PSMA tandem scFv, e.g., an anti-PSMA tandem di-scFv), e.g., such as described herein. In some embodiments, the effector cell referred to as a CAR plus anti-PSMA tandem scFv effector cell or caTCR plus anti-PSMA tandem scFv effector cell.
(277) In some embodiments, the effector cell (such as a lymphocyte, e.g., a T cell) comprises a CAR or a caTCR that does not target PSMA and anti-PSMA CSR (i.e., a CSR that comprises a PSMA-binding module), e.g., such as described herein. In some embodiments, the effector cell referred to as a CAR plus anti-PSMA CSR effector cell or caTCR plus anti-PSMA CSR effector cell.
(278) Also provided herein are methods of producing the effector cells described herein.
(279) For example, provided is a method of producing an anti-PSMA CAR effector cell, e.g., an anti-PSMA CAR immune cell or an anti-PSMA CAR T cell that comprises genetically modifying (i.e., transducing or transfecting) a cell (e.g., a T cell, such as an ?? T cell, a ?? T cell, a cytotoxic T cell, a helper T cell, or a natural killer T cell) with a nucleic acid, a set of nucleic acids, a vector, or a set of vectors encoding an anti-PSMA CAR.
(280) In some embodiments, the method comprises genetically modifying an anti-PSMA CAR effector cell with a further nucleic acid, a set of nucleic acids, a vector, or a set of vectors encoding a multispecific construct. In some embodiments, the method of producing an anti-PSMA CAR plus multispecific construct effector cell (such as an anti-PSMA CAR plus tandem scFv effector cell) comprises genetically modifying (i.e., transducing or transfecting) a cell (e.g., a T cell, such as an ?? T cell, a ?? T cell, a cytotoxic T cell, a helper T cell, or a natural killer T cell) with a nucleic acid, a set of nucleic acids, a vector, or a set of vectors that encode the anti-PSMA caTCR and the multispecific construct. In some embodiments, the expression of the multispecific construct is inducible. In some embodiments, the expression of the multispecific construct is inducible upon signaling by the anti-PSMA CAR. In some embodiments, the multispecific construct is selected from the group consisting of a tandem scFv, a diabody (Db), a single chain diabody (scDb), a dual-affinity retargeting (DART) antibody, and a dual variable domain (DVD) antibody. In some embodiments, the multispecific construct is a tandem scFv. Such effector cells are also referred to herein as anti-PSMA caTCR plus tandem scFv effector cells. In some embodiments the tandem scFv is a tandem di-scFv, e.g., a tandem di-scFv comprising a first scFv and a second scFv, optionally connected by a peptide linker. In some embodiments, the first scFv targets a T cell surface antigen (e.g., CD3 or CD16a), a soluble immunosuppressive agent (e.g., TGF-? 1 to 4, IL-4, or IL-10), or an immune checkpoint inhibitor. In some embodiments, the second scFv targets a disease-associated antigen. In some embodiments, the disease-associated antigen is an antigen other than PSMA. In some embodiments, the disease-associated antigen is PSMA. In some embodiments, the tandem di-scFv is an anti-PSMA anti-CD3 tandem di-scFv that comprises an antibody moiety (such as described herein) that specifically binds PSMA (such as PSMA expressed on the surface of a cell, e.g., a cancer cell) and a second binding moiety that specifically binds CD3. In some embodiments, the anti-PSMA anti-CD3 tandem di-scFv comprises an amino acid sequence set forth in any one of SEQ ID NOs: 25-28. In some embodiments, the anti-PSMA anti-CD3 tandem di-scFv is encoded by a nucleic acid that is operably linked to an NFAT-derived promoter. In some embodiments, the NFAT-derived promoter is an NFAT-derived minimal promoter. In some embodiments, the anti-PSMA anti-CD3 tandem di-scFv is encoded by a nucleic acid that is operably linked to an IL-2 promoter.
(281) In some embodiments, the method comprises genetically modifying an anti-PSMA CAR effector cell with a further nucleic acid, a set of nucleic acids, a vector, or a set of vectors encoding a CSR that comprises ligand-binding domain that specifically binds to a target ligand and a costimulatory signaling domain capable of providing a stimulatory signal to the immune cell. In some embodiments, the method of producing an anti-PSMA CAR plus CSR effector cell comprises genetically modifying (i.e., transducing or transfecting) a cell (e.g., a T cell, such as an ?? T cell, a ?? T cell, a cytotoxic T cell, a helper T cell, or a natural killer T cell) with a nucleic acid, a set of nucleic acids, a vector, or a set of vectors that encode the anti-PSMA CAR and the CSR. Further details regarding CSRs are described in U.S. Application No. 62/490,578, filed Apr. 26, 2017, which is incorporated by reference herein in its entirety. In some embodiments, expression of the CSR is inducible upon signaling through the anti-PSMA CAR. In some embodiments, CSR is an anti-PSMA CSR (i.e., a CSR that comprises a PSMA-binding module), e.g., such as described herein. In some embodiments, the CSR binds to a target ligand other than PSMA.
(282) Also provided is a method of producing an anti-PSMA caTCR effector cell, e.g., an anti-PSMA caTCR immune cell or an anti-PSMA caTCR T cell that comprises genetically modifying (i.e., transducing or transfecting) a cell (e.g., a T cell, such as an ?? T cell, a ?? T cell, a cytotoxic T cell, a helper T cell, or a natural killer T cell) with a nucleic acid, a set of nucleic acids, a vector, or a set of vectors encoding an anti-PSMA caTCR.
(283) In some embodiments, the method comprises genetically modifying an anti-PSMA caTCR effector cell with a further nucleic acid, a set of nucleic acids, a vector, or a set of vectors encoding a multispecific construct. In some embodiments, the method of producing an anti-PSMA caTCR plus multispecific construct effector cell (such as an anti-PSMA caTCR plus tandem scFv effector cell) comprises genetically modifying (i.e., transducing or transfecting) a cell (e.g., a T cell, such as an ?? T cell, a ?? T cell, a cytotoxic T cell, a helper T cell, or a natural killer T cell) with a nucleic acid, a set of nucleic acids, a vector, or a set of vectors that encode the anti-PSMA caTCR and the multispecific construct. In some embodiments, the expression of the multispecific construct is inducible. In some embodiments, the expression of the multispecific construct is inducible upon signaling by the anti-PSMA caTCR. In some embodiments, the multispecific construct is selected from the group consisting of a tandem scFv, a diabody (Db), a single chain diabody (scDb), a dual-affinity retargeting (DART) antibody, and a dual variable domain (DVD) antibody. In some embodiments, the multispecific construct is a tandem scFv. Such effector cells are also referred to herein as anti-PSMA caTCR plus tandem scFv effector cells. In some embodiments the tandem scFv is a tandem di-scFv, e.g., a tandem di-scFv comprising a first scFv and a second scFv, optionally connected by a peptide linker. In some embodiments, the first scFv targets a T cell surface antigen (e.g., CD3 or CD16a), a soluble immunosuppressive agent (e.g., TGF-? 1 to 4, IL-4, or IL-10), or an immune checkpoint inhibitor. In some embodiments, the second scFv targets a disease-associated antigen. In some embodiments, the disease-associated antigen is an antigen other than PSMA. In some embodiments, the disease-associated antigen is PSMA. In some embodiments, the tandem di-scFv is an anti-PSMA anti-CD3 tandem di-scFv that comprises an antibody moiety (such as described herein) that specifically binds PSMA (such as PSMA expressed on the surface of a cell, e.g., a cancer cell) and a second binding moiety that specifically binds CD3. In some embodiments, the anti-PSMA anti-CD3 tandem di-scFv comprises an amino acid sequence set forth in any one of SEQ ID NOs: 25-28. In some embodiments, the anti-PSMA anti-CD3 tandem di-scFv is encoded by a nucleic acid that is operably linked to an NFAT-derived promoter. In some embodiments, the NFAT-derived promoter is an NFAT-derived minimal promoter. In some embodiments, the anti-PSMA anti-CD3 tandem di-scFv is encoded by a nucleic acid that is operably linked to an IL-2 promoter.
(284) In some embodiments, the method comprises genetically modifying an anti-PSMA caTCR effector cell with a further nucleic acid, a set of nucleic acids, a vector, or a set of vectors encoding a CSR that comprises ligand-binding domain that specifically binds to a target ligand and a costimulatory signaling domain capable of providing a stimulatory signal to the immune cell. In some embodiments, the method of producing an anti-PSMA caTCR plus CSR effector cell comprises genetically modifying (i.e., transducing or transfecting) a cell (e.g., a T cell, such as an ?? T cell, a ?? T cell, a cytotoxic T cell, a helper T cell, or a natural killer T cell) with a nucleic acid, a set of nucleic acids, a vector, or a set of vectors that encode the anti-PSMA caTCR and the CSR. Further details regarding CSRs are described in U.S. Application No. 62/490,578, filed Apr. 26, 2017, which is incorporated by reference herein in its entirety. In some embodiments, expression of the CSR is inducible upon signaling through the anti-PSMA caTCR. In some embodiments, CSR is an anti-PSMA CSR (i.e., a CSR that comprises a PSMA-binding module), e.g., such as described herein. In some embodiments, the CSR binds to a target ligand other than PSMA.
(285) In some embodiments, the method comprises genetically modifying an effector cell (such as a lymphocyte, e.g., a T cell) that comprises nucleic acid, a set of nucleic acids, a vector, or a set of vectors encoding a CAR or a caTCR that does not target PSMA and with an additional nucleic acid, a set of nucleic acids, a vector, or a set of vectors that encodes an anti-PSMA multispecific construct (i.e., an anti-PSMA tandem scFv, e.g., an anti-PSMA tandem di-scFv), e.g., such as described herein. In some embodiments, the method comprises genetically modifying an effector cell with a nucleic acid, a set of nucleic acids, a vector, or a set of vectors that encode the CAR or caTCR that does not target PSMA and the anti-PSMA multispecific construct (i.e., an anti-PSMA tandem scFv, e.g., an anti-PSMA tandem di-scFv).
(286) In some embodiments, the method comprises genetically modifying an effector cell (such as a lymphocyte, e.g., a T cell) that comprises nucleic acid, a set of nucleic acids, a vector, or a set of vectors encoding a CAR or a caTCR that does not target PSMA and with an additional nucleic acid, a set of nucleic acids, a vector, or a set of vectors that encodes an anti-PSMA CSR (i.e., a CSR that comprises a PSMA-binding module), e.g., such as described herein. In some embodiments, the method comprises genetically modifying an effector cell with a nucleic acid, a set of nucleic acids, a vector, or a set of vectors that encode the CAR or caTCR that does not target PSMA and the anti-PSMA CSR.
(287) Briefly, prior to expansion and genetic modification of the cells (such as T cells), a source of cells is obtained from a subject. For example, T cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. In some embodiments, any number of T cell lines available in the art may be used. In some embodiments, T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as Ficoll? separation. In some embodiments, cells from the circulating blood of an individual are obtained by apheresis. The apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets. In some embodiments, the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps. In some embodiments, the cells are washed with phosphate buffered saline (PBS). In some embodiments, the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations. As those of ordinary skill in the art would readily appreciate a washing step may be accomplished by methods known to those in the art, such as by using a semi-automated flow-through centrifuge (for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5) according to the manufacturer's instructions. After washing, the cells may be resuspended in a variety of biocompatible buffers, such as Ca.sup.2+-free, Mg.sup.2+-free PBS, PlasmaLyte A, or other saline solutions with or without buffer. Alternatively, the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.
(288) In some embodiments, T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLL? gradient or by counterflow centrifugal elutriation. A specific subpopulation of T cells, such as CD3.sup.+, CD28.sup.+, CD4.sup.+, CD8.sup.+, CD45RA.sup.+, and CD45RO.sup.+ T cells, can be further isolated by positive or negative selection techniques. For example, in some embodiments, T cells are isolated by incubation with anti-CD3/anti-CD28 (i.e., 3?28)-conjugated beads, such as DYNABEADS? M-450 CD3/CD28 T, for a time period sufficient for positive selection of the desired T cells. In some embodiments, the time period is about 30 minutes. In some embodiments, the time period ranges from 30 minutes to 36 hours or longer and all integer values there between. In some embodiments, the time period is at least one, 2, 3, 4, 5, or 6 hours. In some embodiments, the time period is 10 to 24 hours. In some embodiments, the incubation time period is 24 hours. For isolation of T cells from patients with leukemia, use of longer incubation times, such as 24 hours, can increase cell yield. Longer incubation times may be used to isolate T cells in any situation where there are few T cells as compared to other cell types, such as in isolating tumor infiltrating lymphocytes (TIL) from tumor tissue or from immune-compromised individuals. Further, use of longer incubation times can increase the efficiency of capture of CD8.sup.+ T cells. Thus, by simply shortening or lengthening the time T cells are allowed to bind to the CD3/CD28 beads and/or by increasing or decreasing the ratio of beads to T cells, subpopulations of T cells can be preferentially selected for or against at culture initiation or at other time points during the process. Additionally, by increasing or decreasing the ratio of anti-CD3 and/or anti-CD28 antibodies on the beads or other surface, subpopulations of T cells can be preferentially selected for or against at culture initiation or at other desired time points. The skilled artisan would recognize that multiple rounds of selection can also be used. In some embodiments, it may be desirable to perform the selection procedure and use the unselected cells in the activation and expansion process. Unselected cells can also be subjected to further rounds of selection.
(289) Enrichment of a T cell population by negative selection can be accomplished with a combination of antibodies directed to surface markers unique to the negatively selected cells. One method is cell sorting and/or selection via negative magnetic immunoadherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells negatively selected. For example, to enrich for CD4.sup.+ cells by negative selection, a monoclonal antibody cocktail typically includes antibodies to CD 14, CD20, CD11b, CD 16, HLA-DR, and CD8. In some embodiments, it may be desirable to enrich for or positively select for regulatory T cells which typically express CD4.sup.+, CD25.sup.+, CD62Lhi, GITR.sup.+, and FoxP3.sup.+. Alternatively, in some embodiments, T regulatory cells are depleted by anti-CD25 conjugated beads or other similar methods of selection.
(290) For isolation of a desired population of cells by positive or negative selection, the concentration of cells and surface (e.g., particles such as beads) can be varied. In some embodiments, it may be desirable to significantly decrease the volume in which beads and cells are mixed together (i.e., increase the concentration of cells), to ensure maximum contact of cells and beads. For example, in some embodiments, a concentration of about 2 billion cells/ml is used. In some embodiments, a concentration of about 1 billion cells/ml is used. In some embodiments, greater than about 100 million cells/ml is used. In some embodiments, a concentration of cells of about any of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used. In some embodiments, a concentration of cells of about any of 75, 80, 85, 90, 95, or 100 million cells/ml is used. In some embodiments, a concentration of about 125 or about 150 million cells/ml is used. Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells, or from samples where there are many tumor cells present (i.e., leukemic blood, tumor tissue, etc.). Such populations of cells may have therapeutic value and would be desirable to obtain. For example, using high concentration of cells allows more efficient selection of CD8.sup.+ T cells that normally have weaker CD28 expression.
(291) In some embodiments, T cells are obtained from a patient directly following treatment. In this regard, it has been observed that following certain cancer treatments, in particular treatments with drugs that damage the immune system, shortly after treatment during the period when patients would normally be recovering from the treatment, the quality of T cells obtained may be optimal or improved for their ability to expand ex vivo. Likewise, following ex vivo manipulation using the methods described herein, these cells may be in a preferred state for enhanced engraftment and in vivo expansion. Thus, it is contemplated within the context of the present disclosure to collect blood cells, including T cells, dendritic cells, or other cells of the hematopoietic lineage, during this recovery phase. Further, in some embodiments, mobilization (for example, mobilization with GM-CSF) and conditioning regimens can be used to create a condition in a subject wherein repopulation, recirculation, regeneration, and/or expansion of particular cell types is favored, especially during a defined window of time following therapy. Illustrative cell types include T cells, B cells, dendritic cells, and other cells of the immune system.
(292) Whether prior to or after genetic modification of the T cells to express, e.g., an anti-PSMA CAR or an anti-PSMA caTCR, optionally with a CSR (such as an anti-PSMA CSR) or a tandem scFv (such as an anti-PSMA tandem scFv), the T cells can be activated and expanded generally using methods as described, for example, in U.S. Pat. Nos. 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041; and U.S. Patent Application Publication No. 20060121005.
(293) Generally, the genetically modified cells (such as T cells, such as ?? T cells, ?? T cells, cytotoxic T cells, helper T cells, or natural killer T cells) described herein are expanded by contact with a surface having attached thereto an agent that stimulates a CD3/TCR complex associated signal and a ligand that stimulates a co-stimulatory molecule on the surface of the T cells. In particular, T cell populations may be stimulated, such as by contact with an anti-CD3 antibody, or antigen-binding fragment thereof, or an anti-CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) in conjunction with a calcium ionophore. For co-stimulation of an accessory molecule on the surface of the T cells, a ligand that binds the accessory molecule is used. For example, a population of T cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells. To stimulate proliferation of either CD4.sup.+ T cells or CD8.sup.+ T cells, an anti-CD3 antibody and an anti-CD28 antibody. Examples of an anti-CD28 antibody include 9.3, B-T3, XR-CD28 (Diaclone, Besangon, France) can be used as can other methods commonly known in the art (Berg et al., Transplant Proc. 30(8):3975-3977, 1998; Haanen et al., J. Exp. Med. 190(9):13191328, 1999; Garland et al., J. Immunol. Meth. 227(1-2):53-63, 1999).
(294) Immunoconjugates and Preparation Thereof
(295) Also provided herein are immunoconjugates (anti-PSMA immunoconjugates) that comprise an anti-PSMA construct (such as described herein) attached to an effector molecule. In some embodiments the effector molecule is a therapeutic agent, such as a cancer therapeutic agent (or a chemotherapeutic agent), or a toxin that is cytotoxic, cytostatic, and/or otherwise provides some therapeutic benefit. In some embodiments, the effector molecule is a label (e.g., a label that directly or indirectly produces a detectable signal.)
(296) Anti-PSMA immunoconjugates comprising a therapeutic agent (also referred to as antibody-drug conjugates or ADCs) may be used for the local delivery of cytotoxic or cytostatic agents, i.e., drugs to kill or inhibit proliferation tumor cells during treatment for cancer. Targeted delivery of the drug moiety to cells (such as cancer cells) that express or overexpress PSMA permit the intracellular accumulation of the therapeutic agent. See, e.g., Syrigos and Epenetos, Anticancer Research 19:605-614 (1999); Niculescu-Duvaz and Springer, Adv. Drg. Del. Rev. 26:151-172 (1997); U.S. Pat. No. 4,975,278. By contrast, systemic administration of unconjugated therapeutic agents may result in unacceptable levels of toxicity to normal cells as well as the target cells sought to be eliminated (Baldwin et al., Lancet (Mar. 15, 1986):603-605 (1986); Thorpe, (1985) Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review, in Monoclonal Antibodies '84: Biological And Clinical Applications, A. Pinchera et al. (eds.), pp. 475-506). Maximal efficacy with minimal toxicity is sought thereby.
(297) In some embodiments, the anti-PSMA immunoconjugate comprises an anti-PSMA antibody moiety (such as described herein) and a chemotherapeutic agent such as (but not limited to), e.g., daunomycin, doxorubicin, methotrexate, or vindesine (Rowland et al., Cancer Immunol. Immunother. 21:183-187 (1986)). In some embodiments, the anti-PSMA immunoconjugate comprises a bacterial toxin (such as diphtheria toxin), a plant toxin (such as ricin), a small molecule toxin (such as geldanamycin (Mandler et al., J. Nat. Cancer Inst. 92(19):1573-1581 (2000); Mandler et al., Bioorganic & Med. Chem. Letters 10:1025-1028 (2000); Mandler et al., Bioconjugate Chem. 13:786-791 (2002)), a maytansinoid (EP 1391213; Liu et al., Proc. Natl. Acad. Sci. USA 93:8618-8623 (1996)), a calicheamicin (Lode et al., Cancer Res. 58:2928 (1998); Hinman et al., Cancer Res. 53:3336-3342 (1993)), a dolastatin, an aurostatin, a trichothecene, CC1065, or a derivative thereof that exhibits toxin activity.
(298) In some embodiments, the anti-PSMA immunoconjugate comprises an anti-PSMA antibody moiety (such as described herein) and an enzymatically active toxin (or a fragment thereof that exhibits toxin activity). Such enzymatic toxins include, but are not limited to, e.g., a diphtheria A chain, a nonbinding active fragment of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, ?-sarcin, an Aleuritesfordii protein, a dianthin protein, a Phytolaca americana protein (such as PAPI, PAPII, and PAP-S), aMomordica charantia inhibitor, curcin, crotin, a Sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, or a tricothecene. See, e.g., WO 93/21232 published Oct. 28, 1993.
(299) In some embodiments, the anti-PSMA immunoconjugate comprises an anti-PSMA antibody moiety (such as described herein) and a therapeutic agent that has an intracellular activity. In some embodiments, the anti-PSMA immunoconjugate is internalized and the therapeutic agent that has an intracellular activity is a cytotoxin that blocks the protein synthesis in a cell, thus leading to cell death. Exemplary toxins that block protein synthesis (such as by inactivating ribosomes) include, without limitation, e.g., gelonin, bouganin, saporin, ricin, ricin A chain, bryodin, diphtheria toxin, restrictocin, Pseudomonas exotoxin A and variants thereof. In some embodiments, the anti-PSMA immunoconjugate that comprises a cytotoxin that blocks protein synthesis in a cell must be internalized upon binding to the target cell in order for the protein to be cytotoxic to the cells.
(300) In some embodiments, the anti-PSMA immunoconjugate comprises an anti-PSMA antibody moiety (such as described herein) and a therapeutic agent inhibits the synthesis of DNA. Exemplary therapeutic agents that inhibit DNA synthesis/DNA replication include, without limitation, e.g., enediyne (e.g., calicheamicin and esperamicin) and non-enediyne small molecule agents (e.g., bleomycin, methidiumpropyl-EDTA-Fe(II)). Other cancer therapeutic agents useful in accordance with the present application include, without limitation, daunorubicin, doxorubicin, distamycin A, cisplatin, mitomycin C, ecteinascidins, duocarmycin/CC-1065, and bleomycin/pepleomycin. In some embodiments, the anti-PSMA immunoconjugate comprises an anti-PSMA antibody moiety described herein and a compound with nucleolytic activity (e.g., a ribonuclease or a DNA endonuclease such as a deoxyribonuclease; DNase).
(301) In some embodiments, the anti-PSMA immunoconjugate comprises an anti-PSMA antibody moiety described herein and an agent that binds microtubules or tubulin. In some embodiments, the agent that binds microtubules or tubulin stabilizes the microtubule cytoskeleton against depolymerization. Alternatively, in some embodiments, the agent that binds microtubules or tubulin inhibits tubulin polymerization. Such therapeutic agents include, without limitation, e.g., rhizoxin/maytansine, paclitaxel, vincristine and vinblastine, colchicine, auristatin dolastatin 10 MMAE, and peloruside A.
(302) In some embodiments, the anti-PSMA immunoconjugate comprises an anti-PSMA antibody moiety (such as described herein) and an alkylating agent such as, without limitation, e.g., Asaley NSC 167780, AZQ NSC 182986, BCNU NSC 409962, Busulfan NSC 750, carboxyphthalatoplatinum NSC 271674, CBDCA NSC 241240, CCNU NSC 79037, CHIP NSC 256927, chlorambucil NSC 3088, chlorozotocin NSC 178248, cis-platinum NSC 119875, clomesone NSC 338947, cyanomorpholinodoxorubicin NSC 357704, cyclodisone NSC 348948, dianhydrogalactitol NSC 132313, fluorodopan NSC 73754, hepsulfam NSC 329680, hycanthone NSC 142982, melphalan NSC 8806, methyl CCNU NSC 95441, mitomycin C NSC 26980, mitozolamide NSC 353451, nitrogen mustard NSC 762, PCNU NSC 95466, piperazine NSC 344007, piperazinedione NSC 135758, pipobroman NSC 25154, porfiromycin NSC 56410, spirohydantoin mustard NSC 172112, teroxirone NSC 296934, tetraplatin NSC 363812, thio-tepa NSC 6396, triethylenemelamine NSC 9706, uracil nitrogen mustard NSC 34462, and Yoshi-864 NSC 102627.
(303) In some embodiments, the anti-PSMA immunoconjugate comprises an anti-PSMA antibody moiety described herein and antimitotic agent such as, without limitation, e.g., allocolchicine NSC 406042, Halichondrin B NSC 609395, colchicine NSC 757, colchicine derivative NSC 33410, dolastatin 10 NSC 376128 (NG-auristatin derived), maytansine NSC 153858, rhizoxin NSC 332598, taxol NSC 125973, taxol derivative NSC 608832, thiocolchicine NSC 361792, trityl cysteine NSC 83265, vinblastine sulfate NSC 49842, and vincristine sulfate NSC 67574.
(304) In some embodiments, the anti-PSMA immunoconjugate comprises an anti-PSMA antibody moiety (such as described herein) and a topoisomerase I inhibitor such as, e.g., camptothecin NSC 94600, camptothecin, Na salt NSC 100880, aminocamptothecin NSC 603071, camptothecin derivative NSC 95382, camptothecin derivative NSC 107124, camptothecin derivative NSC 643833, camptothecin derivative NSC 629971, camptothecin derivative NSC 295500, camptothecin derivative NSC 249910, camptothecin derivative NSC 606985, camptothecin derivative NSC 374028, camptothecin derivative NSC 176323, camptothecin derivative NSC 295501, camptothecin derivative NSC 606172, camptothecin derivative NSC 606173, camptothecin derivative NSC 610458, camptothecin derivative NSC 618939, camptothecin derivative NSC 610457, camptothecin derivative NSC 610459, camptothecin derivative NSC 606499, camptothecin derivative NSC 610456, camptothecin derivative NSC 364830, camptothecin derivative NSC 606497, and morpholinodoxorubicin NSC 354646.
(305) In some embodiments, the anti-PSMA immunoconjugate comprises an anti-PSMA antibody moiety (such as described herein) and a topoisomerase II inhibitor such as, without limitation, e.g., doxorubicin NSC 123127, amonafide NSC 308847, m-AMSA NSC 249992, anthrapyrazole derivative NSC 355644, pyrazoloacridine NSC 366140, bisantrene HCL NSC 337766, daunorubicin NSC 82151, deoxydoxorubicin NSC 267469, mitoxantrone NSC 301739, menogaril NSC 269148, N,N-dibenzyl daunomycin NSC 268242, oxanthrazole NSC 349174, rubidazone NSC 164011, VM-26 NSC 122819, and VP-16 NSC 141540.
(306) In some embodiments, the anti-PSMA immunoconjugate comprises an anti-PSMA antibody moiety (such as described herein) and an RNA or DNA antimetabolite such as, without limitation, e.g., L-alanosine NSC 153353, 5-azacytidine NSC 102816, 5-fluorouracil NSC 19893, acivicin NSC 163501, aminopterin derivative NSC 132483, aminopterin derivative NSC 184692, aminopterin derivative NSC 134033, an antifol NSC 633713, an antifol NSC 623017, Baker's soluble antifol NSC 139105, dichlorallyl lawsone NSC 126771, brequinar NSC 368390, ftorafur (pro-drug) NSC 148958, 5,6-dihydro-5-azacytidine NSC 264880, methotrexate NSC 740, methotrexate derivative NSC 174121, N-(phosphonoacetyl)-L-aspartate (PALA) NSC 224131, pyrazofurin NSC 143095, trimetrexate NSC 352122, 3-HP NSC 95678, 2-deoxy-5-fluorouridine NSC 27640, 5-HP NSC 107392, ?-TGDR NSC 71851, aphidicolin glycinate NSC 303812, ara-C NSC 63878, 5-aza-2-deoxycytidine NSC 127716, ?-TGDR NSC 71261, cyclocytidine NSC 145668, guanazole NSC 1895, hydroxyurea NSC 32065, inosine glycodialdehyde NSC 118994, macbecin II NSC 330500, pyrazoloimidazole NSC 51143, thioguanine NSC 752, and thiopurine NSC 755.
(307) In some embodiments, the anti-PSMA immunoconjugate comprises an anti-PSMA antibody moiety (such as described herein) and a radioactive isotope. A variety of radioactive isotopes are well known in the art and used for the production of radioconjugated polypeptide. Examples include, without limitation, e.g., .sup.211At, .sup.131I, .sup.125I, .sup.90Y, .sup.86Re, .sup.188Re, .sup.153Sm, .sup.212Bi, .sup.32P, .sup.212Pb and radioactive isotopes of Lu.
(308) In some embodiments, the anti-PSMA immunoconjugate comprises an anti-PSMA antibody moiety (such as described herein) and a receptor (such as streptavidin) for utilization in tumor pre-targeting wherein the antibody-receptor conjugate is administered to the patient, followed by removal of unbound conjugate from the circulation using a clearing agent and then administration of a ligand (e.g., avidin) that is conjugated to a cytotoxic agent (e.g., any one or more of the cytotoxic agents described herein or known in the art).
(309) In some embodiments, the anti-PSMA immunoconjugate comprises an anti-PSMA antibody moiety (such described herein) and a prodrug-activating enzyme. In some embodiments, the prodrug-activating enzyme converts a prodrug (e.g., a peptidyl chemotherapeutic agent, see WO 81/01145) to an active drug, such as an anti-cancer drug. In some embodiments, the anti-PSMA immunoconjugate comprising the prodrug-activating enzyme is used in antibody-dependent enzyme-mediated prodrug therapy (ADEPT). In some embodiments, the anti-PSMA immunoconjugate comprises an anti-PSMA antibody moiety (such as described herein) and alkaline phosphatase, which converts phosphate-containing prodrugs into free drugs; an arylsulfatase, which converts sulfate-containing prodrugs into free drugs; a cytosine deaminase, which converts non-toxic 5-fluorocytosine into the anti-cancer drug 5-fluorouracil; a protease (e.g., serratia protease, thermolysin, subtilisin, a carboxypeptidas or a cathepsin (such as cathepsin B and L)), which converts peptide-containing prodrugs into free drugs; a D-alanylcarboxypeptidase, which converts prodrugs that contain D-amino acid substituents; a carbohydrate-cleaving enzyme (such as ?-galactosidase and neuraminidase), which converts glycosylated prodrugs into free drugs; ?-lactamase, which converts drugs derivatized with ?-lactams into free drugs; or a penicillin amidase (such as penicillin V amidase or penicillin G amidase), which converts drugs derivatized at their amine nitrogens with phenoxyacetyl or phenylacetyl groups, respectively, into free drugs. In some embodiments, the prodrug-activating enzyme is covalently attached to anti-PSMA antibody moiety. In some embodiments, provided is a nucleic acid that encodes an anti-PSMA immunoconjugate that comprises anti-PSMA antibody moiety (such as described herein) and an enzyme (such as a prodrug activating enzyme). See, e.g., Neuberger et al., Nature 312:604-608. Producing such immunoconjugate entails transforming, transfecting, or transducing a host cell with the nucleic acid, culturing the host cell under conditions wherein the immunoconjugate is expressed, and harvesting the immunoconjugate.
(310) In some embodiments, the anti-PSMA immunoconjugate comprises an anti-PSMA antibody moiety (such as described herein) and a nucleic acid, such as, but are not limited to, e.g., an anti-sense RNA, a gene, or other polynucleotide. In some embodiments, the polynucleotide conjugated to the anti-PSMA antibody moiety comprises one or more nucleic acid analogs, such as thioguanine and thiopurine.
(311) In some embodiments, the anti-PSMA immunoconjugate comprises an anti-PSMA antibody moiety (such as described herein) and a label that generates a detectable signal, either directly or indirectly. Such anti-PSMA immunoconjugates can be used for research or diagnostic applications including, e.g., the in vivo or in vitro detection of cancer cells (e.g., in an individual having or suspected of having cancer or in a sample obtained from such an individual). In some embodiments, the label is radio-opaque. In some embodiments, the label is a radioisotope, e.g., without limitation, .sup.3H, .sup.14C, .sup.32P, .sup.35S, .sup.123I, .sup.125I, .sup.131I. In some embodiments, the label is a fluorescent compound (fluorophore) or a chemiluminescent compound (chromophore), such as, e.g., fluorescein isothiocyanate, rhodamine or luciferin. In some embodiments, the label is an enzyme, such as alkaline phosphatase, ?-galactosidase or horseradish peroxidase. In some embodiments, the label is an imaging agent or a metal ion. In some embodiments, the label is a radioactive atom for scintigraphic studies, for example .sup.99Tc or .sup.123I, or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, MRI), such as zirconium-89, iodine-123, iodine-131, indium-111, fluorine-19, carbon-13, nitrogen-15, oxygen-17, gadolinium, manganese or iron. Zirconium-89 may be complexed to various metal chelating agents and conjugated to antibodies, e.g., for PET imaging (WO 2011/056983).
(312) In some embodiments, the anti-PSMA immunoconjugate comprises an anti-PSMA antibody moiety (such as described herein) and a label that produces an indirectly detectable signal. For example, a secondary antibody that is specific for the anti-PSMA immunoconjugate and comprises a detectable label can be used to detect the anti-PSMA immunoconjugate.
(313) Anti-PSMA immunoconjugates may be prepared using any methods known in the art. See, e.g., WO 2009/067800, WO 2011/133886, and U.S. Patent Application Publication No. 2014322129, incorporated by reference herein in their entirety.
(314) The anti-PSMA antibody moiety of an anti-PSMA immunoconjugate may be attached to the effector molecule by any means by which the anti-PSMA antibody moiety can be associated with, or linked to, the effector molecule. In some embodiments, the anti-PSMA immunoconjugate comprise an anti-PSMA antibody moiety described herein and a label or therapeutic agent, wherein the label or the therapeutic agent molecule is covalently attached to the anti-PSMA antibody moiety. The anti-PSMA antibody moiety of an anti-PSMA immunoconjugate may be attached to the effector molecule by chemical or recombinant means. Chemical means for preparing fusions or conjugates are known in the art and can be used to prepare the anti-PSMA immunoconjugate. The method used to conjugate the anti-PSMA antibody moiety and effector molecule (i.e., the label or therapeutic agent) must be capable of joining the binding protein with the effector molecule without interfering with the ability of the anti-PSMA antibody moiety to bind to PSMA expressed on the target cell.
(315) In some embodiments, the anti-PSMA immunoconjugate comprises an anti-PSMA antibody moiety (such as described herein) that is indirectly linked to the effector molecule (i.e., the label or therapeutic agent). For example, the anti-PSMA antibody moiety of an anti-PSMA immunoconjugate may be directly linked to a liposome containing the effector molecule (i.e., the label or therapeutic agent). The effector molecule(s) and/or the anti-PSMA antibody moiety may also be bound to a solid surface.
(316) In some embodiments, the anti-PSMA antibody moiety of an anti-PSMA immunoconjugate and the effector molecule (i.e., the label or therapeutic agent) are both proteins and can be conjugated using techniques well known in the art. A variety of crosslinkers that can conjugate two proteins are well known in the art. (See for example Chemistry of Protein Conjugation and Crosslinking. 1991, Shans Wong, CRC Press, Ann Arbor). The crosslinker is generally chosen based on the reactive functional groups available or inserted on the anti-PSMA antibody moiety and/or effector molecule (i.e., the label or therapeutic agent). In addition, if there are no reactive groups, a photoactivatable crosslinker can be used. In certain instances, it may be desirable to include a spacer between the anti-PSMA antibody moiety and the effector molecule. Crosslinking agents known to the art include the homobifunctional agents: glutaraldehyde, dimethyladipimidate and Bis(diazobenzidine) and the heterobifunctional agents: m-Maleimidobenzoyl-N-Hydroxysuccinimide and Sulfo-m Maleimidobenzoyl-N-Hydroxysuccinimide.
(317) In some embodiments, the anti-PSMA antibody moiety of an anti-PSMA immunoconjugate may be engineered with specific residues for chemical attachment of the effector molecule (i.e., the label or therapeutic agent). Specific residues used for chemical attachment of molecule known to the art include lysine and cysteine. The crosslinker is chosen based on the reactive functional groups inserted on the anti-PSMA antibody moiety, and available on the effector molecule.
(318) An anti-PSMA immunoconjugate may also be prepared using recombinant DNA techniques. In such a case a DNA sequence encoding the anti-PSMA antibody moiety is fused to a DNA sequence encoding the effector molecule, resulting in a chimeric DNA molecule. The chimeric DNA sequence is transfected into a host cell that expresses the fusion protein. The fusion protein can be recovered from the cell culture and purified using techniques known in the art.
(319) Exemplary methods of attaching a detectable label to a binding molecule (such as an anti-PSMA antibody moiety) are described in Hunter, et al., Nature 144:945 (1962); David, et al., Biochemistry 13:1014 (1974); Pain, et al., J. Immunol. Meth. 40:219 (1981); Nygren, J. Histochem. and Cytochem. 30:407 (1982); Wensel and Meares, Radioimmunoimaging And Radioimmunotherapy, Elsevier, N.Y. (1983); and Colcher et al., Use Of Monoclonal Antibodies As Radiopharmaceuticals For The Localization Of Human Carcinoma Xenografts In Athymic Mice, Meth. Enzymol., 121:802-16 (1986).
(320) Radiolabels (or other labels) may be incorporated in the immunoconjugate in known ways. For example, the anti-PSMA antibody moiety may be biosynthesized or may be synthesized by chemical amino acid synthesis using suitable amino acid precursors involving, for example, fluorine-19 in place of hydrogen. Labels such as .sup.99Tc or .sup.123I, .sup.86Re, .sup.188Re and .sup.111In can be attached via a cysteine residue in the anti-PSMA antibody moiety. Yttrium-90 can be attached via a lysine residue. The IODOGEN method (Fraker et al., Biochem. Biophys. Res. Commun. 80:49-57 (1978)) can be used to incorporate iodine-123. Monoclonal Antibodies in Immunoscintigraphy (Chatal, CRC Press 1989) describes other methods in detail.
(321) Anti-PSMA immunoconjugates may be made using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithio) propionate (SPDP), succinimidyl-4-(N-maleimidomethyl) cyclohexane-1-carboxylate (SMCC), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCI), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene). For example, a ricin immunotoxin can be prepared as described in Vitetta et al., Science 238:1098 (1987). Carbon-14-labeled 1-isothiocyanatobenzyl-3-methyldiethylene tnaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionuclide to the anti-PSMA antibody moiety of the anti-PSMA immunoconjugate. See, e.g., WO 94/11026. The linker may be a cleavable linker facilitating release of a cytotoxic drug in the cell. For example, an acid-labile linker, peptidase-sensitive linker, photolabile linker, dimethyl linker or disulfide-containing linker (Chari et al., Cancer Research 52:127-131 (1992); U.S. Pat. No. 5,208,020) may be used.
(322) The anti-PSMA immunoconjugates of the present disclosure include, are not limited to, those prepared using BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo-GMBS, sulfo-KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, and sulfo-SMPB, and SVSB (succinimidyl-(4-vinylsulfone)benzoate), i.e., cross-linking reagents that are commercially available (e.g., from Pierce Biotechnology, Inc., Rockford, IL, U.S.A.). See pages 467-498, 2003-2004 Applications Handbook and Catalog.
(323) Nucleic Acids, Vectors, Host Cells, and Methods of Making Anti-PSMA Constructs
(324) Also provided are nucleic acid molecules (including sets of nucleic acid molecules) that encode the polypeptide portions of the anti-PSMA constructs described herein. In some embodiments, the nucleic acid (or a set of nucleic acids) encodes a full-length anti-PSMA antibody. In some embodiments, the nucleic acid (or a set of nucleic acids) encodes a multispecific anti-PSMA molecule (e.g., a multispecific anti-PSMA antibody, a bispecific anti-PSMA antibody, or a tandem di-scFv that comprises an anti-PSMA antibody moiety), or polypeptide portion thereof. In some embodiments, the nucleic acid (or a set of nucleic acids) encodes an anti-PSMA CAR. In some embodiments, the nucleic acid (or set of nucleic acids) encodes an anti-PSMA caTCR. In some embodiments, the two chains of the anti-PSMA caTCR are encoded on the same nucleic acid. In some embodiments, the two chains of the anti-PSMA caTCR are encoded on separate nucleic acids. In some embodiments, the nucleic acid encodes an anti-PSMA CSR. In some embodiments, the nucleic acid (or a set of nucleic acids) encodes an anti-PSMA immunoconjugate, or polypeptide portion thereof.
(325) Nucleic acid sequence variants that encode the polypeptide portions of the anti-PSMA constructs described herein are also provided. For example, the variants include nucleotide sequences that hybridize to the nucleic acid sequences encoding an anti-PSMA construct or anti-PSMA antibody moiety described herein under at least moderately stringent hybridization conditions.
(326) Also provided are vectors (such as expression vectors) comprising one or more nucleic acids described herein.
(327) An anti-PSMA construct described herein, or polypeptide portion thereof, e.g., an anti-PSMA CAR can be expressed from a natural or synthetic nucleic acid encoding the anti-PSMA construct or polypeptide portion thereof. Briefly, the nucleic acid may be inserted into an appropriate expression vector, such that the nucleic acid is operably linked to 5 and 3 regulatory elements, including for example a promoter (e.g., a lymphocyte-specific promoter) and a 3 untranslated region (UTR). The vectors are preferable suitable for replication and integration in eukaryotic host cells. Typical cloning and expression vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the desired nucleic acid sequence.
(328) The nucleic acids described herein may also be used for nucleic acid immunization and gene therapy, using standard gene delivery protocols. Methods for gene delivery are known in the art. See, e.g., U.S. Pat. Nos. 5,399,346; 5,580,859; and 5,589,466; which are incorporated by reference herein in their entireties. In some embodiments, the provided a gene therapy vector.
(329) The nucleic acids described herein may be cloned into any of a variety of vectors known in the art. For example, the nucleic acid (or set of nucleic acids) can be cloned into, e.g., a plasmid, a phagemid, a phage derivative, an animal virus, and/or a cosmid. Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
(330) In some embodiments, the expression vector comprising a nucleic acid encoding an anti-PSMA construct or anti-PSMA antibody moiety described herein is a viral vector. Viral vector technology is well known in the art and is described, for example, in Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in other virology and molecular biology manuals. Viruses which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses. In general, a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers (see, e.g., WO 01/96584; WO 01/29058; and U.S. Pat. No. 6,326,193).
(331) A number of viral based systems have been developed for gene transfer into mammalian cells. For example, retroviruses provide a convenient platform for gene delivery systems. A selected gene can be inserted into a vector and packaged in retroviral particles using techniques known in the art. The recombinant virus can then be isolated and delivered to cells of the subject either in vivo or ex vivo. A number of retroviral systems are known in the art. In some embodiments, the viral vector is an adenovirus vectors. A number of adenovirus vectors are known in the art. In some embodiments, the viral vector is a lentivirus vector. Vectors derived from retroviruses such as the lentivirus are suitable tools to achieve long-term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells. Lentiviral vectors have the added advantage over vectors derived from onco-retroviruses such as murine leukemia viruses in that they can transduce non-proliferating cells. They also have the added advantage of low immunogenicity.
(332) Additional promoter elements, e.g., enhancers, regulate the frequency of transcriptional initiation. Typically, these are located in the region 30-110 bp upstream of the start site, although a number of promoters have recently been shown to contain functional elements downstream of the start site as well. The spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another. In the thymidine kinase (tk) promoter, the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline.
(333) One example of a suitable promoter is the immediate early cytomegalovirus (CMV) promoter sequence. This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto. Another example of a suitable promoter is Elongation Growth Factor-1? (EF-1?). However, other constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, and the creatine kinase promoter. Further, the expression of anti-PSMA constructs described herein should not be limited to the use of constitutive promoters. Inducible promoters are also contemplated. The use of an inducible promoter provides a molecular switch capable of turning on expression of the polynucleotide sequence which it is operatively linked when such expression is desired, or turning off the expression when expression is not desired. Examples of inducible promoters include, but are not limited to a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.
(334) In order to assess the expression of a polypeptide or portions thereof, the expression vector to be introduced into a cell can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors. In other aspects, the selectable marker may be carried on a separate piece of DNA and used in a co-transfection procedure. Both selectable markers and reporter genes may be flanked with appropriate regulatory sequences to enable expression in the host cells. Exemplary selectable markers include, but are not limited to, e.g., antibiotic-resistance genes, such as neo and the like.
(335) Reporter genes are used for identifying potentially transfected cells and for evaluating the functionality of regulatory sequences. In general, a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a polypeptide whose expression is manifested by some easily detectable property, e.g., enzymatic activity. Expression of the reporter gene is assayed at a suitable time after the DNA has been introduced into the recipient cells. Suitable reporter genes may include genes encoding luciferase, ?-galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene (e.g., Ui-Tel et al., 2000 FEBS Letters 479: 79-82). Suitable expression systems are well known and may be prepared using known techniques or obtained commercially. In general, the construct with the minimal 5 flanking region showing the highest level of expression of reporter gene is identified as the promoter. Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter-driven transcription.
(336) Methods of introducing and expressing genes into a cell are known in the art. In the context of an expression vector, the vector can be readily introduced into a host cell, e.g., mammalian, bacterial, yeast, or insect cell by any method in the art. For example, the expression vector can be transferred into a host cell by physical, chemical, or biological means.
(337) Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York). In some embodiments, the introduction of a polynucleotide into a host cell is carried out by calcium phosphate transfection.
(338) Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors. Viral vectors, and especially retroviral vectors, have become the most widely used method of inserting genes into mammalian, e.g., human cells. Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus 1, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362.
(339) Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle).
(340) Another exemplary delivery vehicle is a liposome. The use of lipid formulations is contemplated for the introduction of the nucleic acids into a host cell (in vitro, ex vivo or in vivo). In another aspect, the nucleic acid may be associated with a lipid. The nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid. Lipid, lipid/DNA or lipid/expression vector associated compositions are not limited to any particular structure in solution. For example, they may be present in a bilayer structure, as micelles, or with a collapsed structure. They may also simply be interspersed in a solution, possibly forming aggregates that are not uniform in size or shape. Lipids are fatty substances which may be naturally occurring or synthetic lipids. For example, lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
(341) Regardless of the method used to introduce exogenous nucleic acids into a host cell, in order to confirm the presence of the recombinant DNA sequence in the host cell, a variety of assays may be performed. Such assays include, for example, molecular biological assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR; biochemical assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the present disclosure.
(342) Anti-PSMA Constructs Comprising Fc Region Variants
(343) In some embodiments, one or more amino acid modifications may be introduced into the Fc region of an anti-PSMA construct provided herein (e.g., a full-length anti-PSMA antibody), thereby generating an Fc region variant. In some embodiments, the Fc region variant has enhanced antibody dependent cellular cytotoxicity (ADCC) effector function, often related to binding to Fc receptors (FcRs). In some embodiments, the Fc region variant has decreased ADCC effector function. There are many examples of changes or mutations to Fc sequences that can alter effector function. For example, WO 00/42072 and Shields et al. J Biol. Chem. 9(2): 6591-6604 (2001) describe antibody variants with improved or diminished binding to FcRs. The contents of those publications are specifically incorporated herein by reference.
(344) Antibody-Dependent Cell-Mediated Cytotoxicity (ADCC) is a mechanism of action of therapeutic antibodies against tumor cells. ADCC is a cell-mediated immune defense whereby an effector cell of the immune system actively lyses a target cell (e.g., a cancer cell), whose membrane-surface antigens have been bound by specific antibodies (e.g., an anti-PSMA antibody). The typical ADCC involves activation of NK cells by antibodies. An NK cell expresses CD16 which is an Fc receptor. This receptor recognizes, and binds to, the Fc portion of an antibody bound to the surface of a target cell. The most common Fc receptor on the surface of an NK cell is called CD16 or Fc?RIII. Binding of the Fc receptor to the Fc region of an antibody results in NK cell activation, release of cytolytic granules and consequent target cell apoptosis. The contribution of ADCC to tumor cell killing can be measured with a specific test that uses NK-92 cells that have been transfected with a high-affinity FcR. Results are compared to wild-type NK-92 cells that do not express the FcR.
(345) In some embodiments, provided is an anti-PSMA construct comprising a variant Fc region that possesses some but not all effector functions, which makes it a desirable candidate for applications in which the half-life of the anti-PSMA construct in vivo is important yet certain effector functions (such as CDC and ADCC) are unnecessary or deleterious. In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities. For example, Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks Fc?R binding (hence likely lacking ADCC activity), but retains FcRn binding ability. The primary cells for mediating ADCC (i.e., NK cells) express Fc?RIII only, whereas monocytes express Fc?RI, Fc?RII and Fc?RIII. FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol. 9:457-492 (1991). Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest is described in U.S. Pat. No. 5,500,362 (see, e.g. Hellstrom, I. et al. Proc. Nat'l Acad. Sci. USA 83:7059-7063 (1986)) and Hellstrom, I et al., Proc. Nat'l Acad. Sci. USA 82:1499-1502 (1985); U.S. Pat. No. 5,821,337 (see Bruggemann, M. et al., J. Exp. Med. 166:1351-1361 (1987)). Alternatively, non-radioactive assay methods may be employed (see, for example, ACTI? non-radioactive cytotoxicity assay for flow cytometry (CellTechnology, Inc. Mountain View, Calif.; and CytoTox 96? non-radioactive cytotoxicity assay (Promega, Madison, Wis.). Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al. Proc. Nat'l Acad. Sci. USA 95:652-656 (1998). C1q binding assays may also be carried out to confirm that the antibody is unable to bind C1q and hence lacks CDC activity. See, e.g., C1q and C3c binding ELISA in WO 2006/029879 and WO 2005/100402. To assess complement activation, a CDC assay may be performed (see, for example, Gazzano-Santoro et al., J Immunol. Methods 202:163 (1996); Cragg, M. S. et al., Blood 101:1045-1052 (2003); and Cragg, M. S. and M. J. Glennie, Blood 103:2738-2743 (2004)). FcRn binding and in vivo clearance/half-life determinations can also be performed using methods known in the art (see, e.g., Petkova, S. B. et al., Int'l. Immunol. 18(12):1759-1769 (2006)).
(346) Antibodies with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Pat. No. 6,737,056). Such Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called DANA Fc mutant with substitution of residues 265 and 297 to alanine (U.S. Pat. No. 7,332,581).
(347) Certain antibody variants with improved or diminished binding to FcRs are described. (See, e.g., U.S. Pat. No. 6,737,056; WO 2004/056312, and Shields et al., J Biol. Chem. 9(2): 6591-6604 (2001).)
(348) In some embodiments, the anti-PSMA construct (e.g., a full-length anti-PSMA antibody) comprises a variant Fc region comprising one or more amino acid substitutions which improve ADCC. In some embodiments, the variant Fc region comprises one or more amino acid substitutions which improve ADCC, wherein the substitutions are at positions 298, 333, and/or 334 of the variant Fc region (EU numbering of residues). In some embodiments, the anti-PSMA construct (e.g., a full-length anti-PSMA antibody) comprises the following amino acid substitutions in its variant Fc region: S298A, E333A, and K334A.
(349) In some embodiments, alterations are made in the Fc region of the anti-PSMA construct (e.g., a full-length anti-PSMA antibody) hat result in altered (i.e., either improved or diminished) C1q binding and/or Complement Dependent Cytotoxicity (CDC), e.g., as described in U.S. Pat. No. 6,194,551, WO 99/51642, and Idusogie et al., J. Immunol. 164: 4178-4184 (2000).
(350) In some embodiments, the anti-PSMA construct (e.g., a full-length anti-PSMA antibody) comprising a variant Fc region comprises one or more amino acid substitutions which increase half-life and/or improve binding to the neonatal Fc receptor (FcRn). Antibodies with increased half-lives and improved binding to FcRn are described in US2005/0014934A1 (Hinton et al.). Such antibodies comprise an Fc region with one or more substitutions therein which improve binding of the Fc region to FcRn. Such Fc variants include those with substitutions at one or more of Fc region residues: 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution of Fc region residue 434 (U.S. Pat. No. 7,371,826).
(351) See also Duncan & Winter, Nature 322:738-40 (1988); U.S. Pat. Nos. 5,648,260; 5,624,821; and WO 94/29351 concerning other examples of Fc region variants.
(352) Anti-PSMA constructs (such as full-length anti-PSMA antibodies) comprising any of the Fc variants described herein, or combinations thereof, are contemplated.
(353) Glycosylation Variants of Anti-PSMA Constructs
(354) In some embodiments, an anti-PSMA construct provided herein is altered to increase or decrease the extent to which the anti-PSMA construct is glycosylated. Addition or deletion of glycosylation sites to an anti-PSMA construct may be conveniently accomplished by altering the amino acid sequence of the anti-PSMA construct or polypeptide portion thereof such that one or more glycosylation sites is created or removed.
(355) Where the anti-PSMA construct comprises an Fc region, the carbohydrate attached thereto may be altered. Native antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 of the C.sub.H2 domain of the Fc region. See, e.g., Wright et al., TIBTECH 15:26-32 (1997). The oligosaccharide may include various carbohydrates, e.g., mannose, N-acetyl glucosamine (GlcNAc), galactose, and sialic acid, as well as a fucose attached to a GlcNAc in the stem of the biantennary oligosaccharide structure. In some embodiments, modifications of the oligosaccharide in an anti-PSMA construct described herein may be made in order to create anti-PSMA construct glycosylation variants with certain improved properties.
(356) In some embodiments, the anti-PSMA construct (such as a full-length anti-PSMA antibody) comprises an Fc region wherein a carbohydrate structure attached to the Fc region has reduced fucose or lacks fucose, which may improve ADCC function. In some embodiments, the anti-PSMA construct (such as full-length anti-PSMA antibody) has reduced fucose relative to the amount of fucose on the same anti-PSMA construct (e.g., the full-length anti-PSMA antibody) produced in a wild-type CHO cell (e.g., a CHO cell that produce a native glycosylation pattern, such as, a CHO cell containing a native FUT8 gene). In some embodiments, the anti-PSMA construct is one wherein less than about 50%, 40%, 30%, 20%, 10%, or 5% of the N-linked glycans thereon comprise fucose. For example, the amount of fucose in such an anti-PSMA construct may be from 1% to 80%, from 1% to 65%, from 5% to 65% or from 20% to 40%. In some embodiments, the anti-PSMA construct is one wherein none of the N-linked glycans thereon comprise fucose, i.e., wherein the anti-PSMA construct is completely without fucose, or has no fucose or is afucosylated. The amount of fucose is determined by calculating the average amount of fucose within the sugar chain at Asn297, relative to the sum of all glycostructures attached to Asn 297 (e.g. complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2008/077546, for example. Asn297 refers to the asparagine residue located at about position 297 in the Fc region (EU numbering of Fc region residues); however, Asn297 may also be located about ?3 amino acids upstream or downstream of position 297, i.e., between positions 294 and 300, due to minor sequence variations in antibodies. Such fucosylation variants may have improved ADCC function. See, e.g., US Patent Publication Nos. US 2003/0157108 (Presta, L.); US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd). Examples of publications related to defucosylated or fucose-deficient antibody variants include: US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/0115614; US 2002/0164328; US 2004/0093621; US 2004/0132140; US 2004/0110704; US 2004/0110282; US 2004/0109865; WO 2003/085119; WO 2003/084570; WO 2005/035586; WO 2005/035778; WO2005/053742; WO2002/031140; Okazaki et al. J. Mol. Biol. 336:1239-1249 (2004); Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004). Examples of cell lines capable of producing defucosylated antibodies include Lec13 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); US Pat Appl No US 2003/0157108 A1, Presta, L; and WO 2004/056312 A1, Adams et al., especially at Example 11), and knockout cell lines, such as ?-1,6-fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g., Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004); Kanda, Y. et al., Biotechnol. Bioeng., 94(4):680-688 (2006); and WO2003/085107).
(357) In some embodiments, the anti-PSMA construct (such as a full-length anti-PSMA antibody) is a glycosylation variant comprising bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to the Fc region of the anti-PSMA construct is bisected by GlcNAc. Such anti-PSMA construct (e.g., a full-length anti-PSMA antibody) glycosylation variants may have reduced fucosylation and/or improved ADCC function. Examples of such antibody variants are described, e.g., in WO 2003/011878 (Jean-Mairet et al.); U.S. Pat. No. 6,602,684 (Umana et al.); US 2005/0123546 (Umana et al.), and Ferrara et al., Biotechnology and Bioengineering, 93(5): 851-861 (2006). In some embodiments, the anti-PSMA construct (such as a full-length anti-PSMA antibody) is a glycosylation variant comprising at least one galactose residue in the oligosaccharide attached to the Fc region. Such anti-PSMA construct glycosylation variants may have improved CDC function. Such glycosylation variants are described, e.g., in WO 1997/30087 (Patel et al.); WO 1998/58964 (Raju, S.); and WO 1999/22764 (Raju, S.).
(358) In some embodiments, the anti-PSMA construct (such as full-length anti-PSMA antibody) glycosylation variant comprises an Fc region capable of binding to an Fc?RIII. In some embodiments, the anti-PSMA construct (such as full-length anti-PSMA antibody) glycosylation variant comprises an Fc region have ADCC activity in the presence of human effector cells or have increased ADCC activity in the presence of human effector cells compared to an anti-PSMA construct (such as a full-length anti-PSMA antibody) comprising a human wild-type IgG1 Fc region.
(359) Cysteine Engineered Variants of Anti-PSMA Constructs
(360) In some embodiments, the anti-PSMA construct (such as a full-length anti-PSMA antibody) has been engineered such that one or more amino acid residues are substituted with cysteine residues. In some embodiments, the substituted residues occur at the surface of and/or at solvent-accessible sites of the anti-PSMA construct. By substituting those residues with cysteine, reactive thiol groups are thereby positioned at accessible sites of the anti-PSMA construct and may be used to conjugate the anti-PSMA construct to other moieties, such as drug moieties or linker-drug moieties, to create anti-PSMA immunoconjugates (which are described in further detail elsewhere herein). Cysteine engineered anti-PSMA constructs (such as full-length anti-PSMA antibodies) may be generated as described, e.g., in U.S. Pat. No. 7,521,541.
(361) Derivatized Anti-PSMA Constructs
(362) In some embodiments, the anti-PSMA construct has been further modified to contain additional nonproteinaceous moieties that are known in the art and readily available. The moieties suitable for derivatization of an anti-PSMA construct of the present disclosure include, but are not limited to, water soluble polymers. Non-limiting examples of water soluble polymers include, without limitation, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1,3-dioxolane, poly-1,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof. Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water. The polymer may be of any molecular weight, and may be branched or unbranched. The number of polymers attached to a derivatized anti-PSMA construct may vary, and if more than one polymer is attached, the polymers can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the anti-PSMA construct to be improved, whether the anti-PSMA construct derivative will be used in a therapy under defined conditions, etc.
(363) In some embodiments, conjugates of an anti-PSMA construct and nonproteinaceous moiety that may be selectively heated by exposure to radiation are provided. In some embodiments, the nonproteinaceous moiety is a carbon nanotube (Kam et al., Proc. Natl. Acad. Sci. USA 102: 11600-11605 (2005)). The radiation may be of any wavelength, and includes, but is not limited to, wavelengths that do not harm ordinary cells, but which heat the nonproteinaceous moiety to a temperature at which cells proximal to the anti-PSMA construct-nonproteinaceous moiety are killed.
(364) Pharmaceutical Compositions
(365) Also provided herein are compositions (such as pharmaceutical compositions, also referred to herein as pharmaceutical formulations or formulations) comprising an anti-PSMA construct or anti-PSMA construct combination described herein. In some embodiments, the composition further comprises a cell (such as an effector cell, e.g., a T cell) associated with the anti-PSMA construct or anti-PSMA construct combination. In some embodiments, the pharmaceutical composition comprises an anti-PSMA construct or anti-PSMA construct combination and a pharmaceutically acceptable carrier. In some embodiments, the pharmaceutical composition further comprises a cell (such as an effector cell, e.g., a T cell) associated with the anti-PSMA construct or anti-PSMA construct combination. In yet other embodiments, the pharmaceutic composition comprises a nucleic acid encoding an anti-PSMA construct or anti-PSMA construct combination.
(366) Suitable formulations of the anti-PSMA constructs or construct combinations are obtained by mixing an anti-PSMA construct or construct combination having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions. Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propylparaben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as olyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as TWEEN?, PLURONICS? or polyethylene glycol (PEG). Exemplary formulations are described in WO98/56418, expressly incorporated herein by reference. Lyophilized formulations adapted for subcutaneous administration are described in WO97/04801. Such lyophilized formulations may be reconstituted with a suitable diluent to a high protein concentration and the reconstituted formulation may be administered subcutaneously to the individual to be treated herein. Lipofectins or liposomes can be used to deliver the anti-PSMA constructs or construct combinations described herein into cells.
(367) In some embodiments, the pharmaceutical composition comprises one or more active compounds in addition to the anti-PSMA construct or construct combination as necessary for the particular indication being treated. Preferably, the active compounds in the pharmaceutical composition do not adversely affect each others' activities. In some embodiments, the one or more active compounds is an anti-neoplastic agent, a growth inhibitory agent, a cytotoxic agent, or a chemotherapeutic agent, i.e., in addition to the anti-PSMA construct or construct combination. Such molecules are suitably present in combination in amounts that are effective for the purpose intended. The effective amount of such other agents depends on the amount of anti-PSMA construct or construct combination present in the formulation, the type of disease or disorder or treatment, and other factors discussed elsewhere herein. These are generally used in the same dosages and with administration routes as described herein or about from 1 to 99% of the heretofore employed dosages.
(368) The anti-PSMA constructs or construct combinations may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions. Such techniques are disclosed in Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980). Sustained-release preparations may be prepared.
(369) Sustained-release preparations of the anti-PSMA constructs or construct combinations can be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody (or fragment thereof), which matrices are in the form of shaped articles, e.g., films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT? (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-(?)-3-hydroxybutyric acid. While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydro gels release proteins for shorter time periods. When encapsulated antibodies remain in the body for a long time, they can denature or aggregate as a result of exposure to moisture at 37? C., resulting in a loss of biological activity and possible changes in immunogenicity. Rational strategies can be devised for stabilization of anti-PSMA constructs or construct combinations depending on the mechanism involved. For example, if the aggregation mechanism is discovered to be intermolecular SS bond formation through thio-disulfide interchange, stabilization can be achieved by modifying sulfhydryl residues, lyophilizing from acidic solutions, controlling moisture content, using appropriate additives, and developing specific polymer matrix compositions.
(370) In some embodiments, the anti-PSMA construct or construct combination is formulated in a buffer comprising a citrate, NaCl, acetate, succinate, glycine, polysorbate 80 (Tween 80), or any combination of the foregoing. In some embodiments, the anti-PSMA construct or construct combination is formulated in a buffer comprising about 100 mM to about 150 mM glycine. In some embodiments, the anti-PSMA construct or construct combination is formulated in a buffer comprising about 50 mM to about 100 mM NaCl. In some embodiments, the anti-PSMA construct or construct combination is formulated in a buffer comprising about 10 mM to about 50 mM acetate. In some embodiments, the anti-PSMA construct is formulated in a buffer comprising about 10 mM to about 50 mM succinate. In some embodiments, the anti-PSMA construct or construct combination is formulated in a buffer comprising about 0.005% to about 0.02% polysorbate 80. In some embodiments, the anti-PSMA construct or construct combination is formulated in a buffer having a pH between about 5.1 and 5.6. In some embodiments, the anti-PSMA construct or construct combination is formulated in a buffer comprising 10 mM citrate, 100 mM NaCl, 100 mM glycine, and 0.010% polysorbate 80, wherein the formulation is at pH 5.5.
(371) The pharmaceutical formulations to be used for in vivo administration must be sterile. This is readily accomplished by, e.g., filtration through sterile filtration membranes.
(372) Methods of Treatment Using Anti-PSMA Constructs
(373) The anti-PSMA constructs, anti-PSMA construct combinations, and/or compositions described herein may be administered to individuals (e.g., mammals such as humans) to treat a PSMA-associated disease or disorder. In some embodiments, the PMSA-associated disease or disorder is characterized by PSMA expression, PSMA overexpression, and/or aberrant PSMA activity. Such diseases or disorders including, for example, PSMA-associated cancer, e.g., prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer.
(374) Thus, provided herein is a method of treating a PSMA-associated disease (such as cancer) in an individual, which method comprises administering to the individual an effective amount of a composition (such as a pharmaceutical composition) comprising an anti-PSMA construct or construct combination described herein. In some embodiments, the composition further comprises a cell (such as an effector cell) associated with the anti-PSMA construct or construct combination (such as an effector cell that expresses an anti-PSMA construct or construct combination described herein). In some embodiments, the cancer is, for example, prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer. In some embodiments, the individual is human.
(375) In some embodiments, the anti-PSMA construct or construct combination used in the method is non-naturally occurring. In some embodiments, the anti-PSMA construct used in the method is a full-length antibody, a multispecific (such as bispecific) anti-PSMA construct, an anti-PSMA chimeric antigen receptor (CAR), an anti-PSMA chimeric antibody-T cell receptor construct (caTCR), an anti-PSMA chimeric signaling receptors (CSRs), an anti-PSMA immunoconjugate, or any other anti-PSMA construct described in further detail elsewhere herein. In some embodiments, a construct combination comprising anti-PSMA caTCR and an anti-PSMA CSR (e.g., an anti-PSMA caTCR+anti-PSMA CSR construct combination described elsewhere herein) is used in the method. Each of the constructs or construct combinations described herein demonstrates high specificity for human PSMA in native form (e.g., expressed on the surface of a cell, such as a cancer cell). In some embodiments, the pharmaceutical composition used in the method further comprises a cell (such as an effector cell) that expresses or is associated with the anti-PSMA construct or construct combination. In some embodiments, the PSMA-associated disease is cancer. In some embodiments, the cancer is, for example, prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer. In some embodiments, the individual is human.
(376) In some embodiments of any of the methods for treating a PSMA-associated disease described herein, the anti-PSMA construct or construct combination is conjugated to a cell (such as an immune cell, e.g., a T cell) prior to being administered to the individual. Thus, provided is a method of treating a PSMA-associated disease in an individual comprising a) conjugating any one of the anti-PSMA constructs or construct combinations described herein to a cell (such as an immune cell, e.g., a T cell) to form an anti-PSMA construct/cell conjugate, and b) administering an effective amount of a composition comprising the anti-PSMA construct/cell conjugate to the individual. In some embodiments, the cell to which the anti-PSMA construct or construct combination is conjugated is derived from the individual being treated. In some embodiments, the cell to which the anti-PSMA construct or construct combination is conjugated is not derived from the individual being treated. In some embodiments, the anti-PSMA construct or construct combination is conjugated to the cell by covalent linkage to a molecule on the surface of the cell. In some embodiments, the anti-PSMA construct or construct combination is conjugated to the cell by non-covalent linkage to a molecule on the surface of the cell. In some embodiments, the anti-PSMA construct or construct combination is conjugated to the cell by insertion of a portion of the anti-PSMA construct or construct combination into the outer membrane of the cell. In some embodiments, the anti-PSMA construct or construct combination is non-naturally occurring. In some embodiments, the anti-PSMA construct used in the method is a full-length antibody, a multispecific (such as bispecific) anti-PSMA construct (such as a tandem di-scFv), an anti-PSMA immunoconjugate, or any other anti-PSMA construct described in further detail elsewhere herein. In some embodiments, a construct combination comprising anti-PSMA caTCR and an anti-PSMA CSR (e.g., an anti-PSMA caTCR+anti-PSMA CSR construct combination described elsewhere herein) is used in the method. In some embodiments, the PSMA-associated disease is cancer. In some embodiments, the cancer is, for example, prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer. In some embodiments, the individual is human.
(377) In some embodiments of any of the methods for treating a PSMA-associated disease described herein, treatment comprises administering to a recipient in need a cell (e.g., a T cell, such as an ?? T cell, a ?? T cell, a cytotoxic T cell, a helper T cell, or a natural killer T cell) that has been genetically modified (i.e., transduced or transfected, such as in vitro) with a nucleic acid, a set of nucleic acids, a vector, or a set of vectors encoding an anti-PSMA CAR, anti-PSMA caTCR, anti-PSMA tandem multispecific scFv (such as a tandem di-scFv), or anti-PSMA CSR disclosed herein, or an anti-PSMA caTCR+anti-PSMA CSR construct combination disclosed herein. In some embodiments, the genetically modified cell (e.g., a T cell, such as an ?? T cell, a ?? T cell, a cytotoxic T cell, a helper T cell, a natural killer T cell, and a suppressor T cell) expresses the anti-PSMA CAR, anti-PSMA caTCR, anti-PSMA tandem multispecific scFv (such as a tandem di-scFv), anti-PSMA CSR, or an anti-PSMA caTCR+anti-PSMA CSR construct combination encoded by the nucleic acid, set of nucleic acids, vector, or set of vectors. In some embodiments, the recipient is a mammal, such as a human, e.g., a human who has or is suspected of having the PSMA-associated disease).
(378) In some embodiments of the methods for treating a PSMA-associated disease, treatment further comprises the step of genetically modifying (i.e., transducing or transfecting, such as in vitro) the cell (e.g., a T cell, such as an ?? T cell, a ?? T cell, a cytotoxic T cell, a helper T cell, or a natural killer T cell) with the nucleic acid, the set of nucleic acids, the vector, or the set of vectors encoding the anti-PSMA CAR, the anti-PSMA caTCR, anti-PSMA tandem multispecific scFv (such as a tandem di-scFv), or anti-PSMA CSR prior to administration to the recipient. In some embodiments, the cell (e.g., a T cell, such as an ?? T cell, a ?? T cell, a cytotoxic T cell, a helper T cell, or a natural killer T cell) has been genetically modified (i.e., transduced or transfected, such as in vitro) with the nucleic acid, the set of nucleic acids, the vector, or the set of vectors encoding anti-PSMA CAR or anti-PSMA caTCR, and is further genetically modified (i.e., transduced or transfected, such as in vitro) with a nucleic acid, a set of nucleic acids, a vector, or a set of vectors encoding a multispecific scFv (such as a tandem di-scFv) or a CSR. In some embodiments, the multispecific scFv (e.g., a tandem di-scFv) targets PSMA. In some embodiments, the multispecific scFv (e.g., a tandem di-scFv) targets a different antigen (e.g., an antigen other than PSMA). In some embodiments, the CSR targets PSMA. In some embodiments, the CSR targets a different antigen (e.g., an antigen other than PSMA). In some embodiments, the cell (e.g., a T cell, such as an ?? T cell, a ?? T cell, a cytotoxic T cell, a helper T cell, or a natural killer T cell) has been genetically modified (i.e., transduced or transfected, such as in vitro) with the nucleic acid, the set of nucleic acids, the vector, or the set of vectors encoding the anti-PSMA tandem multispecific scFv (such as a tandem di-scFv) or the anti-PSMA CSR, and is further genetically modified (i.e., transduced or transfected, such as in vitro) with a nucleic acid, a set of nucleic acids, a vector, or a set of vectors encoding a CAR or caTCR. In some embodiments, the CAR targets PSMA. In some embodiments, the CAR targets a different antigen (e.g., an antigen other than PSMA). In some embodiments, the caTCR targets PSMA. In some embodiments, the caTCR targets a different antigen (e.g., an antigen other than PSMA). In some embodiments, the construct combination comprises an anti-PSMA caTCR and anti-PSMA CSR (e.g., an anti-PSMA caTCR+anti-PSMA CSR construct combination described elsewhere herein).
(379) In some embodiments of the methods for treating a PSMA-associated disease, treatment further comprises the step of obtaining (such as isolating) cells (e.g., T cells, such as ?? T cells, a ?? T cells, cytotoxic T cells, helper T cells, or natural killer T cells) from an individual (e.g., a mammal, such as a human, e.g., a human who has or is suspected of having the PSMA-associated disease) prior to the step of genetically modifying (i.e., transducing or transfecting, such as in vitro) the cells with a nucleic acid, a set of nucleic acids, a vector, or a set of vectors encoding the anti-PSMA CAR, the anti-PSMA caTCR, anti-PSMA tandem multispecific scFv (such as a tandem di-scFv), anti-PSMA CSR, or anti-PSMA caTCR+anti-PSMA CSR construct combination, e.g., as described above. In some embodiments, the recipient to whom the genetically modified cells are administered is the individual from whom the cells were obtained. Such a genetically modified immune cell is referred to as an autologous anti-PSMA effector cell. In some embodiments, the recipient to whom the genetically modified cells are administered is not the individual from whom the cells were obtained. Such a genetically modified immune cell is referred to as a heterologous anti-PSMA effector cell. In some embodiments, the heterologous anti-PSMA cell is allogeneic, syngeneic, or xenogeneic with respect to the recipient.
(380) In some embodiments, the individual is a mammal (e.g., a human, a non-human primate (such as a rhesus monkey or a cynomolgus monkey), a rat, a mouse, a cow, a horse, a pig, a sheep, a goat, a dog, a cat, etc.). In some embodiments, the individual is a human. In some embodiments, the individual is a clinical patient, a clinical trial volunteer, an experimental animal, etc. In some embodiments, the individual is younger than about 60 years old (including for example younger than about any of 50, 40, 30, 25, 20, 15, or 10 years old). In some embodiments, the individual is older than about 60 years old (including for example older than about any one of 70, 75, 80, 85, 90, 95, 100, or more than 100 years old). In some embodiments, the individual is diagnosed with or genetically prone to one or more of the PSMA-associated diseases or disorders described herein (e.g., prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer). In some embodiments, the individual has one or more risk factors associated with one or more PSMA-associated diseases or disorders described herein.
(381) Also provided is a method of delivering an anti-PSMA construct (such as any one of the anti-PSMA constructs described herein) or an anti-PSMA construct combination (such as any one of the anti-PSMA construct combinations described herein) to a cell expressing PSMA (such as cell surface-bound PSMA), the method comprising administering to the individual a composition comprising the anti-PSMA construct or construct combination. In some embodiments, the anti-PSMA construct or construct combination to be delivered is associated with a cell (such as an effector cell, e.g., a T cell).
(382) Many diagnostic methods for PSMA-associated cancer e.g., prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer) or any other PSMA-associated disease, e.g., a disease exhibiting PSMA expression and the clinical delineation of those diseases are known in the art. Such methods include, but are not limited to, e.g., immunohistochemistry, PCR, and fluorescent in situ hybridization (FISH).
(383) In some embodiments, the anti-PSMA constructs, anti-PSMA construct combinations, and/or compositions of the present disclosure are administered in combination with a second, third, or fourth agent (including, e.g., an antineoplastic agent, a growth inhibitory agent, a cytotoxic agent, or a chemotherapeutic agent) to treat PSMA-associated diseases or disorders, e.g., diseases involving PSMA expression. In some embodiments, the anti-PSMA construct or construct combination is administered in combination with an agent that increases the expression PSMA on diseased cells (such as cancer cells). In some embodiments, the agent is a chemotherapeutic agent including, for example, topotecan, etoposide, cisplatin, paclitaxel, and vinblastine.
(384) The efficacy of cancer treatments can be evaluated, for example, by a variety of well-known methods including, without limitation, e.g., tumor regression, tumor weight or size shrinkage, time to progression, duration of survival, progression free survival, overall response rate, duration of response, quality of life, PSMA protein expression and/or PSMA activity. Approaches to determining efficacy of the therapy can be employed, including for example, measurement of response through radiological imaging.
(385) In some embodiments, the efficacy of a method of treatment is measured as the percentage tumor growth inhibition (% TGI), calculated using the equation 100?(T/C?100), where T is the mean relative tumor volume of the treated tumor, and C is the mean relative tumor volume of a non-treated tumor. In some embodiments, the % TGI is about any one of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, or more than 95% (e.g., up to 100%), including any range in between these values.
(386) Dosing and Administration of Anti-PSMA Constructs
(387) The dose of a pharmaceutical composition comprising an anti-PSMA construct or construct combination described herein that is administered to an individual (such as a human) may vary with the particular composition, the mode of administration, and the type of disease being treated. In some embodiments, the amount of the pharmaceutical composition is effective to result in an objective response (e.g., in the case of solid tumor, a partial response (PR) or a complete response (CR), e.g., according to RECIST criteria described in Eisenhauer et al. (2009) European Journal of Cancer, 45 (2): 228-247 or Therasse et al. (2000) J. Nat'l. Cancer Inst. 92(3): 205-216). In some embodiments, the amount a composition comprising the anti-PSMA construct (or construct combination) administered to an individual in need thereof (for example when administered as a single agent) is sufficient to produce an overall response rate of more than about any one of 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 64%, 65%, 70%, 75%, 80%, 85%, or 90% among a population of individuals treated with a pharmaceutical composition comprising an anti-PSMA construct (or construct combination) described herein. Responses of an individual to the treatment of the methods described herein can be determined, for example, based on RECIST levels.
(388) In some embodiments, the amount of the pharmaceutical composition administered to an individual in need thereof is sufficient to prolong progression-free survival of the individual. In some embodiments, the amount of the composition administered to an individual in need thereof is sufficient to prolong overall survival of the individual. In some embodiments, the amount of the composition administered to an individual in need thereof is sufficient to produce clinical benefit rate of more than about any of 50%, 60%, 70%, or 77% among a population of individuals treated with the anti-PSMA construct composition.
(389) In some embodiments, the amount of the composition administered to an individual in need thereof (e.g., as a single agent or in combination with a second, third, and/or fourth agent), is sufficient to decrease the size of a tumor, decrease the number of cancer cells, or decrease the growth rate of a tumor by at least about any of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 100% (including any range in between these values), as compared to the corresponding tumor size, number of cancer cells, or tumor growth rate in the same subject prior to treatment, or as compared to the corresponding activity in other subjects not receiving the treatment. Standard methods can be used to measure the magnitude of this effect, such as in vitro assays with purified enzyme, cell-based assays, animal models, or human testing.
(390) In some embodiments, the amount of the anti-PSMA construct (e.g., full-length anti-PSMA antibody, multispecific anti-PSMA construct, an anti-PSMA CAR, an anti-PSMA chimeric antibody-T cell receptor construct (caTCR), an anti-PSMA chimeric signaling receptors (CSRs), an anti-PSMA immunoconjugate, or any other anti-PSMA construct or construct combination described in further detail elsewhere herein) in the pharmaceutical composition is below the level that induces a toxicological effect. In some embodiments, the amount of the anti-PSMA construct (e.g., full-length anti-PSMA antibody, multispecific anti-PSMA construct, an anti-PSMA CAR, an anti-PSMA chimeric antibody-T cell receptor construct (caTCR), an anti-PSMA chimeric signaling receptors (CSRs), an anti-PSMA immunoconjugate, or any other anti-PSMA construct or construct combination described in further detail elsewhere herein) in the pharmaceutical composition is at a level where a potential side effect can be controlled or tolerated when the composition is administered to the individual.
(391) In some embodiments, the amount of the pharmaceutical composition administered to an individual in need thereof is close to a maximum tolerated dose (MTD) of the composition following the same dosing regimen. In some embodiments, the amount of the composition is more than about any of 80%, 90%, 95%, or 98% of the MTD.
(392) In some embodiments, the amount of an anti-PSMA construct (e.g., full-length anti-PSMA antibody, multispecific anti-PSMA construct, an anti-PSMA CAR, an anti-PSMA chimeric antibody-T cell receptor construct (caTCR), an anti-PSMA chimeric signaling receptors (CSRs), an anti-PSMA immunoconjugate, or any other anti-PSMA construct or construct combination described in further detail elsewhere herein) in the pharmaceutical composition is included in a range of about 0.001 ?g to about 1000 ?g.
(393) In some embodiments, the effective amount of an anti-PSMA construct (e.g., full-length anti-PSMA antibody, multispecific anti-PSMA construct, an anti-PSMA immunoconjugate, or any other anti-PSMA construct or construct combination described in further detail elsewhere herein) in the composition is in the range of about 0.1 ?g/kg to about 100 mg/kg of total body weight.
(394) A pharmaceutical compositions comprising an anti-PSMA construct or construct combination described herein may be administered to an individual (such as human) via any known available route, including, for example, intravenous, intraportal, intra-arterial, intraperitoneal, intrahepatic, hepatic arterial infusion, intrapulmonary, oral, inhalation, intravesicular, intramuscular, intra-tracheal, subcutaneous, intraocular, intrathecal, transmucosal, and transdermal. In some embodiments, a sustained continuous release formulation of a pharmaceutical composition comprising an anti-PSMA construct described herein can be used.
(395) Anti-PSMA Effector Cell Therapy
(396) In some embodiments, a method of treating a PSMA-associated disease or disorder comprises using an anti-PSMA effector cell (e.g., an anti-PSMA CAR effector cell, an anti-PSMA caTCR effector cell, an anti-PSMA caTCR plus tandem di-scFv effector cell, and/or an anti-PSMA caTCR plus CSR effector cell) to redirect the specificity of an effector cell (such as a primary T cell) to PSMA (e.g., PSMA expressed on or associated with the surface of a cell, such as a cancer cell). Thus, provided herein is a method of stimulating an effector cell-mediated response (such as a T cell-mediated immune response) to a target cell population and/or tissue (e.g., a target cell population and/or tissue comprising PSMA-expressing cells) in an individual, which method comprises the step of administering an anti-PSMA effector cell (such as a T cell) described herein to the individual.
(397) Anti-PSMA effector cells (such as T cells), such as those described in further detail elsewhere herein, can be infused to an individual in need thereof (e.g., an individual who has or is suspected of having a PSMA-associated disease or disorder, such as cancer). The infused anti-PSMA effector cell is able to kill PSMA-expressing cells in the individual. Unlike therapeutic antibodies, anti-PSMA effector cells (such as T cells) are able to replicate in vivo, resulting in long-term persistence that can lead to sustained tumor control. In some embodiments, anti-PSMA effector cells (such as T cells) develop into specific memory T cells that can be reactivated to inhibit any additional tumor formation or growth.
(398) The anti-PSMA effector cells (such as T cells) described herein may also serve as a type of vaccine for ex vivo immunization and/or in vivo therapy in an individual. In some embodiments, the individual is a mammal. In some embodiments, the mammal is a human or a non-human primate (such as a rhesus monkey or a cynomolgus monkey).
(399) With respect to ex vivo immunization, of least one of the following occurs in vitro prior to administering the cell into the individual: i) expansion of the cells, ii) introducing a nucleic acid encoding an anti-PSMA CAR or an anti-PSMA caTCR to the cells, and/or iii) cryopreservation of the cells.
(400) Ex vivo procedures are well known in the art and are discussed more fully below. Briefly, cells (e.g., T cells, such as ?? T cells, a ?? T cells, cytotoxic T cells, helper T cells, or natural killer T cells) are isolated from an individual (e.g., a mammal, preferably a human) and genetically modified (i.e., transduced or transfected, such as in vitro) with a nucleic acid, a set of nucleic acids, a vector, or a set of vectors encoding an anti-PSMA CAR, anti-PSMA caTCR, anti-PSMA tandem multispecific scFv (such as an anti-PSMA tandem di-scFv), and/or anti-PSMA CSR disclosed herein.
(401) In some embodiments, the cell (e.g., a T cell, such as an ?? T cell, a ?? T cell, a cytotoxic T cell, a helper T cell, or a natural killer T cell) has been genetically modified (i.e., transduced or transfected, such as in vitro) with the nucleic acid, the set of nucleic acids, the vector, or the set of vectors encoding anti-PSMA CAR or anti-PSMA caTCR, and is further genetically modified (i.e., transduced or transfected, such as in vitro) with a nucleic acid, a set of nucleic acids, a vector, or a set of vectors encoding a multispecific scFv (such as a tandem di-scFv) or a CSR. In some embodiments, the cell (e.g., a T cell, such as an ?? T cell, a ?? T cell, a cytotoxic T cell, a helper T cell, or a natural killer T cell) been genetically modified (i.e., transduced or transfected, such as in vitro) with a nucleic acid, a set of nucleic acids, a vector, or a set of vectors that encode an anti-PSMA CAR or anti-PSMA caTCR and a multispecific scFv (such as a tandem di-scFv). In some embodiments, the cell (e.g., a T cell, such as an ?? T cell, a ?? T cell, a cytotoxic T cell, a helper T cell, or a natural killer T cell) been genetically modified (i.e., transduced or transfected, such as in vitro) with a nucleic acid, a set of nucleic acids, a vector, or a set of vectors that encode an anti-PSMA CAR or anti-PSMA caTCR and a CSR. In some embodiments, the multispecific scFv (e.g., a tandem di-scFv) targets PSMA. In some embodiments, the multispecific scFv (e.g., a tandem di-scFv) targets a different antigen (e.g., an antigen other than PSMA). In some embodiments, the CSR targets PSMA. In some embodiments, the CSR targets a different antigen (e.g., an antigen other than PSMA).
(402) In some embodiments, the cell (e.g., a T cell, such as an ?? T cell, a ?? T cell, a cytotoxic T cell, a helper T cell, or a natural killer T cell) has been genetically modified (i.e., transduced or transfected, such as in vitro) with the nucleic acid, the set of nucleic acids, the vector, or the set of vectors encoding the anti-PSMA tandem multispecific scFv (such as a tandem di-scFv) or the anti-PSMA CSR, and is further genetically modified (i.e., transduced or transfected, such as in vitro) with a nucleic acid, a set of nucleic acids, a vector, or a set of vectors encoding a CAR or caTCR. In some embodiments, the cell (e.g., a T cell, such as an ?? T cell, a ?? T cell, a cytotoxic T cell, a helper T cell, or a natural killer T cell) been genetically modified (i.e., transduced or transfected, such as in vitro) with a nucleic acid, a set of nucleic acids, a vector, or a set of vectors that encode an anti-PSMA tandem multispecific scFv (such as a tandem di-scFv) or anti-PSMA CSR and a CAR. In some embodiments, the cell (e.g., a T cell, such as an ?? T cell, a ?? T cell, a cytotoxic T cell, a helper T cell, or a natural killer T cell) been genetically modified (i.e., transduced or transfected, such as in vitro) with a nucleic acid, a set of nucleic acids, a vector, or a set of vectors that encode an anti-PSMA tandem multispecific scFv (such as a tandem di-scFv) or anti-PSMA CSR and a caTCR. In some embodiments, the CAR targets PSMA. In some embodiments, the CAR targets a different antigen (e.g., an antigen other than PSMA). In some embodiments, the caTCR targets PSMA. In some embodiments, the caTCR targets a different antigen (e.g., an antigen other than PSMA).
(403) In some embodiments, the cells (e.g., T cells, such as ?? T cells, ?? T cells, cytotoxic T cells, helper T cells, or natural killer T cells) that have been genetically modified (i.e., transduced or transfected, such as in vitro) as described above are administered to a recipient. In some embodiments, the recipient is a mammal, such as a human, e.g., a human who has or is suspected of having the PSMA-associated disease. In some embodiments, the recipient to whom the genetically modified cells are administered is the individual from whom the cells were obtained. Such a genetically modified immune cell is referred to as an autologous anti-PSMA effector cell. In some embodiments, the recipient to whom the genetically modified immune cells are administered is not the individual from whom the cells were obtained. Such a genetically modified immune cell is referred to as a heterologous anti-PSMA effector cell. In some embodiments, the heterologous anti-PSMA effector cell is allogeneic, syngeneic, or xenogeneic with respect to the recipient.
(404) The procedure for ex vivo expansion of hematopoietic stem and progenitor cells is described in U.S. Pat. No. 5,199,942, incorporated herein by reference in its entirety. Other suitable methods are also known in the art, and the present disclosure is not limited to any particular method of ex vivo expansion of the cells. Briefly, ex vivo culture and expansion of T cells comprises: (1) collecting CD34.sup.+ hematopoietic stem and progenitor cells from an individual (e.g., a mammal such as a human) from peripheral blood harvest or bone marrow explants; and (2) expanding such cells ex vivo. In addition to the cellular growth factors described in U.S. Pat. No. 5,199,942, other factors such as flt3-L, IL-1, IL-3 and c-kit ligand, can be used for culturing and expansion of the cells.
(405) In addition to using a cell-based vaccine in terms of ex vivo immunization, the present disclosure also provides compositions and methods for in vivo immunization to elicit an immune response directed against an antigen in an individual in need thereof (e.g., an individual who has or is suspected of having a PSMA-associated disease, such as cancer).
(406) The anti-PSMA effector cells (such as T cells) of the present disclosure may be administered either alone, or as a pharmaceutical composition in combination with diluents and/or with other components such as IL-2 or other cytokines or cell populations. Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives. In some embodiments, effector cell (such as T cell) compositions are formulated for intravenous administration.
(407) The precise amount of the anti-PSMA effector cell (such as T cell) of the present disclosure to be administered to an individual in need thereof can be determined by a physician with consideration of the individual's age, weight, tumor size, stage and/or severity of the disease, presence or absence of metastasis, condition of the individual, and other factors. In some embodiments, a pharmaceutical composition comprising anti-PSMA effector cells (such as T cells) of the present disclosure is administered at a dosage of about 10.sup.4 to about 10.sup.9 cells/kg body weight, such any of about 10.sup.4 to about 10.sup.5, about 10.sup.5 to about 10.sup.6, about 10.sup.6 to about 10.sup.7, about 10.sup.7 to about 10.sup.8, or about 10.sup.8 to about 10.sup.9 cells/kg body weight, including all integer values within those ranges. Anti-PSMA effector cell (such as T cell) compositions may also be administered multiple times at these dosages. The cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. of Med. 319:1676, 1988). The optimal dosage and treatment regimen for a particular patient can readily be determined by one skilled in the art of medicine by monitoring the patient for signs of disease and adjusting the treatment accordingly.
(408) In some embodiments, it may be desirable to administer activated anti-PSMA effector cells (such as T cells) described herein to an individual, subsequently redraw blood (or have an apheresis performed), activate the anti-PSMA effector cells (e.g., anti-PSMA T cells) described herein obtained from the redrawn blood, and reinfuse the individual with the activated and expanded anti-PSMA effector cells (e.g., anti-PSMA T cells). In some embodiments, this process is carried out multiple times every few weeks. In some embodiments, the anti-PSMA effector cells (e.g., anti-PSMA T cells) are activated from blood draws of from 10 cc to 400 cc. In some embodiments, the anti-PSMA effector cells (e.g., anti-PSMA T cells) are activated from blood draws of 20 cc, 30 cc, 40 cc, 50 cc, 60 cc, 70 cc, 80 cc, 90 cc, or 100 cc.
(409) The administration anti-PSMA effector cells (e.g., anti-PSMA T cells) described herein may be carried out in any convenient manner, including by aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation. Compositions comprising anti-PSMA effector cells (e.g., anti-PSMA T cells) described herein may be administered to a patient subcutaneously, intradermally, subcutaneously, intratumorally, intranodally, intramedullary, intramuscularly, by intravenous (i.v.) injection, or intraperitoneally. In some embodiments, compositions comprising anti-PSMA effector cells (e.g., anti-PSMA T cells) of the present disclosure are administered by i.v. injection directly into a tumor, lymph node, or site of disease.
(410) Provided are methods of treating a PSMA-associated disease in an individual that comprise administering to the individual an effective amount of a composition comprising an anti-PSMA effector cell (e.g., anti-PSMA T cell) of the present disclosure. In some embodiments, the PSMA-associated disease is cancer. In some embodiments, the cancer is, for example, prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer. In some embodiments, the individual is human. In some embodiments, the individual to whom the composition comprising an anti-PSMA effector cell (e.g., anti-PSMA T cell) is administered is an individual who has (e.g., has been diagnosed with) or is suspected of having a PSMA-associated disease. In some embodiments, the PSMA-associated disease is refractory to at least one conventional treatment. In some embodiments, the individual to whom the composition comprising an anti-PSMA effector cell (e.g., anti-PSMA T cell) is administered is an individual who has (e.g., has been diagnosed with) a PSMA-associated disease and has relapsed following at least one conventional treatment for the PSMA-associated diseases.
(411) Cancers
(412) The anti-PSMA constructs and effector cells described herein may be used in the treatment of cancer, e.g., a PSMA-associated cancer. Cancers that may be treated using any of the methods described herein include tumors that are not vascularized, or not yet substantially vascularized, as well as vascularized tumors. The cancers may comprise non-solid tumors (such as hematological tumors, for example, leukemias and lymphomas) or may comprise solid tumors. Types of cancers to be treated with the anti-PSMA constructs and effector cells described herein include, but are not limited to, carcinomas, blastomas, and sarcomas, and leukemias or lymphoid malignancies, benign and malignant tumors, and malignancies e.g., melanomas. Adult tumors/cancers and pediatric tumors/cancers are also contemplated.
(413) Hematologic cancers are cancers of the blood or bone marrow. Examples of hematological (or hematogenous) cancers include leukemias, e.g., acute leukemias (such as acute lymphocytic leukemia, acute myelocytic leukemia, acute myelogenous leukemia and myeloblastic, promyelocytic, myelomonocytic, monocytic and erythroleukemia), chronic leukemias (such as chronic myelocytic (granulocytic) leukemia, chronic myelogenous leukemia, and chronic lymphocytic leukemia), polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma (indolent and high grade forms), multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia and myelodysplasia.
(414) Solid tumors are abnormal masses of tissue that usually do not contain cysts or liquid areas. Solid tumors can be benign or malignant. Different types of solid tumors are named for the type of cells that form them (such as sarcomas, carcinomas, and lymphomas). Examples of solid tumors, such as sarcomas and carcinomas, include fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteosarcoma, and other sarcomas, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, lymphoid malignancy, liver cancer, pancreatic cancer, uterine cancer, breast cancer, lung cancers, ovarian cancer, prostate cancer, hepatocellular carcinoma, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, medullary thyroid carcinoma, papillary thyroid carcinoma, pheochromocytomas sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, Wilms' tumor, cervical cancer (e.g., cervical carcinoma and pre-invasive cervical dysplasia), cancer of the anus, anal canal, or anorectum, vaginal cancer, cancer of the vulva (e.g., squamous cell carcinoma, intraepithelial carcinoma, adenocarcinoma, and fibrosarcoma), penile cancer, oropharyngeal cancer, head cancers (e.g., squamous cell carcinoma), neck cancers (e.g., squamous cell carcinoma), testicular cancer (e.g., seminoma, teratoma, embryonal carcinoma, teratocarcinoma, choriocarcinoma, sarcoma, Leydig cell tumor, fibroma, fibroadenoma, adenomatoid tumors, and lipoma), bladder carcinoma, melanoma, cancer of the uterus (e.g., endometrial carcinoma), urothelial cancers (e.g., squamous cell carcinoma, transitional cell carcinoma, adenocarcinoma, ureter cancer, and urinary bladder cancer), and CNS tumors (such as a glioma (such as brainstem glioma and mixed gliomas), glioblastoma (also known as glioblastoma multiforme) astrocytoma, CNS lymphoma, germinoma, medulloblastoma, Schwannoma craniopharyogioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, menangioma, neuroblastoma, retinoblastoma and brain metastases).
(415) In some embodiments, the PSMA-overexpression cancer is prostate cancer. In some embodiments, the prostate cancer is an adenocarcinoma. In some embodiments, the prostate cancer is a sarcoma, neuroendocrine tumor, small cell cancer, ductal cancer, or a lymphoma. In some embodiments, the prostate cancer is at any of the four stages, A, B, C, or D, according to the Whitmore-Jewett staging system, the TNM (i.e., Tumors, Nodes, Metastasis) staging system, or the AUA (Modified Whitmore-Jewett) staging system. In some embodiments, the prostate cancer is stage A prostate cancer (e.g., the cancer cannot be felt during a rectal exam). In some embodiments, the prostate cancer is stage B prostate cancer (e.g., the tumor involves more tissue within the prostate, and can be felt during a rectal exam, or is found with a biopsy that is done because of a high PSA level). In some embodiments, the prostate cancer is stage C prostate cancer (e.g., the cancer has spread outside the prostate to nearby tissues). In some embodiments, the prostate cancer is stage D prostate cancer. In some embodiments, the prostate cancer is androgen independent prostate cancer (AIPC). In some embodiments, the prostate cancer is androgen dependent prostate cancer. In some embodiments, the prostate cancer is refractory to hormone therapy.
(416) Cancer treatments can be evaluated, for example, by tumor regression, tumor weight or size shrinkage, time to progression, duration of survival, progression free survival, overall response rate, duration of response, quality of life, protein expression and/or activity. Approaches to determining efficacy of the therapy can be employed, including for example, measurement of response through radiological imaging.
(417) Methods for Diagnosis and Imaging
(418) Labeled anti-PSMA constructs described herein (e.g., constructs that specifically bind to PSMA expressed on the surface of a cell, such as a cancer cell) may be used for diagnostic purposes to, e.g., detect, diagnose, monitor the progression of a PSMA-associated disease or disorder, e.g., a disease or disorder associated with the expression, aberrant expression and/or activity of PSMA, and/or monitor a patients response to treatment for a PSMA-associated disease. Exemplary PSMA-associated diseases or disorders include any of the diseases and disorders described herein, such as cancer (e.g., prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer). For example, the anti-PSMA constructs described herein can be used in in situ, in vivo, ex vivo, and in vitro diagnostic assays or imaging assays.
(419) In some embodiments, provided are methods of diagnosing a disease or disorder associated with expression or aberrant expression of PSMA in an individual (e.g., a mammal, such as a human or a non-human primate, such as a rhesus monkey or a cynomolgus monkey). The methods comprise detecting cells that aberrantly express PSMA in the individual. In some embodiments, provided is a method of diagnosing a PSMA-associated disease or disorder in an individual (e.g., a mammal, such as a human or a non-human primate, such as a rhesus monkey or a cynomolgus monkey) comprising (a) administering an effective amount of a labeled anti-PSMA construct described herein to the individual; and (b) determining the level of the label in the individual, such that a level of the label above a threshold level indicates that the individual has the disease or disorder. The threshold level can be determined by various methods, including, for example, by detecting the label according to the method of diagnosing described herein in a first set of individuals that have the disease or disorder and a second set of individuals that do not have the disease or disorder, and setting the threshold to a level that allows for discrimination between the first and second sets. In some embodiments, the threshold level is zero, and the method comprises determining the presence or absence of the label in the individual. In some embodiments, the method further comprises waiting for a time interval following the administering of step (a) to permit the labeled anti-PSMA construct to preferentially concentrate at sites in the individual where the PSMA is expressed (and for unbound labeled anti-PSMA construct to be cleared). In some embodiments, the method further comprises subtracting a background level of the label. Background level can be determined by various methods, including, for example, by detecting the label in the individual prior to administration of the labeled anti-PSMA construct, or by detecting the label according to the method of diagnosing described herein in an individual that does not have the disease or disorder. In some embodiments, the disease or disorder is cancer. In some embodiments, the cancer is selected, for example, from the group consisting of prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer. In some embodiments, the individual is human. In some embodiments, the individual is suspected of having a disease or disorder associated with expression, aberrant expression and/or activity of PSMA.
(420) In some embodiments, provided is a method of diagnosing a PSMA-associated disease or disorder in an individual (e.g., a mammal, such as a human or a non-human primate, such as a rhesus monkey or a cynomolgus monkey), comprising (a) contacting a labeled anti-PSMA construct according to any of the embodiments described herein with a sample (such as homogenized tissue) obtained or derived from the individual; and (b) determining the number of cells bound with the labeled anti-PSMA construct in the sample, such that a value for the number of cells bound with the labeled anti-PSMA construct above a threshold level indicates that the individual has the disease or disorder. The threshold level can be determined by various methods, including, for example, by determining the number of cells bound with the labeled anti-PSMA construct according to the method of diagnosing described herein in a first set of individuals that have the disease or disorder and a second set of individuals that do not have the disease or disorder, and setting the threshold to a level that allows for discrimination between the first and second sets. In some embodiments, the threshold level is zero, and the method comprises determining the presence or absence of cells bound with the labeled anti-PSMA construct in the sample. In some embodiments, the method further comprises subtracting a background level of the number of cells bound with the labeled anti-PSMA construct. Background level can be determined by various methods, including, for example, by determining the number of cells bound with the labeled anti-PSMA construct in the individual prior to administration of the labeled anti-PSMA construct, or by determining the number of cells bound with the labeled anti-PSMA construct according to the method of diagnosing described herein in an individual that does not have the disease or disorder. In some embodiments, the disease or disorder is cancer. In some embodiments, the cancer is selected, for example, from the group consisting of prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer. In some embodiments, the cancer is metastatic. In some embodiments, the individual is human. In some embodiments, the individual is suspected of having a PSMA-associated disease or disorder.
(421) In some embodiments, there is provided a method of diagnosing a PSMA-associated cancer in an individual (e.g., a mammal, such as a human or a non-human primate, such as a rhesus monkey or a cynomolgus monkey), comprising (a) contacting a labeled anti-PSMA construct according to any of the embodiments described herein with a tissue sample derived from the individual; and (b) determining the number of cells in the tissue sample bound with the labeled anti-PSMA construct, such that a value for the number of cells in the tissue sample bound with the labeled anti-PSMA construct above a threshold level indicates that the individual has a PSMA-associated cancer. The threshold level can be determined by various methods, including, for example, by determining the number of cells bound with the labeled anti-PSMA construct according to the method of diagnosing described herein in tissue samples from a first set of individuals who have a PSMA-associated and tissue samples from a second set of individuals who do not have a PSMA-associated cancer, and setting the threshold to a level that allows for discrimination between the tissue samples from the first and second sets. In some embodiments, the threshold level is zero, and the method comprises determining the presence or absence of cells in the tissue sample bound with the labeled anti-PSMA antibody moiety. In some embodiments, the method further comprises subtracting a background level of the number of cells bound with the labeled anti-PSMA construct. Background level can be determined by various methods, including, for example, by determining the number of cells in the tissue sample bound with the labeled anti-PSMA construct in the individual prior to contacting with the labeled anti-PSMA construct, or by determining the number of cells in a tissue sample bound with the labeled anti-PSMA construct according to the method of diagnosing described herein, which tissue sample is obtained or derived from an individual that does not have a PSMA-associated cancer. In some embodiments, the PSMA-associated cancer is selected, for example, from the group consisting of prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer. In some embodiments, the individual is human. In some embodiments, the individual is suspected of having a PSMA-associated cancer.
(422) The anti-PSMA constructs provided herein may be used to assay levels of PSMA in a biological sample using methods known to those of skill in the art. Suitable labels are known in the art and include enzyme labels, such as, glucose oxidase; radioisotopes, such as iodine (.sup.131I, .sup.125I, .sup.123I, .sup.121I) carbon (.sup.14C), sulfur (.sup.35S), tritium (.sup.3H), indium (.sup.115mIn, .sup.113mIn, .sup.112In, .sup.111In), technetium (.sup.99Tc, .sup.99mTc), thallium (.sup.201Ti), gallium (.sup.68Ga, .sup.67Ga), palladium (.sup.103Pd), molybdenum (.sup.99Mo), xenon (133Xe), fluorine (.sup.18F), samarium (.sup.153Sm), lutetium (.sup.77Lu), gadolinium (.sup.159Gd), promethium (.sup.149Pm), lanthanum (.sup.140La), ytterbium (.sup.75Yb), holmium (.sup.166Ho), yttrium (.sup.90Y), scandium (.sup.47Sc), rhenium (.sup.186Re, .sup.188Re), praseodymium (.sup.142Pr), rhodium (.sup.105Rh), and ruthenium (.sup.97Ru); luminol; fluorescent labels, such as fluorescein and rhodamine; and biotin.
(423) Techniques known in the art may be applied to labeled anti-PSMA constructs provided herein. Such techniques include, but are not limited to, the use of bifunctional conjugating agents (see e.g., U.S. Pat. Nos. 5,756,065; 5,714,631; 5,696,239; 5,652,361; 5,505,931; 5,489,425; 5,435,990; 5,428,139; 5,342,604; 5,274,119; 4,994,560; and 5,808,003). Aside from the above assays, various in vivo and ex vivo assays are available to the skilled practitioner. For example, one can expose cells within the body of the subject to an anti-PSMA construct which is optionally labeled with a detectable label, e.g., a radioactive isotope, and binding of the anti-PSMA antibody moiety to the cells can be evaluated, e.g., by external scanning for radioactivity or by analyzing a sample (e.g., a biopsy or other biological sample) derived from a subject previously exposed to the anti-PSMA construct.
(424) Articles of Manufacture and Kits
(425) Provided herein are articles of manufacture that comprise materials useful for the diagnosis or treatment of a PSMA-associated disease, such as cancer (for example prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer), for delivering an anti-PSMA construct or construct combination to a cell expressing PSMA on its surface, or for isolation or detection of PSMA-expressing cells in an individual. The article of manufacture can comprise a container and a label or package insert on or associated with the container. Suitable containers include, for example, bottles, vials, syringes, etc. The containers may be formed from a variety of materials such as glass or plastic. Generally, the container holds a composition which is effective for diagnosing or treating a PSMA-associated disease or disorder described herein, and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). At least one active agent in the composition is an anti-PSMA construct or construct combination provided herein. The label or package insert indicates that the composition is used for treating the particular condition. The label or package insert will further comprise instructions for administering the anti-PSMA construct or construct combination (or, e.g., a composition comprising such construct or construct combination) to an individual in need thereof (e.g., an individual having or suspected of having a PSMA-associated disease or disorder. Articles of manufacture and kits comprising combinatorial therapies (e.g., one or more therapeutic agents in addition to an anti-PSMA construct or construct combination described herein) are also contemplated.
(426) A package insert refers to instructions customarily included in commercial packages of therapeutic products that contain information about the indications, usage, dosage, administration, contraindications and/or warnings concerning the use of such therapeutic products. In some embodiments, the package insert indicates that the composition is used for treating PSMA-associated cancer (e.g., prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer).
(427) Additionally, the article of manufacture may further comprise a second container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI), sterile water for injection (SWFI) phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
(428) Kits are also provided that are useful for various purposes, e.g., for treatment of a PSMA-associated disease or disorder described herein, for delivering an anti-PSMA construct or construct combination to a cell expressing PSMA on its surface, or for isolation or detection of PSMA-binding cells in an individual, optionally in combination with the articles of manufacture. Kits provided herein include one or more containers comprising a composition comprising an anti-PSMA construct or construct combination (or unit dosage form thereof and/or article of manufacture), and in some embodiments, further comprise another agent (such as the agents described herein) and/or instructions for use in accordance with any of the methods described herein. The kit may further comprise a description of selection of individuals suitable for treatment. Instructions supplied in the kits herein are typically written instructions on a label or package insert (e.g., a paper sheet included in the kit), but machine-readable instructions (e.g., instructions carried on a magnetic or optical storage disk) are also acceptable.
(429) For example, in some embodiments, the kit comprises a composition comprising an anti-PSMA construct (e.g., a full-length anti-PSMA antibody, a mono-specific anti-PSMA construct, a multispecific anti-PSMA construct (such as a bispecific anti-PSMA antibody), or an anti-PSMA immunoconjugate) or an anti-PSMA construct combination (e.g., an anti-PSMA caTCR+anti-PSMA CSR). In some embodiments, the kit comprises a) a composition comprising an anti-PSMA construct or construct combination, and b) an effective amount of at least one other therapeutic agent. In some embodiments, the kit comprises a) a composition comprising an anti-PSMA construct or construct combination, and b) instructions for administering the composition to an individual for treatment of a PSMA-associated disease, including for example prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer. The anti-PSMA construct (or construct combination) and the other agent(s) can be present in separate containers or in a single container. For example, the kit may comprise one distinct composition or two or more compositions wherein one composition comprises an anti-PSMA construct or construct combination and another composition comprises another agent.
(430) In some embodiments, the kit comprises a) a composition comprising an anti-PSMA construct (e.g., a full-length anti-PSMA antibody, a mono-specific anti-PSMA construct, a multispecific anti-PSMA construct (such as a bispecific anti-PSMA antibody), an anti-PSMA immunoconjugate, or other anti-PSMA construct described herein) or an anti-PSMA construct combination (e.g., an anti-PSMA caTCR+anti-PSMA CSR), and b) instructions for combining the anti-PSMA construct or construct combination with cells (such as cells, e.g., immune cells, derived from an individual) to form a composition comprising anti-PSMA construct-cell conjugates and administering the anti-PSMA construct-cell conjugate composition to the individual for treatment of a PSMA-associated disease (including for example prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer). In some embodiments, the kit comprises a) a composition comprising an anti-PSMA construct or construct combination (such as described herein), and b) a cell (such as a cytotoxic cell). In some embodiments, the kit comprises a) a composition comprising an anti-PSMA construct or construct combination (such as described herein), b) a cell (such as a cytotoxic cell), and c) instructions for combining the anti-PSMA construct or construct combination with the cell to form a composition comprising anti-PSMA construct-cell conjugates and administering the anti-PSMA construct-cell conjugate composition to an individual for the treatment of a PSMA-associated disease, including for example prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer. In some embodiments, the kit comprises a composition comprising an anti-PSMA construct or construct combination (such as described herein) in association with a cell (such as a cytotoxic cell). In some embodiments, the kit comprises a) a composition comprising an anti-PSMA construct or construct combination (such as described herein) in association with a cell (such as a cytotoxic cell), and b) instructions for administering the composition to an individual for the treatment of a PSMA-associated disease, including for example prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer. In some embodiments, the association is by conjugation of the anti-PSMA construct or construct combination to a molecule on the surface of the cell. In some embodiments, the association is by insertion of a portion of the anti-PSMA construct or construct combination into the outer membrane of the cell.
(431) In some embodiments, the kit comprises a nucleic acid (or set of nucleic acids) encoding an anti-PSMA construct (e.g., a full-length anti-PSMA antibody, a mono-specific anti-PSMA construct, a multispecific anti-PSMA construct, e.g., a bispecific anti-PSMA construct (such as a bispecific anti-PSMA antibody, e.g., anti-PSMA tandem di-scFv), an anti-PSMA CAR, an anti-PSMA immunoconjugate, or other anti-PSMA construct described herein), an anti-PSMA construct combination described herein, or the polypeptide portion(s) thereof. In some embodiments, the kit comprises a) a nucleic acid (or set of nucleic acids) encoding an anti-PSMA construct (or construct combination) or polypeptide portion(s) thereof, and b) a host cell (such as an effector cell, e.g., a T cell) for expressing the nucleic acid (or set of nucleic acids). In some embodiments, the kit comprises a) a nucleic acid (or set of nucleic acids) encoding an anti-PSMA construct (or construct combination) or polypeptide portion(s) thereof, and b) instructions for i) expressing the anti-PSMA construct (or construct combination) in a host cell (such as an effector cell, e.g., a T cell), ii) preparing a composition comprising the anti-PSMA construct (or construct combination) or the host cell (e.g., effector cell, e.g., T cell) expressing the anti-PSMA construct (or construct combination), and iii) administering the composition comprising the anti-PSMA construct (or construct combination) or the host cell expressing the anti-PSMA construct (or construct combination) to an individual for the treatment of a PSMA-associated disease, including for example prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer. In some embodiments, the host cell (e.g., effector cell, such as a T cell) is derived from the individual. In some embodiments, the kit comprises a) a nucleic acid (or set of nucleic acids) encoding an anti-PSMA construct (or construct combination) or polypeptide portion(s) thereof, b) a host cell (such as an effector cell, e.g., a T cell) for expressing the nucleic acid (or set of nucleic acids), and c) instructions for i) expressing the anti-PSMA construct (or construct combination) in the host cell, ii) preparing a composition comprising the anti-PSMA construct (or construct combination) or the host cell expressing the anti-PSMA construct (or construct combination), and iii) administering the composition comprising the anti-PSMA construct (or construct combination) or the host cell expressing the anti-PSMA construct (or construct combination) to an individual for the treatment of a PSMA-associated disease, including for example prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer.
(432) In some embodiments, the kit comprises a nucleic acid encoding an anti-PSMA CAR. In some embodiments, the kit comprises a vector comprising a nucleic acid encoding an anti-PSMA CAR. In some embodiments, the kit comprises a) a vector comprising a nucleic acid encoding an anti-PSMA CAR, and b) instructions for i) introducing the vector into effector cells, such as T cells derived from an individual, ii) preparing a composition comprising the anti-PSMA CAR effector cells, and iii) administering the anti-PSMA CAR effector cell composition to the individual for treatment of a PSMA-associated disease, including for example prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer.
(433) In some embodiments, the kit comprises a nucleic acid encoding an anti-PSMA caTCR. In some embodiments, the kit comprises a vector comprising a nucleic acid encoding an anti-anti-PSMA caTCR. In some embodiments, the kit further comprises nucleic acid(s) encoding a bispecific construct, e.g., a tandem di-scFv (e.g., an anti-PSMA tandem di-scFv) or a CSR (such as an anti-PSMA CSR). In some embodiments, the kit comprises a) a vector comprising a nucleic acid encoding an anti-PSMA caTCR, and b) instructions for i) introducing the vector into effector cells, such as T cells derived from an individual, ii) preparing a composition comprising the anti-PSMA caTCR effector cells, and iii) administering the anti-PSMA caTCR effector cell composition to the individual for treatment of a PSMA-associated disease, including for example prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer. In some embodiments, the kit further comprises a) vector(s) comprising a nucleic acid that encodes a bispecific construct, e.g., a tandem di-scFv (such as an anti-PSMA tandem scFv), and b) instructions for i) introducing the vector(s) encoding the tandem di-scFv into the host cell simultaneously or sequentially with the vector encoding the anti-PSMA caTCR, ii) preparing a composition comprising the anti-PSMA caTCR plus tandem di-scFv effector cells, and iii) administering the anti-PSMA caTCR plus tandem di-scFv effector cell composition to the individual for treatment of a PSMA-associated disease, including for example prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer. In some embodiments, the kit further comprises a) vector(s) comprising a nucleic acid that encodes a CSR (such as an anti-PSMA CSR), and b) instructions for i) introducing the vector(s) encoding the CSR into the host cell simultaneously or sequentially with the vector encoding the anti-PSMA caTCR, ii) preparing a composition comprising the anti-PSMA caTCR plus CSR effector cells, and iii) administering the anti-PSMA caTCR plus CSR effector cell composition to the individual for treatment of a PSMA-associated disease, including for example prostate cancer (such as hormone-refractory or metastatic prostate cancer), renal cell cancer cell (such as clear cell renal cell cancer), uterine cancer, or liver cancer.
(434) The kits described herein are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like. Kits may optionally provide additional components such as buffers and interpretative information. The present application thus also provides articles of manufacture, which include vials (such as sealed vials), bottles, jars, flexible packaging, and the like.
(435) The instructions relating to the use of compositions comprising an anti-PSMA construct (or construct combination) generally include information as to dosage, dosing schedule, and route of administration for the intended treatment. The containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses. For example, kits may be provided that contain sufficient dosages of an anti-PSMA construct (e.g., a full-length anti-PSMA antibody, a multispecific anti-PSMA molecule (such as a bispecific anti-PSMA antibody), an anti-PSMA CAR, an anti-PSMA immunoconjugate, or other anti-PSMA construct or construct combination described herein) to provide effective treatment of an individual for an extended period, such as any of a week, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 2 weeks, 3 weeks, 4 weeks, 6 weeks, 8 weeks, 3 months, 4 months, 5 months, 7 months, 8 months, 9 months, or more. Kits may also include multiple unit doses of the anti-PSMA construct (or construct combination) and pharmaceutical compositions and instructions for use and packaged in quantities sufficient for storage and use in pharmacies, for example, hospital pharmacies and compounding pharmacies.
(436) Those skilled in the art will recognize that several embodiments are possible within the scope and spirit of this application. The embodiments will now be described in greater detail by reference to the following non-limiting examples. The following examples further illustrate the methods and compositions of the present disclosure but, of course, should not be construed as in any way limiting its scope.
EXAMPLES
Example 1: Materials and Methods
(437) The reagents discussed below are used in Examples 2-9.
(438) The cell lines include: prostate cancer cell lines: LNCaP (ATCC CRL-1740, PSMA positive), PC-3 (ATCC CRL-1438, PSMA negative), PC-3-PSMA (PC-3 engineered to express PSMA by lentiviral transduction), T cell line: Jurkat Clone E61 (ATCC TIB-152) and Jurkat-PSMA (Jurkat engineered to express PSMA by lentiviral transduction). The cell lines were cultured in RPMI 1640 (Hyclone, SH30027.02) supplemented with 10% FBS, 2.05 mM L-glutamine at 37? C./5% CO.sub.2.
(439) Additional PSMA-positive human cancer cell lines used in the examples below include MDA PCa 2b, VCaP, 22Rv1, Caki-1, HCC1482, and HuH-7. The following PSMA-negative human cancer cell lines are also used: PrEC LH, PC-3, NCI-H660, and DU 145.
Example 2: Selection and Characterization of scFv Specific for PSMA
(440) Identification of PSMA-Specific Antibodies
(441) A collection of human scFv antibody phage display libraries (diversity=10?10.sup.10) constructed by Eureka Therapeutics (i.e., the E-ALPHA? phage display library) was used for the selection of human mAbs specific to PSMA. Specifically, the E-ALPHA? phage display library was used to pan against a Jurkat cell line that has been engineered to express PSMA. The parental Jurkat cell line was used for negative selection. Two unique scFv clones isolated in this screen, i.e., Clone A and Clone B, were found to be specific for PSMA by flow cytometry assay. The sequences of Clone A and Clone B are provided in Table 13 below. The V.sub.L in each scFv is underlined, the V.sub.H in each scFv is double underlined, and the linker is in bold italic type. The CDRs are in underlined bold type and double underlined bold type.
(442) TABLE-US-00034 TABLE13 Anti-PSMAscFvClones CloneA QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNS NRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKV TVLG
EVQLVQSGAEVKKPGESLKISCKGS
IGWVRQMPGKGLEWMGI
RYSPSFQGOVTISADKSISTAYLQW SSLKASDTAMYYC
WGQGTLVTVSS(SEQIDNO:20) CloneB QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQ RPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGYVFGTGTKVT VLG
EVQLVQSGAEMKKPGESLKISCKGSGYNFA SYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWS SLKASDTAMYYCARDSYYGIDVWGQGTLVTVSS(SEQIDNO:21)
(443) The binding specificities of Clone A and Clone B against PSMA-positive cell lines and PSMA-negative cell lines were evaluated via flow cytometry. The PSMA-positive cell lines included LNCaP, a PSMA-expressing human prostate adenocarcinoma cell line; PC3-PSMA, a PSMA-negative human prostate cancer cell line engineered to express hPSMA; and Jurkat-PSMA, i.e., a PSMA-negative human T lymphocyte cell line engineered to express hPSMA. The PSMA-native cell lines included: PC3 and Jurkat. As shown in
Example 3: Characterization of T Cells Expressing Anti-PSMA CAR Constructs in Cytotoxicity Assays and Interferon-? (IFN-?) Release Assays
(444) To evaluate Clone A and Clone B in their abilities to redirect T cells and lead to cellular cytotoxicity and IFN-? release, nucleic acids encoding Clone A and Clone B ScFvs were cloned into a CD28/CD3? chimeric antigen receptor (CAR) construct, and each CAR (i.e., Clone A-CAR and Clone-B CAR) was transduced into primary human T cells. The amino acid sequences of Clone A-CAR and Clone B-CAR are provided in Table 14 below. Each CAR comprises (sequentially, from the N-terminus to the C-terminus) an anti-PSMA scFv (underlined), a myc tag (bold underlined), a linker (bold italic type), sequences derived from CD28 (double underlined), and sequences derived from CD3? (bold double underlined).
(445) TABLE-US-00035 TABLE14 CloneA-CAR QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSS IEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLV TVAFTIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
(SEQIDNO:29) CloneB-CAR QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFA SYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGT LVTVSS
IEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFI IFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
(SEQIDNO:30)
(446) Mock and CAR-encoding-nucleic-acid-transduced T cells were incubated for 16 hours at a 1:1 effector cell to target cell (E:T) ratio. The target cells used in these assays included: LNCaP (PSMA.sup.+), PC3 (PSMA.sup.?), PC3-PSMA (PSMA.sup.+), Jurkat (PSMA.sup.?), and Jurkat-PSMA (PSMA.sup.+).
(447) Cellular cytotoxicity was assessed using the LDH Cytotoxicity Assay (Promega, G1780). As shown in
(448) Target-dependent activation of T cells expressing Clone A-CAR or Clone B-CAR was assessed by measuring IFN-? release. Briefly, mock and transduced T cells were incubated for 16 hours at a 1:1 effector cell to target cell (E:T) ratio, as described above. IFN-? levels in the culture supernatants were measured using the Bio-Plex Pro human cytokine 8-plex Assay (Bio-Rad, M50000007A). As shown in
Example 4: Affinity Maturation of Anti-PSMA scFv Clones
(449) DNA encoding the Clone A and Clone B scFvs is subjected to random mutagenesis using, e.g., GeneMorph II Random Mutagenesis kit (Agilent Technologies). After mutagenesis, DNA sequences are cloned into an scFv-expressing phagemid vector to build variant antibody phage libraries. Separate mutation libraries are built for Clone A and Clone B. Individual phage clones from enriched phage panning pools (e.g., variant clones) are tested for enhanced binding to cell-surface human PSMA compared to their respective parental clones. Further, a competition cell-binding assay is performed to compare the binding affinities of the variant clones to those of the parental clones.
(450) Briefly, the relative binding affinities of the variant clones, as compared to their respective parental clones, are determined through antibody titration flow cytometry using, e.g., LNCaP, PC3, PC3-PSMA, Jurkat, and Jurkat-PSMA cells. EC.sub.50 and apparent K.sub.D for each variant clone is calculated based on flow cytometry binding signals.
(451) The variant clones are also evaluated for their abilities to redirect T cells and lead to cellular cytotoxicity and IFN-? release, as described in Example 3. Parental clones, i.e., Clone A and Clone B, are evaluated in parallel as a basis to measure the relative changes in the cellular cytotoxicity and IFN-? release levels demonstrated by the variant clones.
Example 5: Characterization of the Epitopes Bound by PSMA-Specific scFv Clones
(452) Epitope Binding
(453) To assess the epitope(s) of PSMA bound by Clone A, Clone B, and affinity-matured variants thereof, a binding competition assay is carried out as follows: Clones A and B are each conjugated to a fluorescent label. PSMA-expressing cell lines are incubated with unlabeled Clone A at 1 ug/ml. After pre-incubation, increasing concentrations (e.g., 0.001 ?g/mL, 0.01 ?g/mL, 0.1 ?g/mL, 1 ?g/mL, 5 ?g/mL, and 10 ?g/mL) of labeled Clone B is added directly to the sample without washing and incubated for another 30 minutes. After blocking, FACS is used for detection and analysis. The percent binding is determined from the MFI (mean fluorescence intensity) and samples are normalized against the isotype control. A parallel set of experiments is performed in which PSMA-expressing cell lines are incubated with unlabeled Clone B at 1 ug/ml in the presence of increasing concentrations (e.g., 0.001 ?g/mL, 0.01 ?g/mL, 0.1 ?g/mL, 1 ?g/mL, 5 ?g/mL, and 10 ?g/mL) of labeled Clone A. Additional experiments are performed in which PSMA-expressing cell lines are incubated with unlabeled J591 (i.e., a monoclonal murine anti-hPSMA antibody) at 1 ug/ml in the presence of increasing concentrations of labeled Clone A, and, in a separate set of experiments, increasing concentrations of labeled Clone B.
(454) Epitope Mapping
(455) To identify the residues of PSMA that are components of the epitope(s) bound by Clone A and Clone B (as well as affinity matured variants thereof), a variety of mammalian cell lines, each expressing a different PSMA mutant comprising at least one alanine substitution in the extracellular domain, are generated using standard recombinant DNA technology. The expression of the PSMA mutants on the surfaces of each of the mammalian cell lines is confirmed. Clones A and B (and affinity matured variants thereof) are assessed via flow cytometry for binding to cells expressing each different PSMA mutant. KO7 helper phage is assessed in parallel as a negative control. J591, a monoclonal murine anti-hPSMA antibody, is also assessed in parallel.
Example 6: Anti-PSMA Bispecific Antibodies
(456) Generation of Bispecific Antibody Constructs Using Human Anti-PSMA Antibodies
(457) This example described the construction of an anti-PSMA bispecific antibody construct (a tandem di-scFv) having a first antibody moiety (e.g., scFv) that binds human PSMA in native format (i.e., cell-surface expressed PSMA) and a second antibody moiety (e.g., scFv) that binds CD3 on T cells. The tandem di-scFvs described herein can be used for directing T cells to kill target cells that express human PSMA.
(458) The tandem di-scFvs are constructed using a single-chain format comprising the V.sub.L-V.sub.H scFv sequence of Clone A or Clone B the N-terminus and an anti-human CD3? mouse monoclonal scFv at the C-terminus (anti-PSMA anti-CD3 tandem di-scFv; e.g., see Brischwein, K. et al., Mol. Immunol. 43:1129-1143, 2006). DNA fragments encoding Clone A scFv, Clone B scFv, and the anti-human CD3? scFv are synthesized using, e.g., Genewiz or Genscript, and subcloned into a mammalian expression vector such as pQD-T (Eureka Therapeutics, Inc.) using standard recombinant DNA technology. A hexahistidine tag HHHHIH (SEQ ID NO: 158) is inserted at the C-terminus of each tandem di-scFv for purification and detection.
(459) HEK293 cells are transfected with an expression vector encoding the Clone A-tandem di-scFv or the Clone B-tandem di-scFv and cultured for seven days to express the tandem di-scFv. Each tandem di-scFv is purified from HEK293 cell supernatants, e.g., using HisTrap HP column (GE healthcare) by FPLC AKTA system or His GraviTrap columns (GE healthcare) based on the cell culture volume. Molecular weights of the purified tandem di-scFvs are measured under non-reducing conditions by gel electrophoresis. Bands (?98kD) corresponding to each construct (Clone A anti-PSMA anti-CD3 tandem di-scFv and Clone B anti-PSMA anti-CD3 tandem di-scFv) are expected to be observed as the major species on the gel.
(460) The amino acid sequences of Clone A anti-PSMA anti-CD3 tandem di-scFv and Clone B anti-CD3 tandem di-scFv are provided in Table 15 below. The anti-PSMA scFv in each tandem di-scFv is underlined. The anti-CD3 scFv in each tandem di-scFv is double underlined. The linker connecting the anti-PSMA scFv and the anti-CD3 scFv is in bold italic type.
(461) TABLE-US-00036 TABLE15 CloneAanti-PSMAanti-CD3tandemdi-scFv QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDV WGQGTLVTVSS DVQLVQSGAEVKKPGASVKVSCKASGYTFTRYTMHWVRQAPGQGLEWIGYINPSRGYTNYADS VKGRFTITTDKSTSTAYMELSSLRSEDTATYYCARYYDDHYCLDYWGQGTTVTVSSGEGTSTGSGGSGGSGGADDIVLTQS PATLSLSPGERATLSCRASQSVSYMNWYQQKPGKAPKRWIYDTSKVASGVPARFSGSGSGTDYSLTINSLEAEDAATYYCQ QWSSNPLTFGGGTKVEIKHHHHHH(SEQIDNO:25) CloneBanti-PSMAanti-CD3tandemdi-scFv QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNWQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFA SYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGT LVTVSS
DVQLVQSGAEVKKPGASVKVSCKASGYTFTRYTMHWVRQAPGQGLEWIGYINPSRGYTNYADSVKGRF TITTDKSTSTAYMELSSLRSEDTATYYCARYYDDHYCLDYWGQGTTVTVSSGEGTSTGSGGSGGSGGADDIVLTQSPATLS LSPGERATLSCRASQSVSYMNWYQQKPGKAPKRWIYDTSKVASGVPARFSGSGSGTDYSLTINSLEAEDAATYYCQQWSSN PLTFGGGTKVEIKHHHHHH(SEQIDNO:27)
(462) The tandem di-scFvs are characterized further, as described below.
(463) Assessing the Binding of Anti-PSMA Bispecific Antibody Constructs to Human Cancer Cell Lines
(464) The Clone A anti-PSMA anti-CD3 tandem di-scFv and Clone B anti-PSMA anti-CD3 tandem di-scFv constructs are evaluated for binding to human PSMA-expressing cancer cell lines (including, e.g., prostate cancer cell lines LNCaP, MDA PCa 2b, VCaP, and 22Rv1; renal cancer cell line Caki-1; uterine cancer cell line HCC1482; and liver cancer cell line HuH-7) via flow cytometry. Binding to human cancer cells lines that do not express PSMA (e.g., prostate cancer cell lines PrEC LH, PC-3, NCI-H660, DU 145) is evaluated in parallel. Additional bispecific antibody constructs (comprising e.g., a non-PSMA binding scFv with an anti-human CD3? scFv and/or, e.g., an scFv comprising the PSMA-binding moiety from J591 and an anti-human CD3? scFv) are tested in parallel.
Example 7: Generation and Characterization of T Cells Expressing Chimeric Antibody-T Cell Receptor (caTCR) Constructs
(465) Nucleic acids encoding the V.sub.H and V.sub.L domains from Clone A anti-PSMA scFv or Clone B anti-PSMA scFv are each fused to nucleic acids encoding Ig CH1 and CL constant regions and the transmembrane domain of a ??TCR using standard molecular biological techniques, generating nucleic acids encoding Clone A-caTCR and Clone B-caTCR. A schematic of the Clone A-caTCR and Clone B-caTCR constructs is provided in
(466) TABLE-US-00037 TABLE16 CloneA-caTCR Chain1: EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYL QWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTDSTDHVKPKETENTK QPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFL(SEQIDNO:31) Chain2:
PIKTDVITMDPEDNCSKDANDTLLLQ LTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS(SEQIDNO:32) CloneB-caTCR Chain1: EVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYL QWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTDSTDHVKPKETENTKQPSK SCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFL(SEQIDNO:34) Chain2:
PIKTDVITMDPKDNCSEDANDTLLLQL TNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS(SEQIDNO:35)
(467) Clone A-caTCR T cells and Clone B-caTCR T cells are generated using methods described in WO 2017/070608, PCT/US2018/029217 (now published as WO 2018/200582), and Milone, et al (Molecular Therapy, 17:1453-1464, 2009).
(468) The T-cell phenotypes resulting from activation through each anti-PSMA caTCR are characterized. Clone A-caTCR-T cells are incubated alone, co-incubated with PSMA-expressing LNCaP cells, or co-incubated with LNCaP cells in which PSMA has been knocked out at a ratio of effector cells:target cells of 2:1 in the presence of brefeldin. Parallel sets incubations are performed using Clone B-caTCR-T cells. Following the incubation, Clone A-caTCR-T cells and Clone B-caTCR-T cells are assayed via flow cytometry for the expression of activation markers, including, e.g., CD69 and CD25, and cellular degranulation markers, including, e.g., CD107a. In addition, intracellular flow cytometric analysis of Clone A-caTCR-T cells and Clone B-caTCR-T cells is performed to measure the levels of TNF?, IL-2, and IFN? expressed by CD4.sup.+ caTCR.sup.+ cells and CD4-CD8.sup.+ caTCR.sup.+ cells in response to PSMA-expressing cells as compared to PSMA-non expressing cells.
(469) The tumor-killing activities of Clone A-caTCR-T cells and Clone B-caTCR-T cells are assessed as described in Example 3. The percentage of Clone A-caTCR-positive-, Clone B-caTCR-positive-, Clone A-caTCR-negative-, and Clone B-caTCR-negative-T cells are each co-cultured with multiple PSMA-expressing and PSMA-non-expressing cell lines, including, e.g., LNCaP, PC3, PC3-PSMA, Jurkat, and Jurkat-PSMA. Specific lysis of target cells across a range of effector cell: target cell ratios is measured, as described in Example 3.
(470) A fluorescence-based assay is used to assess in vitro proliferation of Clone A-caTCR-T cells and Clone B-caTCR-T cells upon antigen stimulation. Briefly, Clone A-caTCR-T cells or Clone B-caTCR-T are serum starved overnight and then labeled with, e.g., 1 M CFSE (ThermoFisher Scientific), for 5 minutes at room temperature. The labeled cells are re-suspended in serum-free medium and co-cultured with target cells (e.g., LNCaP cells, PC3-PSMA cells, or Jurkat-PSMA cells) at an effector cell: target cell ratio of 2:1. To account for differences in transduction efficiency, donor-matched un-transduced T cells are used to normalize the percentage of receptor-positive cells. Cell division is monitored by flow cytometry.
Example 8: Generation and Characterization of Full-Length Anti-PSMA Antibodies Comprising a Human IgG1 Fc Region
(471) Clone A and Clone B are reformatted as full-length antibodies comprising a human IgG1 Fc region in, e.g., HEK293 and Chinese hamster ovary (CHO) cell lines, as described (Tomimatsu K. et al., Biosci. Biotechnol. Biochem. 73(7):1465-1469, 2009). Briefly, the antibody variable regions Clone A and Clone B are each subcloned into mammalian expression vectors, with matching human lambda or kappa light chain constant region and human IgG1 constant region sequences. Applying the same cloning strategy, chimeric PSMA full-length antibodies with mouse IgG1 heavy chain and light chain constant regions are generated. The molecular weights of purified full length IgG antibodies are measured under both reducing and non-reducing conditions by electrophoresis to assess the purity of the antibody sample. Sample purity is also assessed by performing SDS-PAGE, as follows: 2 ?g of each antibody is mixed with 2.5 ?L of NuPAGE LDS Sample Buffer (Life Technologies, NP0008) and the volume of each sample is adjusted to 10 ?L with deionized water. The samples are heated at 70? C. for 10 minutes, and then loaded onto the gel. Gel electrophoresis is performed at 180V for 1 hour.
(472) Anti-PSMA chimeric IgG1 antibodies comprising the antibody variable regions Clone A or Clone B are each assessed via FACS for binding to Jurkat cells, Jurkat cells expressing PSMA, PC3 cells, PC3 cells expressing PSMA, and to LNCaP human prostate adenocarcinoma cells. 10 ?g/mL of each antibody is added to each of the cell lines and incubated on ice. After washing, R-PE conjugated anti-mouse IgG (H+L) (Vector Labs #EI-2007) is added to detect antibody binding. Binding affinity of the anti-PSMA chimeric IgG1 antibodies is determined by ForteBio Octet QK. 5 ?g/mL biotinylated PSMA (extracellular domain) is loaded onto a streptavidin biosensor. After washing off excess antigen, 10 ?g/mL of each antibody is tested at for association and dissociation kinetics. Binding parameters are calculated using a 1:1 binding site, partial fit model.
(473) The amino acid sequences of the full length Clone A-IgG1 and full length Clone A-IgGlantibodies are provided in Table 17 below. The V.sub.L in each light chain is underlined, and the V.sub.H in each heavy chain is double underlined. The CDRs are in bold type.
(474) TABLE-US-00038 TABLE17 FulllengthCloneAIgG1antibody: Heavychain: EVQLVQSGAEVKKPGESLKISCKGS IGWVRQMPGKGLEWMGI
RYSPSFQGQVTISADKSISTAYL QWSSLKASDTAMYYC
WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK(SEQIDNO:39) LightChain: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQ AEDEADYYCQSYDSSLSGYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKA GVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS(SEQIDNO:40) FulllengthCloneBIgG1antibody: Heavychain: EVQLVQSGAEMKKPGESLKISCKGS
GWVRQMPGKGLEWMGT
RYGPAFQGQVTISADKSISTAYL OWSSLKASDTAMYYC
WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK(SEQIDNO:41) LightChain: QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAG VETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS(SEQIDNO:42)
Example 9: In Vivo Efficacy Studies
(475) PSMA CAR-T Cell Treatment in Mice
(476) Human PSMA-expressing prostate cancer (s.c.) xenograft models are generated in SCID-beige (no functional T-, B-, NK-cells) mice. Animals are randomized when average s.c. tumor volume reaches 200 mm.sup.3. Mice are divided into 6 groups (n=8-10 mice/group) that receive one of the following: (i) no treatment (ii) 10.sup.7 mock transduced CAR T cells, 1?/week for 4 weeks (iii) 10.sup.7 Clone A-CAR T cells, 1?/week for 4 weeks, (iv) 2?10.sup.6 Clone A-CAR T cells, 1?/week for 4 weeks, (v) 107 Clone B-CAR T cells, 1?/week for 4 weeks, or (iv) 2?10.sup.6 Clone B-CAR T cells, 1?/week for 4 weeks. The animals in each group are monitored for tumor volume, adverse response, human cytokine profile, histopathology of tumor for human CD3.sup.+ cells in tumor and organs for CAR T cell infiltration, PSMA expression on cells from tumor tissue, body weight and general health condition (such as eating, walking, daily activities). The amino acid sequences of Clone A-CAR and Clone B-CAR are provided in Table 13 above.
(477) PSMA caTCR-T Cell Treatment in Mice
(478) Human PSMA-expressing prostate cancer (s.c.) xenograft models are generated in SCID-beige (no functional T-, B-, NK-cells) mice. Animals are randomized when average s.c. tumor volume reaches 200 mm.sup.3. Mice are divided into 4 groups (n=8-10 mice/group) that receive one of the following: (i) no treatment, (ii) 10.sup.7 mock transduced caTCR T cells, 1?/week for 4 weeks, (iii) 10.sup.7 Clone A-caTCR T cells, 1?/week for 4 weeks, (iv) 2?10.sup.6 Clone A-caTCR T cells, 1?/week for 4 weeks, (v) 10.sup.7 Clone B-caTCR T cells, 1?/week for 4 weeks, or (iv) 2?10.sup.6 Clone B-caTCR T cells, 1?/week for 4 weeks. The animals in each group are monitored for tumor volume, adverse response, human cytokine profile, histopathology of tumor for human CD3.sup.+ cells in tumor and organs for caTCR-T cell infiltration, PSMA expression on cells from tumor tissue, body weight and general health condition (eating, walking, daily activities). The amino acid sequences of Clone A-caTCR and Clone B-caTCR are provided in Table 15 above.
Example 10: Generation and Characterization of T Cells Expressing Monovalent and Bivalent caTCR Constructs
(479) Nucleic acids encoding a monovalent anti-PSMA Clone A caTCR construct and a monovalent anti-PSMA Clone B caTCR construct were generated according to the description in Example 7. SEQ ID NO: 33 is an exemplary amino acid sequence of an anti-PSMA Clone A caTCR construct. Such construct is alternatively referred to herein as Clone A caTCR, anti-PSMA caTCR #1, or Ax1-caTCR. SEQ ID NO: 36 is an exemplary amino acid sequence of an anti-PSMA Clone B caTCR construct. The anti-PSMA Clone B caTCR construct is alternatively referred to herein as Clone B caTCR, anti-PSMA caTCR #2, or Bx1-caTCR.
(480) TABLE-US-00039 (SEQIDNO:33) METDTLLLWVLLLWVPGSTGEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSIST AYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTLVTVSSASTKGP SVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCE VKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRML FAKTVAVNFLLTAKLFFLRAKRSGSGAPVKQTLNFDLLKLAGDVESNPG PMETDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSN IGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAI TGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGQPKANPTVTLFPPS SEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNN KYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIKTDVI TMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLR RTAFCCNGEKS (SEQIDNO:36) METDTLLLWVLLLWVPGSTGEVQLVQSGAEMKKPGESLKISCKGSGYNF ASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSIST AYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSASTKGPSVFP LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTD STDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKT VAVNFLLTAKLFFLRAKRSGSGAPVKQTLNFDLLKLAGDVESNPGPMET DTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCSGSSSNIGSN TVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQS EDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQ ANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAAS SYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIKTDVITMDPK DNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFC CNGEKS
(481) In an effort to increase the binding of anti-PSMA caTCR to PSMA, bivalent caTCR constructs were designed. In particular, nucleic acids encoding the following homo bivalent caTCR constructs were generated.
(482) 1. Ax2-caTCR-1 (which is alternatively referred to herein as Ax2-caTCR or Bivalent Clone A caTCR-1) is a bivalent anti-PSMA Clone A caTCR comprising 1 scFv and 1 Fab. See, e.g., SEQ ID NO: 47 below.
(483) TABLE-US-00040 (SEQIDNO:47) METDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNI GAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAIT GLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGG GSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGK GLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTA MYYCARSMGSSLYASSDVWGQGTLVTVSSGGGGSEVQLVQSGAEVKKPG ESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSF QGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQ GTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPS NTKVDKRVEPKSCEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEK VNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFLRAKRSGSGAPVKQTLNF DLLKLAGDVESNPGPMETDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAP GQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDR FSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLG QPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVK AGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKT VAPTECSPIKTDVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLK SVVYFAIITCCLLRRTAFCCNGEKS
2. Ax2-caTCR-2 (which is alternatively referred to herein as Bivalent Clone A caTCR-2) is a bivalent Anti-PSMA Clone A caTCR comprising 2 Fabs. See, e.g., SEQ ID NO: 48 below.
(484) TABLE-US-00041 (SEQIDNO:48) METDTLLLWVLLLWVPGSTGEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSIST AYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTLVTVSSGGGGSG GGGSEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGL EWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMY YCARSMGSSLYASSDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGT AALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTV PSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTDSTDHVKPKETEN TKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLF FLRAKRSGSGAPVKQTLNFDLLKLAGDVESNPGPMETDTLLLWVLLLWV PGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGT APKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSY DSSLSGYVFGTGTKVTVLGGGGGSGGGGSQSVLTQPPSVSGAPGQRVTI SCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKS GTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGQPKANP TVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETT KPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC SPIKTDVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFA IITCCLLRRTAFCCNGEKS
3. Bx2-caTCR-1 (which is alternatively referred to herein as Bx2-caTCR or Bivalent Clone B caTCR-1) is a bivalent anti-PSMA Clone B caTCR comprising 1 scFv and 1 Fab. See, e.g., SEQ ID NO: 49 below.
(485) TABLE-US-00042 (SEQIDNO:49) METDTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCSGSSSNI GSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISG LQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGG SLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGKG LEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAM YYCARDSYYGIDVWGQGTLVTVSSGGGGSEVQLVQSGAEMKKPGESLKI SCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVT ISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVE PKSCEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVL GLRMLFAKTVAVNFLLTAKLFFLRAKRSGSGAPVKQTLNFDLLKLAGDV ESNPGPMETDTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCS GSSSNI
4. Bx2-caTCR-2 (which is alternatively referred to herein as Bivalent Clone B caTCR-2) is a bivalent anti-PSMA Clone B caTCR comprising 2 Fabs. See, e.g., SEQ ID NO: 50 below.
(486) TABLE-US-00043 (SEQIDNO:50) METDTLLLWVLLLWVPGSTGEVQLVQSGAEMKKPGESLKISCKGSGYNF ASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSIST AYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSGGGGSGGGGS EVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMG TIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCAR DSYYGIDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ TYICNVNHKPSNTKVDKRVEPKSCEVKTDSTDHVKPKETENTKQPSKSC HKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFLRAKRSG SGAPVKQTLNFDLLKLAGDVESNPGPMETDTLLLWVLLLWVPGSTGQAV LTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSN NQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGYVF GTGTKVTVLGGGGGSGGGGSQAVLTQPPSASGTPGQRVTISCSGSSSNI GSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISG LQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKANPTVTLFPPSSE ELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKY AASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIKTDVITM DPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRT AFCCNGEKS
(487) T cells expressing Ax2-caTCR-1, Ax2-caTCR-2, Bx2-caTCR-1, or Bx2-caTCR-2 were generated by transducing primary human T cells with viruses comprising nucleic acids encoding the caTCR constructs. The features and functions of the transformed T cells were assessed using the methods described in Example 7. Such T cells expressed the encoded caTCR constructs, proliferated well, redirected the T cells' specificity, and showed positive PSMA-specific cellular cytotoxicity/tumor-killing activities.
(488) In two representative tumor cell killing experiments, T cells expressing Bx2-caTCR (i.e., Bx2-caTCR-1) (see
(489) In addition, nucleic acids encoding the hetero bivalent caTCR constructs described below are generated and used to transduce primary human T cells. The transduced caTCR-T cells are characterized using the methods described in Example 7 and in the current Example to assess the whether the transduced T cells express the encoded caTCR constructs, proliferate well, redirect the T cells' specificity, and induce PSMA-specific cellular cytotoxicity/tumor cell killing.
(490) 5. Ax1-Bx1-caTCR-1 (alternatively referred to herein as Clone A Clone B caTCR-1) is an anti-PSMA caTCR comprising a Clone A scFv and a Clone B Fab. See, e.g., SEQ ID NO: 91 below.
(491) TABLE-US-00044 (SEQIDNO:91) METDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNI GAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAIT GLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGG GSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGK GLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTA MYYCARSMGSSLYASSDVWGQGTLVTVSSGGGGSEVQLVQSGAEMKKPG ESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAF QGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLV TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKV DKRVEPKSCEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMM SLTVLGLRMLFAKTVAVNFLLTAKLFFLRAKRSGSGAPVKQTLNFDLLK LAGDVESNPGPMETDTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRV TISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSK SGTSASLAISGLQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKAN PTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVET TKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE CSPIKTDVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYF AIITCCLLRRTAFCCNGEKS
6. Ax1-Bx1-caTCR-2 (alternatively referred to herein as Clone A Clone B caTCR-2 is an anti-PSMA caTCR comprising a Clone A Fab and a Clone B Fab. See, e.g., SEQ ID NO: 92 below.
(492) TABLE-US-00045 (SEQIDNO:92) METDTLLLWVLLLWVPGSTGEVQLVQSGAEVKKPGESLKISCKGSGYSF TSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSIST AYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTLVTVSSGGGGSG GGGSEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGKGL EWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMY YCARDSYYGIDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALG CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS LGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTDSTDHVKPKETENTKQP SKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFLRA KRSGSGAPVKQTLNFDLLKLAGDVESNPGPMETDTLLLWVLLLWVPGST GQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKL LIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSL SGYVFGTGTKVTVLGGGGGSGGGGSQAVLTQPPSASGTPGQRVTISCSG SSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSAS LAISGLQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKANPTVTLF PPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQ SNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIKT DVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCC LLRRTAFCCNGEKS
Example 11: Generation and Characterization of T Cells Expressing Construct Combinations with caTCR and CSR Receptors
(493) Nucleic acids encoding anti-PSMA Clone A chimeric signaling receptor (CSR) or anti-PSMA Clone B CSR were fused to the nucleic acids encoding monovalent or bivalent anti-PSMA caTCR constructs described in Example 10 to generate full-length nucleic acids encoding various caTCR+CSR construct combinations. Viruses comprising the full-length nucleic acids were used to transduce primary human T cells, so that the caTCR+CSR construct combinations were expressed on the surface of the T cells.
(494) Specifically, nucleic acids encoding the anti-PSMA CSR constructs listed below have been designed, and many have been generated.
(495) TABLE-US-00046 CloneA-CSR-1A(inorderfromN-terminustoC-terminus:anti-PSMACloneAscFv+ myctag(bold)+sequencesderivedfromCD28(underlined)) (SEQIDNO:55) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAE DEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYW IGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTL VTVSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFTIFW VRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS CloneA-CSR-1B(inorderfromN-terminustoC-terminus:anti-PSMACloneAscFv+ sequencesderivedfromCD28(underlined)) (SEQIDNO:37) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAE DEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYW IGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTL VTVSSAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFTIFWVRSKRSRLLH SDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS CloneA-CSR-2A(inorderfromN-terminustoC-terminus:anti-PSMACloneAscFv+ myctag(bold)+sequencesderivedfrom4-1BB(underlined)) (SEQIDNO:56) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAE DEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYW IGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTL VTVSSEQKLISEEDLAAATGPADLSPGASSVTPPAPAREPGHSPQIISFFLALTSTALLFLLFFLTLRFSVVKRGRKKLLYIF KQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL CloneA-CSR-2B(inorderfromN-terminustoC-terminus:anti-PSMACloneAscFv+ sequencesderivedfrom4-1BB(underlined)) (SEQIDNO:57) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAE DEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYW IGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTL VTVSSAAATGPADLSPGASSVTPPAPAREPGHSPQIISFFLALTSTALLFLLFFLTLRFSVVKRGRKKLLYIFKQPFMRPVQT TQEEDGCSCRFPEEEEGGCEL CloneA-CSR-3A(inorderfromN-terminustoC-terminus:anti-PSMACloneAscFv+ myctag(bold)+sequencesderivedfromCD27(underlined)) (SEQIDNO:58) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAE DEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYW IGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTL VTVSSEQKLISEEDLAAATGPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMFLVFT LAGALFLHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP CloneA-CSR-3B(inorderfromN-terminustoC-terminus:anti-PSMACloneAscFv+ sequencesderivedfromCD27(underlined)) (SEQIDNO:59) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAE DEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYW IGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTL VTVSSAAATGPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMFLVFTLAGALFLHQR RKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP CLONEA-CSR-4A(inorderfromN-terminustoC-terminus:anti-PSMACloneAscFv+ myctag(bold)+sequencesderivedfromCD30(underlined)) (SEQIDNO:60) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAE DEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYW IGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTL VTVSSEQKLISEEDLAAATGAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVL FWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMET CHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEA DHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK CLONEA-CSR-4B(inorderfromN-terminustoC-terminus:anti-PSMACloneAscFv+ sequencesderivedfromCD30(underlined)) (SEQIDNO:61) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAE DEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYW IGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTL VTVSSAAATGAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVV VGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLE SLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQE TEPPLGSCSDVMLSVEEEGKEDPLPTAASGK CLONEA-CSR-5A(inorderfromN-terminustoC-terminus:anti-PSMACloneAscFv+ myctag(bold)+sequencesderivedfromOX40(underlined)) (SEQIDNO:62) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAE DEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYW IGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTL VTVSSEQKLISEEDLAAATGDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGP LAILLALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI CLONEA-CSR-5B(inorderfromN-terminustoC-terminus:anti-PSMACloneAscFv+ sequencesderivedfromOX40(underlined)) (SEQIDNO:63) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAE DEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYW IGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTL VTVSSAAATGDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILLALYLL RRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI CLONEA-CSR-6A(inorderfromN-terminustoC-terminus:anti-PSMACloneAscFv+ myctag(bold)+CD8MMandCD27IC(underlined)) (SEQIDNO:64) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAE DEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYW IGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTL VTVSSEQKLISEEDLAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSL VITLYCQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP CLONEA-CSR-6B(inorderfromN-terminustoC-terminus:anti-PSMACloneAscFv+ CD8TMandCD27IC(underlined)) (SEQIDNO:65) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAE DEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYW IGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTL VTVSSAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCQRRK YRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP CLONEA-CSR-7A(inorderfromN-terminustoC-terminus:anti-PSMACloneAscFv+ myctag(bold)+CD8MMandCD30IC(underlined)) (SEQIDNO:66) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAE DEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYW IGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTL VTVSSEQKLISEEDLAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSL VITLYCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLP LQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEP PLGSCSDVMLSVEEEGKEDPLPTAASGK CLONEA-CSR-7B(inorderfromN-terminustoC-terminus:anti-PSMACloneAscFv+ CD8TMandCD30IC(underlined)) (SEQIDNO:67) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAE DEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYW IGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTL VTVSSAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCHRRA CRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGP SSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVML SVEEEGKEDPLPTAASGK CLONEA-CSR-8A(inorderfromN-terminustoC-terminus:anti-PSMACloneAscFv+ myctag(bold)+CD8MMandOX40IC(underlined)) (SEQIDNO:68) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAE DEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYW IGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTL VTVSSEQKLISEEDLAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSL VITLYCALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI CLONEA-CSR-8B(inorderfromN-terminustoC-terminus:anti-PSMACloneAscFv+ CD8TMandOX40IC(underlined)) (SEQIDNO:69) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAE DEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYW IGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTL VTVSSAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCALYL LRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI CloneB-CSR-1A(inorderfromN-terminustoC-terminus:anti-PSMACloneBscFv+ myctag(bold)+sequencesderivedfromCD28(underlined)) (SEQIDNO:70) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSED EADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWV GWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSS EQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFTIFWVRSKR SRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS CloneB-CSR-1B(inorderfromN-terminustoC-terminus:anti-PSMACloneBscFv+ sequencesderivedfromCD28(underlined)) (SEQIDNO:38) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSED EADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWV GWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSS AAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFTIFWVRSKRSRLLHSDYMN MTPRRPGPTRKHYQPYAPPRDFAAYRS CloneB-CSR-2A(inorderfromN-terminustoC-terminus:anti-PSMACloneBscFv+ myctag(bold)+sequencesderivedfrom4-1BB(underlined)) (SEQIDNO:71) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSED EADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWV GWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSS EQKLISEEDLAAATGPADLSPGASSVTPPAPAREPGHSPQIISFFLALTSTALLFLLFFLTLRFSVVKRGRKKLLYIFKQPFM RPVQTTQEEDGCSCRFPEEEEGGCEL CLONEB-CSR-2B(fromN-terminustoC-terminus:anti-PSMACloneBscFv+sequences derivedfrom4-1BB(underlined)) (SEQIDNO:72) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSED EADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWV GWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSS AAATGPADLSPGASSVTPPAPAREPGHSPQIISFFLALTSTALLFLLFFLTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEED GCSCRFPEEEEGGCEL CloneB-CSR-3A(inorderfromN-terminustoC-terminus:anti-PSMACloneBscFv+ myctag(bold)+sequencesderivedfromCD27(underlined)) (SEQIDNO:73) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSED EADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWV GWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSS EQKLISEEDLAAATGPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMFLVFTLAGAL FLHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP CloneB-CSR-3B(inorderfromN-terminustoC-terminus:anti-PSMACloneBscFv+ sequencesderivedfromCD27(underlined)) (SEQIDNO:74) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSED EADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWV GWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSS AAATGPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMFLVFTLAGALFLHQRRKYRS NKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP CLONEB-CSR-4A(inorderfromN-terminustoC-terminus:anti-PSMACloneBscFv+ myctag(bold)+sequencesderivedfromCD30(underlined)) (SEQIDNO:75) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSED EADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWV GWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSS EQKLISEEDLAAATGAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVIL VLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVG AAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPH YPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK CLONEB-CSR-4B(inorderfromN-terminustoC-terminus:anti-PSMACloneBsFv+ sequencesderivedfromCD30(underlined)) (SEQIDNO:76) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSED EADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWV GWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSS AAATGAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSA FLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQ DASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPL GSCSDVMLSVEEEGKEDPLPTAASGK CLONEB-CSR-5A(inorderfromN-terminustoC-terminus:anti-PSMACloneBscFv+ myctag(bold)+sequencesderivedfromOX40(underlined)) (SEQIDNO:77) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSED EADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWV GWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSS EQKLISEEDLAAATGDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILL ALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI CLONEB-CSR-5B(inorderfromN-terminustoC-terminus:anti-PSMACloneBscFv+ sequencesderivedfromOX40(underlined)) (SEQIDNO:78) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSED EADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWV GWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSS AAATGDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILLALYLLRRDQR LPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI CLONEB-CSR-6A(inorderfromN-terminustoC-terminus:anti-PSMACloneBscFv+ myctag(bold)+CD8MMandCD27IC(underlined)) (SEQIDNO:79) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSED EADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWV GWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSS EQKLISEEDLAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLY CQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP CLONEB-CSR-6B(inorderfromN-terminustoC-terminus:anti-PSMACloneBscFv+ CD8TMandCD27IC(underlined)) (SEQIDNO:80) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSED EADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWV GWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSS AAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCQRRKYRSNK GESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP CLONEB-CSR-7A(inorderfromN-terminustoC-terminus:anti-PSMACloneBscFv+ myctag(bold)+CD8MMandCD30IC(underlined)) (SEQIDNO:81) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSED EADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWV GWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSS EQKLISEEDLAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLY CHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDAS PAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSC SDVMLSVEEEGKEDPLPTAASGK CLONEB-CSR-7B(inorderfromN-terminustoC-terminus:anti-PSMACloneBscFv+ CD8TMandCD30IC(underlined)) (SEQIDNO:82) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSED EADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWV GWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSS AAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCHRRACRKRI RQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRD LPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEE GKEDPLPTAASGK CLONEB-CSR-8A(inorderfromN-terminustoC-terminus:anti-PSMACloneBscFv+ myctag(bold)+CD8MMandOX40IC(underlined)) (SEQIDNO:83) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSED EADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWV GWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSS EQKLISEEDLAAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLY CALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI CLONEB-CSR-8B(inorderfromN-terminustoC-terminus:anti-PSMACloneBscFv+ CD8TMandOX40IC(underlined)) (SEQIDNO:84) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSED EADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWV GWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSS AAATGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCALYLLRRDQ RLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI
(496) Nucleic acids encoding the caTCR+CSR construct combinations listed below have been designed, and many of these nucleic acids have been generated.
(497) TABLE-US-00047 Ax1-caTCR+A-CSR-1A(Ax1-caTCR+P2Aself-cleavingpeptide(bold)+signal sequence(italic)+CloneA-CSR-1A(underlined)) (SEQIDNO:85) METDTLLLWVLLLWVPGSTGEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPS FQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAAL GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTD STDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNELLTAKLEFLRAKRSGSGAPVKQTLNFDLL KLAGDVESNPGPMETDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIY GNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVEGTGTKVTVLGQPKANPTVTLEPPSSEELQANK ATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS PIKTDVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKSGSGATNESLLKQAGDV EENPGPMETDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRP SGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVEGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQS GAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASD TAMYYCARSMGSSLYASSDVWGQGTLVTVSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP FWVLVVVGGVLACYSLLVTVAFTIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS A-CSR-1A+Ax1-caTCR(signalsequence(italic)+CloneA-CSR-1A(underlined)+P2A self-cleavingpeptide(italic)+Ax1-caTCR) (SEQIDNO:161) METDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDR FSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVEGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKK PGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYC ARSMGSSLYASSDVWGQGTLVTVSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVV VGGVLACYSLLVTVAFTIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSGSGATNESLLKQAGDVEENPG PMETDTLLLWVLLLWVPGSTGEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSP SFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAA LGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKT DSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFLRAKRSGSGAPVKQTLNFDL LKLAGDVESNPGPMETDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLI YGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQAN KATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC SPIKTDVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS Ax1-caTCR+B-CSR-1A(Ax1-caTCR+P2Aself-cleavingpeptide(bold)+signal sequence(italic)+CloneB-CSR-1A(underlined)) (SEQIDNO:86) METDTLLLWVLLLWVPGSTGEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPS FQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAAL GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTD STDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFLRAKRSGSGAPVKQTLNFDLL KLAGDVESNPGPMETDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIY GNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANK ATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS PIKTDVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKSGSGATNESLLKQAGDV EENPGPMETDTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPS GVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSG AEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDT AMYYCARDSYYGIDVWGQGTLVTVSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLV VVGGVLACYSLLVTVAFTIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS B-CSR-1A+Ax1-caTCR(signalsequence(italic)+CloneB-CSR-1A(underlined)+P2A self-cleavingpeptide(italic)+Ax1-caTCR) (SEQIDNO:162) METDTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRF SGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKP GESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCA RDSYYGIDVWGQGTLVTVSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVL ACYSLLVTVAFTIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSGSGATNESLLKQAGDVEENPGPMETD TLLLWVLLLWVPGSTGEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQ VTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTDSTDH VKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFLRAKRSGSGAPVKQTLNFDLLKLAG DVESNPGPMETDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSN RPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLV CLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIKT DVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS Bx1-caTCR+A-CSR-1A(Bx1-caTCR+P2Aself-cleavingpeptide(bold)+signal sequence(italic)+CloneA-CSR-1A(underlined)) (SEQIDNO:87) METDTLLLWVLLLWVPGSTGEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPA FQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTDSTDH VKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFLRAKRSGSGAPVKQTLNFDLLKLAG DVESNPGPMETDTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQR PSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVC LISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIKTD VITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKSGSGATNESLLKQAGDVEENPG PMETDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPD RFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVK KPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYY CARSMGSSLYASSDVWGQGTLVTVSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLV VVGGVLACYSLLVTVAFTIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS A-CSR-1A+Bx1-caTCR(signalsequence(italic)+CloneA-CSR-1A(underlined)+P2A self-cleavingpeptide(italic)+Bx1-caTCR) (SEQIDNO:163) METDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDR FSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVEGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKK PGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYC ARSMGSSLYASSDVWGQGTLVTVSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVV VGGVLACYSLLVTVAFTIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSGSGATNFSLLKQAGDVEENPG METDTLLLWVLLLWVPGSTGEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPA FQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTDSTDH VKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNELLTAKLEFLRAKRSGSGAPVKQTLNFDLLKLAG DVESNPGPMETDTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQR PSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGYVEGTGTKVTVLGQPKANPTVTLEPPSSEELQANKATLVC LISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIKTD VITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS Bx1-caTCR+B-CSR-1A(Bx1-caTCR+P2Aself-cleavingpeptide(bold)+signal sequence(italic)+CloneB-CSR-1A(underlined)) (SEQIDNO:88) METDTLLLWVLLLWVPGSTGEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPA FQGQVTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTDSTDH VKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNELLTAKLEFLRAKRSGSGAPVKQTLNFDLLKLAG DVESNPGPMETDTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQR PSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGYVEGTGTKVTVLGQPKANPTVTLEPPSSEELQANKATLVC LISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIKTD VITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKSGSGATNESLLKQAGDVEENPG PMETDTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDR FSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGYVEGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKK PGESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYC ARDSYYGIDVWGQGTLVTVSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGV LACYSLLVTVAFTIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS B-CSR-1A+Bx1-caTCR(signalsequence(italic)+CloneA-CSR-1A(underlined)+P2A self-cleavingpeptide(italic)+Bx1-caTCR) (SEQIDNO:164) METDTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGVPDRF SGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEMKKP GESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYLQWSSLKASDTAMYYCA RDSYYGIDVWGQGTLVTVSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVL ACYSLLVTVAFTIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSGSGATNESLLKQAGDVEENPGPMETD TLLLWVLLLWVPGSTGEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQ VTISADKSISTAYLQWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCEVKTDSTDHVKPK ETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNELLTAKLEFLRAKRSGSGAPVKQTLNFDLLKLAGDVES NPGPMETDTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLMYSNNQRPSGV PDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGYVEGTGTKVTVLGQPKANPTVTLEPPSSEELQANKATLVCLISD FYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSPIKTDVITM DPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS Ax2-caTCR-1+B-CSR-1A(fromN-terminustoC-terminus:Ax2-caTCR+P2Aself- cleavingpeptide(bold)+signalsequence(italic)+CloneA-CSR-1A(underlined)) (SEQIDNO:89) METDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDR FSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVEGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKK PGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYC ARSMGSSLYASSDVWGQGTLVTVSSGGGGSEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGITYP GDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARSMGSSLYASSDVWGQGTLVTVSSASTKGPSVFPLAPSS KSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRV EPKSCEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNELLTAKLEFLRAKRSGSGAP VKQTLNFDLLKLAGDVESNPGPMETDTLLLWVLLLWVPGSTGQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQL PGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVEGTGTKVTVLGQPKANPTVTLFP PSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTV EKTVAPTECSPIKTDVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKSGSGATN FSLLKQAGDVEENPGPMETDTLLLWVLLLWVPGSTGQAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKL LMYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLE MAEVQLVQSGAEMKKPGESLKISCKGSGYNFASYWVGWVRQMPGKGLEWMGTIYPDDSDTRYGPAFQGQVTISADKSISTAYL QWSSLKASDTAMYYCARDSYYGIDVWGQGTLVTVSSEQKLISEEDLAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFP GPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
(498) Nucleic acids encoding the caTCR+CSR construct combinations listed in bold below and in Table 12 (which is reproduced below) are also designed.
(499) A nucleic acid encoding B-CSR-1A+Ax2-caTCR-1 comprises sequences that encode (from 5 to 3) the following main components: B-CSR-1A (SEQ ID NO: 70), the furin cleavage site fused to P2A self-cleaving peptide of SEQ ID NO: 133 (i.e., RAKRSGSGATNFSLLKQAGDVEENPGP), and a polypeptide comprising SEQ ID NO: 47 (Ax2-caTCR-1).
(500) A nucleic acid encoding Ax2-caTCR-1+B-CSR-1B comprises sequences that encode (from 5 to 3): a polypeptide comprising SEQ ID NO: 47 (Ax2-caTCR-1), the P2A self-cleaving peptide of SEQ ID NO: 132 (GSGATNFSLLKQAGDVEENPGP), and B-CSR-1B (SEQ ID NO: 38). (See also row 3 in Table 12, which is reproduced below.)
(501) A nucleic acid encoding B-CSR-1B+Ax2-caTCR-1 comprises sequences that encode (from 5 to 3): B-CSR-1B (SEQ ID NO: 38), the furin cleavage site fused to P2A self-cleaving peptide of SEQ ID NO: 133, and a polypeptide comprising SEQ ID NO: 47 (Ax2-caTCR-1). (See also row 4 in Table 12, which is reproduced below.)
(502) TABLE-US-00048 TABLE 12 Order of Components (from N-Terminus caTCR + CSR to C-Terminus) Combination in Polypeptide Exemplary Exemplary Encoded by encoded by the anti-PSMA anti-PSMA Nucleic Acid Nucleic Acid caTCR CSR Exemplary Linker 1 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-1A P2A self-cleaving B-CSR-1A (see, e.g., (SEQ ID NO: 47) (SEQ ID NO: 70) peptide SEQ ID NO: 89) (SEQ ID NO: 132) 2 B-CSR-1A + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-1A furin cleavage Ax2-caTCR-1 (see, e.g., (SEQ ID NO: 47) (SEQ ID NO: 70) site + P2A self- paragraph [0441]) cleaving peptide (SEQ ID NO: 133) 3 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-1B P2A self-cleaving B-CSR-1B (see, e.g., (SEQ ID NO: 47) (SEQ ID NO: 38) peptide paragraph [0442]) (SEQ ID NO: 132) 4 B-CSR-1B + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-1B furin cleavage Ax2-caTCR-1 (see, e.g., (SEQ ID NO: 47) (SEQ ID NO: 38) site + P2A self- paragraph [0443]) cleaving peptide (SEQ ID NO: 133) 5 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-2A P2A self-cleaving B-CSR-2A (SEQ ID NO: 47) (SEQ ID NO: 71) peptide (SEQ ID NO: 132) 6 B-CSR-2A + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-2A furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 71) site + P2A self- cleaving peptide (SEQ ID NO: 133) 7 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-2B P2A self-cleaving B-CSR-2B (SEQ ID NO: 47) (SEQ ID NO: 72) peptide (SEQ ID NO: 132) 8 B-CSR-2B + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-2B furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 72) site + P2A self- cleaving peptide (SEQ ID NO: 133) 9 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-3A P2A self-cleaving B-CSR-3A (SEQ ID NO: 47) (SEQ ID NO: 73) peptide (SEQ ID NO: 132) 10 B-CSR-3A + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-3A furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 73) site + P2A self- cleaving peptide (SEQ ID NO: 133) 11 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-3B P2A self-cleaving B-CSR-3B (SEQ ID NO: 47) (SEQ ID NO: 74) peptide (SEQ ID NO: 132) 12 B-CSR-3B + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-3B furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 74) site + P2A self- cleaving peptide (SEQ ID NO: 133) 13 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-4A P2A self-cleaving B-CSR-4A (SEQ ID NO: 47) (SEQ ID NO: 75) peptide (SEQ ID NO: 132) 14 B-CSR-4A + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-4A furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 75) site + P2A self- cleaving peptide (SEQ ID NO: 133) 15 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-4B P2A self-cleaving B-CSR-4B (SEQ ID NO: 47) (SEQ ID NO: 76) peptide (SEQ ID NO: 132) 16 B-CSR-4B + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-4B furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 76) site + P2A self- cleaving peptide (SEQ ID NO: 133) 17 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-5A P2A self-cleaving B-CSR-5A (SEQ ID NO: 47) (SEQ ID NO: 77) peptide (SEQ ID NO: 132) 18 B-CSR-5A + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-5A furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 77) site + P2A self- cleaving peptide (SEQ ID NO: 133) 19 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-5B P2A self-cleaving B-CSR-5B (SEQ ID NO: 47) (SEQ ID NO: 78) peptide (SEQ ID NO: 132) 20 B-CSR-5B + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-5B furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 78) site + P2A self- cleaving peptide (SEQ ID NO: 133) 21 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-6A P2A self-cleaving B-CSR-6A (SEQ ID NO: 47) (SEQ ID NO: 79) peptide (SEQ ID NO: 132) 22 B-CSR-6A + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-6A furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 79) site + P2A self- cleaving peptide (SEQ ID NO: 133) 23 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-6B P2A self-cleaving B-CSR-6B (SEQ ID NO: 47) (SEQ ID NO: 80) peptide (SEQ ID NO: 132) 24 B-CSR-6B + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-6B furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 80) site + P2A self- cleaving peptide (SEQ ID NO: 133) 25 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-7A P2A self-cleaving B-CSR-7A (SEQ ID NO: 47) (SEQ ID NO: 81) peptide (SEQ ID NO: 132) 26 B-CSR-7A + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-7A furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 81) site + P2A self- cleaving peptide (SEQ ID NO: 133) 27 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-7B P2A self-cleaving B-CSR-7B (SEQ ID NO: 47) (SEQ ID NO: 82) peptide (SEQ ID NO: 132) 28 B-CSR-7B + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-7B furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 82) site + P2A self- cleaving peptide (SEQ ID NO: 133) 29 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-8A P2A self-cleaving B-CSR-8A (SEQ ID NO: 47) (SEQ ID NO: 83) peptide (SEQ ID NO: 132) 30 B-CSR-8A + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-8A furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 83) site + P2A self- cleaving peptide (SEQ ID NO: 133) 31 Ax2-caTCR-1 + caTCR-linker-CSR Ax2-caTCR-1 B-CSR-8B P2A self-cleaving B-CSR-8B (SEQ ID NO: 47) (SEQ ID NO: 84) peptide (SEQ ID NO: 132) 32 B-CSR-8B + CSR-linker-caTCR Ax2-caTCR-1 B-CSR-8B furin cleavage Ax2-caTCR-1 (SEQ ID NO: 47) (SEQ ID NO: 84) site + P2A self- cleaving peptide (SEQ ID NO: 133) 33 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-1A P2A self-cleaving A-CSR-1A (e.g., SEQ ID (SEQ ID NO: 49) (SEQ ID NO: 55) peptide NO:90) (SEQ ID NO: 132) 34 A-CSR-1A + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-1A furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 55) site + P2A self- cleaving peptide (SEQ ID NO: 133) 35 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-1B P2A self-cleaving A-CSR-1B (SEQ ID NO: 49) (SEQ ID NO: 37) peptide (SEQ ID NO: 132) 36 A-CSR-1B + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-1B furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 37) site + P2A self- cleaving peptide (SEQ ID NO: 133) 37 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-2A P2A self-cleaving A-CSR-2A (SEQ ID NO: 49) (SEQ ID NO: 56) peptide (SEQ ID NO: 132) 38 A-CSR-2A + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-2A furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 56) site + P2A self- cleaving peptide (SEQ ID NO: 133) 39 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-2B P2A self-cleaving A-CSR-2B (SEQ ID NO: 49) (SEQ ID NO: 57) peptide (SEQ ID NO: 132) 40 A-CSR-2B + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-2B furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 57) site + P2A self- cleaving peptide (SEQ ID NO: 133) 41 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-3A P2A self-cleaving A-CSR-3A (SEQ ID NO: 49) (SEQ ID NO: 58) peptide (SEQ ID NO: 132) 42 A-CSR-3A + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-3A furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 58) site + P2A self- cleaving peptide (SEQ ID NO: 133) 43 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-3B P2A self-cleaving A-CSR-3B (SEQ ID NO: 49) (SEQ ID NO: 59) peptide (SEQ ID NO: 132) 44 A-CSR-3B + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-3B furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 59) site + P2A self- cleaving peptide (SEQ ID NO: 133) 45 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-4A P2A self-cleaving A-CSR-4A (SEQ ID NO: 49) (SEQ ID NO: 60) peptide (SEQ ID NO: 132) 46 A-CSR-4A + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-4A furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 60) site + P2A self- cleaving peptide (SEQ ID NO: 133) 47 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-4B P2A self-cleaving A-CSR-4B (SEQ ID NO: 49) (SEQ ID NO: 61) peptide (SEQ ID NO: 132) 48 A-CSR-4B + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-4B furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 61) site + P2A self- cleaving peptide (SEQ ID NO: 133) 49 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-5A P2A self-cleaving A-CSR-5A (SEQ ID NO: 49) (SEQ ID NO: 62) peptide (SEQ ID NO: 132) 50 A-CSR-5A + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-5A furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 62) site + P2A self- cleaving peptide (SEQ ID NO: 133) 51 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-5B P2A self-cleaving A-CSR-5B (SEQ ID NO: 49) (SEQ ID NO: 63) peptide (SEQ ID NO: 132) 52 A-CSR-5B + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-5B furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 63) site + P2A self- cleaving peptide (SEQ ID NO: 133) 53 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-6A P2A self-cleaving A-CSR-6A (SEQ ID NO: 49) (SEQ ID NO: 64) peptide (SEQ ID NO: 132) 54 A-CSR-6A + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-6A furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 64) site + P2A self- cleaving peptide (SEQ ID NO: 133) 55 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-6B P2A self-cleaving A-CSR-6B (SEQ ID NO: 49) (SEQ ID NO: 65) peptide (SEQ ID NO: 132) 56 A-CSR-6B + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-6B furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 65) site + P2A self- cleaving peptide (SEQ ID NO: 133) 57 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-7A P2A self-cleaving A-CSR-7A (SEQ ID NO: 49) (SEQ ID NO: 66) peptide (SEQ ID NO: 132) 58 A-CSR-7A + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-7A furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 66) site + P2A self- cleaving peptide (SEQ ID NO: 133) 59 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-7B P2A self-cleaving A-CSR-7B (SEQ ID NO: 49) (SEQ ID NO: 67) peptide (SEQ ID NO: 132) 60 A-CSR-7B + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-7B furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 67) site + P2A self- cleaving peptide (SEQ ID NO: 133) 61 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-8A P2A self-cleaving A-CSR-8A (SEQ ID NO: 49) (SEQ ID NO: 68) peptide (SEQ ID NO: 132) 62 A-CSR-8A + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-8A furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 68) site + P2A self- cleaving peptide (SEQ ID NO: 133) 63 Bx2-caTCR-1 + caTCR-linker-CSR Bx2-caTCR-1 A-CSR-8B P2A self-cleaving A-CSR-8B (SEQ ID NO: 49) (SEQ ID NO: 69) peptide (SEQ ID NO: 132) 64 A-CSR-8B + CSR-linker-caTCR Bx2-caTCR-1 A-CSR-8B furin cleavage Bx2-caTCR-1 (SEQ ID NO: 49) (SEQ ID NO: 69) site + P2A self- cleaving peptide (SEQ ID NO: 133) 65 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-1A P2A self-cleaving B-CSR-1A (SEQ ID NO: 48) (SEQ ID NO: 70) peptide (SEQ ID NO: 132) 66 B-CSR-1A + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-1A furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 70) site + P2A self- cleaving peptide (SEQ ID NO: 133) 67 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-1B P2A self-cleaving B-CSR-1B (SEQ ID NO: 48) (SEQ ID NO: 38) peptide (SEQ ID NO: 132) 68 B-CSR-1B + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-1B furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 38) site + P2A self- cleaving peptide (SEQ ID NO: 133) 69 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-2A P2A self-cleaving B-CSR-2A (SEQ ID NO: 48) (SEQ ID NO: 71) peptide (SEQ ID NO: 132) 70 B-CSR-2A + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-2A furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 71) site + P2A self- cleaving peptide (SEQ ID NO: 133) 71 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-2B P2A self-cleaving B-CSR-2B (SEQ ID NO: 48) (SEQ ID NO: 72) peptide (SEQ ID NO: 132) 72 B-CSR-2B + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-2B furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 72) site + P2A self- cleaving peptide (SEQ ID NO: 133) 73 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-3A P2A self-cleaving B-CSR-3A (SEQ ID NO: 48) (SEQ ID NO: 73) peptide (SEQ ID NO: 132) 74 B-CSR-3A + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-3A furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 73) site + P2A self- cleaving peptide (SEQ ID NO: 133) 75 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-3B P2A self-cleaving B-CSR-3B (SEQ ID NO: 48) (SEQ ID NO: 74) peptide (SEQ ID NO: 132) 76 B-CSR-3B + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-3B furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 74) site + P2A self- cleaving peptide (SEQ ID NO: 133) 77 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-4A P2A self-cleaving B-CSR-4A (SEQ ID NO: 48) (SEQ ID NO: 75) peptide (SEQ ID NO: 132) 78 B-CSR-4A + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-4A furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 75) site + P2A self- cleaving peptide (SEQ ID NO: 133) 79 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-4B P2A self-cleaving B-CSR-4B (SEQ ID NO: 48) (SEQ ID NO: 76) peptide (SEQ ID NO: 132) 80 B-CSR-4B + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-4B furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 76) site + P2A self- cleaving peptide (SEQ ID NO: 133) 81 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-5A P2A self-cleaving B-CSR-5A (SEQ ID NO: 48) (SEQ ID NO: 77) peptide (SEQ ID NO: 132) 82 B-CSR-5A + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-5A furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 77) site + P2A self- cleaving peptide (SEQ ID NO: 133) 83 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-5B P2A self-cleaving B-CSR-5B (SEQ ID NO: 48) (SEQ ID NO: 78) peptide (SEQ ID NO: 132) 84 B-CSR-5B + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-5B furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 78) site + P2A self- cleaving peptide (SEQ ID NO: 133) 85 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-6A P2A self-cleaving B-CSR-6A (SEQ ID NO: 48) (SEQ ID NO: 79) peptide (SEQ ID NO: 132) 86 B-CSR-6A + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-6A furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 79) site + P2A self- cleaving peptide (SEQ ID NO: 133) 87 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-6B P2A self-cleaving B-CSR-6B (SEQ ID NO: 48) (SEQ ID NO: 80) peptide (SEQ ID NO: 132) 88 B-CSR-6B + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-6B furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 80) site + P2A self- cleaving peptide (SEQ ID NO: 133) 89 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-7A P2A self-cleaving B-CSR-7A (SEQ ID NO: 48) (SEQ ID NO: 81) peptide (SEQ ID NO: 132) 90 B-CSR-7A + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-7A furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 81) site + P2A self- cleaving peptide (SEQ ID NO: 133) 91 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-7B P2A self-cleaving B-CSR-7B (SEQ ID NO: 48) (SEQ ID NO: 82) peptide (SEQ ID NO: 132) 92 B-CSR-7B + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-7B furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 82) site + P2A self- cleaving peptide (SEQ ID NO: 133) 93 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-8A P2A self-cleaving B-CSR-8A (SEQ ID NO: 48) (SEQ ID NO: 83) peptide (SEQ ID NO: 132) 94 B-CSR-8A + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-8A furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 83) site + P2A self- cleaving peptide (SEQ ID NO: 133) 95 Ax2-caTCR-2 + caTCR-linker-CSR Ax2-caTCR-2 B-CSR-8B P2A self-cleaving B-CSR-8B (SEQ ID NO: 48) (SEQ ID NO: 84) peptide (SEQ ID NO: 132) 96 B-CSR-8B + CSR-linker-caTCR Ax2-caTCR-2 B-CSR-8B furin cleavage Ax2-caTCR-2 (SEQ ID NO: 48) (SEQ ID NO: 84) site + P2A self- cleaving peptide (SEQ ID NO: 133) 97 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-1A P2A self-cleaving A-CSR-1A (SEQ ID NO: 50) (SEQ ID NO: 55) peptide (SEQ ID NO: 132) 98 A-CSR-1A + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-1A furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 55) site + P2A self- cleaving peptide (SEQ ID NO: 133) 99 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-1B P2A self-cleaving A-CSR-1B (SEQ ID NO: 50) (SEQ ID NO: 37) peptide (SEQ ID NO: 132) 100 A-CSR-1B + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-1B furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 37) site + P2A self- cleaving peptide (SEQ ID NO: 133) 101 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-2A P2A self-cleaving A-CSR-2A (SEQ ID NO: 50) (SEQ ID NO: 56) peptide (SEQ ID NO: 132) 102 A-CSR-2A + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-2A furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 56) site + P2A self- cleaving peptide (SEQ ID NO: 133) 103 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-2B P2A self-cleaving A-CSR-2B (SEQ ID NO: 50) (SEQ ID NO: 57) peptide (SEQ ID NO: 132) 104 A-CSR-2B + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-2B furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 57) site + P2A self- cleaving peptide (SEQ ID NO: 133) 105 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-3A P2A self-cleaving A-CSR-3A (SEQ ID NO: 50) (SEQ ID NO: 58) peptide (SEQ ID NO: 132) 106 A-CSR-3A + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-3A furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 58) site + P2A self- cleaving peptide (SEQ ID NO: 133) 107 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-3B P2A self-cleaving A-CSR-3B (SEQ ID NO: 50) (SEQ ID NO: 59) peptide (SEQ ID NO: 132) 108 A-CSR-3B + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-3B furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 59) site + P2A self- cleaving peptide (SEQ ID NO: 133) 109 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-4A P2A self-cleaving A-CSR-4A (SEQ ID NO: 50) (SEQ ID NO: 60) peptide (SEQ ID NO: 132) 110 A-CSR-4A + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-4A furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 60) site + P2A self- cleaving peptide (SEQ ID NO: 133) 111 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-4B P2A self-cleaving A-CSR-4B (SEQ ID NO: 50) (SEQ ID NO: 61) peptide (SEQ ID NO: 132) 112 A-CSR-4B + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-4B furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 61) site + P2A self- cleaving peptide (SEQ ID NO: 133) 113 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-5A P2A self-cleaving A-CSR-5A (SEQ ID NO: 50) (SEQ ID NO: 62) peptide (SEQ ID NO: 132) 114 A-CSR-5A + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-5A furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 62) site + P2A self- cleaving peptide (SEQ ID NO: 133) 115 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-5B P2A self-cleaving A-CSR-5B (SEQ ID NO: 50) (SEQ ID NO: 63) peptide (SEQ ID NO: 132) 116 A-CSR-5B + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-5B furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 63) site + P2A self- cleaving peptide (SEQ ID NO: 133) 117 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-6A P2A self-cleaving A-CSR-6A (SEQ ID NO: 50) (SEQ ID NO: 64) peptide (SEQ ID NO: 132) 118 A-CSR-6A + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-6A furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 64) site + P2A self- cleaving peptide (SEQ ID NO: 133) 119 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-6B P2A self-cleaving A-CSR-6B (SEQ ID NO: 50) (SEQ ID NO: 65) peptide (SEQ ID NO: 132) 120 A-CSR-6B + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-6B furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 65) site + P2A self- cleaving peptide (SEQ ID NO: 133) 121 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-7A P2A self-cleaving A-CSR-7A (SEQ ID NO: 50) (SEQ ID NO: 66) peptide (SEQ ID NO: 132) 122 A-CSR-7A + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-7A furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 66) site + P2A self- cleaving peptide (SEQ ID NO: 133) 123 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-7B P2A self-cleaving A-CSR-7B (SEQ ID NO: 50) (SEQ ID NO: 67) peptide (SEQ ID NO: 132) 124 A-CSR-7B + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-7B furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 67) site + P2A self- cleaving peptide (SEQ ID NO: 133) 125 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-8A P2A self-cleaving A-CSR-8A (SEQ ID NO: 50) (SEQ ID NO: 68) peptide (SEQ ID NO: 132) 126 A-CSR-8A + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-8A furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 68) site + P2A self- cleaving peptide (SEQ ID NO: 133) 127 Bx2-caTCR-2 + caTCR-linker-CSR Bx2-caTCR-2 A-CSR-8B P2A self-cleaving A-CSR-8B (SEQ ID NO: 50) (SEQ ID NO: 69) peptide (SEQ ID NO: 132) 128 A-CSR-8B + CSR-linker-caTCR Bx2-caTCR-2 A-CSR-8B furin cleavage Bx2-caTCR-2 (SEQ ID NO: 50) (SEQ ID NO: 69) site + P2A self- cleaving peptide (SEQ ID NO: 133)
(503) The single nucleic acid encoding the anti-PSMA caTCR+anti-PSMA CSR of any one of rows 1-128 in Table 12 may further encode one or more signal peptides (e.g., upstream of the sequence(s) encoding Chain 1 and/or Chain 2 of the caTCR and/or upstream of the sequence encoding the anti-PSMA CSR). Although specific linkers are listed in rows 1-128 in Table 12, an alternative linker (see e.g., Table 6A) may be used. The single nucleic acid encoding the anti-PSMA caTCR+anti-PSMA CSR of any one of rows 1-128 in Table 12 may further encode one or more peptide linkers (e.g., cleavable linkers) and/or peptide tags. See, e.g., Tables 6A and 6B.
(504) T cells expressing some of the caTCR+CSR construct combinations described in this Example were generated by transducing primary human T cells with viruses comprising corresponding nucleic acids, and their features and functions were assessed, using the methods described in Examples 3 and 7. The myc tags in the CSR constructs carrying such tags were used as the expression marker. Such T cells expressed the encoded caTCR and CSR constructs, proliferated well, redirected the T cells' specificity, and showed positive PSMA-specific cellular cytotoxicity/tumor-killing activities.
(505) In the two representative tumor cell killing experiments described in Example 10, along with the mock-transduced T cells and the T cells transduced with caTCR-encoding nucleic acids, some primary T cells were transduced with nucleic acids encoding various caTCR+CSR combinations and also normalized to 60% receptor positive and incubated with the same three target cell lines at a 2:1 E:T ratio (receptor-positive effector:target ratio 1.2:1) for 16 hours. The results of these experiments are shown in
(506) In another representative tumor cell killing experiment, T cells transduced with nucleic acids encoding Ax2-caTCR+B-CSR or Bx2-caTCR+A-CSR combinations, along with T cells expressing an anti-PSMA CAR construct comprising the amino acid sequence of SEQ ID NO: 29 or an anti-PSMA CAR construct comprising the amino acid sequence of SEQ ID NO: 30 were normalized to 53% receptor positive and incubated with target cells at a 2:1 E:T ratio (0.2M:0.1M, receptor-positive effector:target ratio 1.06:1) for 16 hours. Two PSMA.sup.+ target cell lines were used: LNCaP and PC3-PMSA. The result of this tumor cell killing experiment is shown in
(507) In addition to tumor cell killing experiments, a fluorescence-based flow cytometry assay as described in Example 7 was performed with T cells expressing the construct combinations Ax1-caTCR+B-CSR (a.k.a. Ax1-caTCR+B-CSR-1A, SEQ ID NO: 86) or Bx1-caTCR+A-CSR (a.k.a. Bx1-caTCR+A-CSR-1A, SEQ ID NO: 87), along with T cells expressing Clone A CAR (SEQ ID NO: 29) or Clone B CAR (SEQ ID NO: 30), which were all normalized with mock-transduced T cells to 50% receptor positivity, to assess T-cell proliferation. LNCaP was used as the PSMA.sup.+ target cell line and the E:T ratio is 2:1 (0.1M/0.05M, receptor-positive effector: target ratio 1:1). T cells were stained with CFSE. T cells were re-challenged with 0.1M target cells every 7 days up to 4 cycles (4 engagements). CFSE signaling were examined by flow cytometry on D3, D5 and D7 of each engagement period. The results are shown in
(508) The experiments described above are repeated using T cells expressing the caTCR+CSR construct combinations shown in Table 12.
LIST OF EMBODIMENTS
(509) 1. An anti-prostate specific membrane antigen (PSMA) construct comprising an antibody moiety specifically recognizing an extracellular domain of a cell surface-bound PSMA that comprises an amino acid sequence set forth in SEQ ID NO: 44. 2. The anti-PSMA construct of embodiment 1, wherein the PSMA is expressed on the surface of a cancer cell. 3. The anti-PSMA construct of embodiment 3, wherein the cancer cell is a prostate cancer cell, a renal cell cancer cell, a uterine cancer cell, or a liver cancer cell. 4. The anti-PSMA construct of embodiment 3, wherein the cancer cell is a prostate cancer cell. 5. The anti-PSMA construct of embodiment 4, wherein the prostate cancer cell is a hormone refractory prostate cancer cell or a metastatic prostate cancer cell. 6. The anti-PSMA construct of embodiment 3, wherein the cancer cell is a renal cancer cell. 7. The anti-PSMA construct of embodiment 6, wherein the renal cancer cell is a clear cell renal cell carcinoma (CCRCC) cell. 8. The anti-PSMA construct of any one of embodiments 1-7 wherein the PSMA is expressed on the surface of a cell selected from the group consisting of: LNCaP, MDA PCa 2b, VCaP, 22Rv1, Caki-1; HCC1482; and HuH-7. 9. The anti-PSMA construct of any one of embodiments 1-8, wherein the antibody moiety comprises: i) a heavy chain variable domain (V.sub.H) comprising a CDR-H1 comprising the amino acid sequence of any one of SEQ ID NOs: 1-2, or a variant thereof comprising up to about 5 amino acid substitutions, a CDR-H2 comprising the amino acid sequence of any one of SEQ ID NOs: 3-4, or a variant thereof comprising up to about 5 amino acid substitutions, and a CDR-H3 comprising the amino acid sequence of any one of SEQ ID NOs: 5-6, or a variant thereof comprising up to about 5 amino acid substitutions; and ii) a light chain variable domain (V.sub.L) comprising a CDR-L1 comprising the amino acid sequence of any one of SEQ ID NOs: 7-8, or a variant thereof comprising up to about 5 amino acid substitutions, a CDR-L2 comprising the amino acid sequence GNS or SSN, or a variant thereof comprising about 2 amino acid substitutions, and a CDR-L3 comprising the amino acid sequence of any one of SEQ ID NOs: 9-10, or a variant thereof comprising up to about 5 amino acid substitutions. 10. The anti-PSMA construct of embodiment 9, wherein the antibody moiety comprises: i) a V.sub.H comprising a CDR-H1 comprising the amino acid sequence of any one of SEQ ID NOs: 1-2, a CDR-H2 comprising the amino acid sequence of any one of SEQ ID NOs: 3-4, and a CDR-H3 comprising the amino acid sequence of any one of SEQ ID NOs: 5-6; and ii) a V.sub.L comprising a CDR-L1 comprising the amino acid sequence of any one of SEQ ID NOs: 7-8, a CDR-L2 comprising the amino acid sequence of GNS or SNN, and a CDR-L3 comprising the amino acid sequence of any one of SEQ ID NOs: 9-10. 11. The anti-PSMA construct of embodiment 9 or 10, wherein the antibody moiety comprises i) a V.sub.H comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 1, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 3, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 5; and ii) a light chain variable domain (V.sub.L) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 7, a CDR-L2 comprising the amino acid sequence GNS, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 9. 12. The anti-PSMA construct of embodiment 9 or 10, wherein the antibody moiety comprises i) a V.sub.H comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 2, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 4, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 6; and ii) a V.sub.L comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 8, a CDR-L2 comprising the amino acid sequence SNN, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 10. 13. The anti-PSMA construct of any one of embodiments 1-8, wherein the antibody moiety comprises a CDR-H1, a CDR-H2, and a CDR-H3 of a heavy chain variable domain (V.sub.H) set forth in SEQ ID NO: 16 or 17 and a CDR-L1, a CDR-L2, and a CDR-L3 of a light chain variable domain (V.sub.L) set forth in SEQ ID NO: 18 or 19. 14. The anti-PSMA construct of embodiment 13, wherein the antibody moiety comprises the CDR-H1, CDR-H2, and CDR-H3 of the V.sub.H set forth in SEQ ID NO: 16 and the CDR-L1, the CDR-L2, and the CDR-L3 of the V.sub.L set forth in SEQ ID NO: 18. 15. The anti-PSMA construct of embodiment 13, wherein the antibody moiety comprises the CDR-H1, CDR-H2, and CDR-H3 of the V.sub.H set forth in SEQ ID NO: 17 and the CDR-L1, the CDR-L2, and the CDR-L3 of the V.sub.L set forth in SEQ ID NO: 19. 16. The anti-PSMA construct of any one of embodiments 1-8, wherein the antibody moiety comprises: i) a V.sub.H comprising an amino acid sequence having at least about 85% sequence identity to SEQ ID NO: 16 or 17 and ii) a V.sub.L comprising an amino acid sequence having at least about 85% sequence identity to SEQ ID NO: 18 or 19. 17. The anti-PSMA construct of any one of embodiments 1-16, wherein the antibody moiety comprises: i) a V.sub.H comprising an amino acid sequence having at least about 90% sequence identity to SEQ ID NO: 16 or 17 and ii) a V.sub.L comprising an amino acid sequence having at least about 90% sequence identity to SEQ ID NO: 18 or 19. 18. The anti-PSMA construct of any one of embodiments 1-17, wherein the antibody moiety comprises: i) a V.sub.H comprising an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 16 or 17 and ii) a V.sub.L comprising an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 18 or 19. 19. The anti-PSMA construct of embodiment 1-18, wherein the antibody moiety comprises: a V.sub.H comprising an amino acid sequence of SEQ ID NO: 16 and a V.sub.L comprising the amino acid sequence of SEQ ID NO: 18. 20. The anti-PSMA construct of embodiment 1-18, wherein the antibody moiety comprises: a V.sub.H comprising an amino acid sequence of SEQ ID NO: 17; and a V.sub.L comprising the amino acid sequence of SEQ ID NO: 19. 21. The anti-PSMA construct of any one of embodiments 1-8, wherein the antibody moiety comprises: i) a heavy chain variable domain (V.sub.H) comprising the amino acid sequences of SEQ ID NOs: 1, 3, and 5, and a light chain variable domain (V.sub.L) comprising the amino acid sequence of SEQ ID NO: 7, GNS, and SEQ ID NO: 9; or ii) a V.sub.H comprising the amino acid sequences of SEQ ID NOs: 2, 4, and 6, and a V.sub.L comprising the amino acid sequence of SEQ ID NO: 8, SSN, and SEQ ID NO: 10. 22. An anti-PSMA construct comprising an antibody moiety that competes with the anti-PSMA construct of embodiment 19 or embodiment 20 for specific binding to PSMA. 23. The anti-PSMA construct of any one of embodiments 1-22, wherein the antibody moiety specifically recognizing PSMA is chimeric, human, partially humanized, fully humanized, or semi-synthetic. 24. The anti-PSMA construct of any one of embodiments 1-23, wherein the antibody moiety specifically recognizing PSMA is a full-length antibody, a Fab, a Fab, a F(ab).sub.2, an Fv, or a single chain Fv (scFv). 25. The anti-PSMA construct of embodiment 24, wherein the antibody moiety specifically recognizing PSMA is an scFv. 26. The anti-PSMA construct of embodiment 25, wherein the scFv comprises the amino acid sequence set forth in SEQ ID NO: 20 or an amino acid sequence that has at least 85%, 90%, or 95% sequence identity to SEQ ID NO: 20. 27. The anti-PSMA construct of embodiment 25, wherein the scFv comprises the amino acid sequence set forth in SEQ ID NO: 21 or an amino acid sequence that has at least 85%, 90%, or 95% sequence identity to SEQ ID NO: 21. 28. The anti-PSMA construct of embodiment 24, wherein the antibody moiety specifically recognizing PSMA is a Fab or Fab. 29. The anti-PSMA construct of any one of embodiments 1-28, wherein the antibody moiety specifically recognizing PSMA is fused to an Fc fragment optionally via a linker. 30. The anti-PSMA construct of embodiment 29, wherein the Fc fragment is a human IgG Fc fragment. 31. The anti-PSMA construct of embodiment 30, wherein the human IgG is an IgG1, IgG2, IgG3, or IgG4. 32. The anti-PSMA construct of any one of embodiments 1-23, wherein the anti-PSMA antibody moiety is a full-length antibody. 33. The anti-PSMA construct of embodiment 30, wherein the full-length antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 39 or an amino acid sequence having at least 85% sequence identity to SEQ ID NO: 39 and a light chain comprising the amino acid sequence of SEQ ID NO: 40 or amino acid sequence having at least 85% sequence identity to SEQ ID NO: 40. 34. The anti-PSMA construct of embodiment 30, wherein the full-length antibody comprises a heavy chain comprising an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 39 and a light chain comprising an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 40. 35. The anti-PSMA construct of embodiment 30, wherein the full-length antibody comprises a heavy chain comprising an amino acid sequence having at least 95% sequence identity to SEQ ID NO: 39 and a light chain comprising an amino acid sequence having at least 95% sequence identity to SEQ ID NO: 40. 36. The anti-PSMA construct of embodiment 30, wherein the full-length antibody comprises a heavy chain comprising an amino acid sequence having at least 85% sequence identity to SEQ ID NO: 41 and a light chain comprising an amino acid having at least 85% sequence identity to SEQ ID NO: 42. 37. The anti-PSMA construct of embodiment 30, wherein the full-length antibody comprises a heavy chain comprising an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 41 and a light chain comprising an amino acid having at least 90% sequence identity to SEQ ID NO: 42. 38. The anti-PSMA construct of embodiment 30, wherein the full-length antibody comprises a heavy chain comprising an amino acid sequence having at least 95% sequence identity to SEQ ID NO: 41 and a light chain comprising an amino acid having at least 95% sequence identity to SEQ ID NO: 42. 39. The anti-PSMA construct of any one of embodiments 1-38, wherein the construct is monospecific. 40. The anti-PSMA construct of any one of embodiments 1-38, wherein the construct is multispecific. 41. The anti-PSMA construct of embodiment 40, wherein the construct is bispecific. 42. The anti-PSMA construct of embodiment 40 or 41, wherein the construct is a tandem scFv, a diabody (Db), a single chain diabody (scDb), a dual-affinity retargeting (DART) antibody, a F(ab)2, a dual variable domain (DVD) antibody, a knob-into-hole (KiH) antibody, a dock and lock (DNL) antibody, a chemically cross-linked antibody, a heteromultimeric antibody, or a heteroconjugate antibody. 43. The anti-PSMA construct of embodiment 42, wherein the construct is a tandem scFv comprising two scFvs linked by a peptide linker. 44. The anti-PSMA construct of any one of embodiments 40-43, wherein the construct further comprises a second antibody moiety specifically recognizing a second antigen. 45. The anti-PSMA construct of embodiment 44, wherein the second antigen is an antigen on the surface of a T cell. 46. The anti-PSMA construct of embodiment 45, wherein the second antigen is selected from the group consisting of CD3?, CD3?, CD3?, CD3?, CD28, OX40, GITR, CD137, CD27, CD40L, and HVEM. 47. The anti-PSMA construct of embodiment 46, wherein the second antigen is CD3?. 48. The anti-PSMA construct of embodiment 47, wherein the construct is a tandem scFv comprising an N-terminal scFv specifically recognizing PSMA and a C-terminal scFv specifically recognizing CD3?. 49. The anti-PSMA construct of embodiment 48, comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 25 or 26. 50. The anti-PSMA construct of embodiment 48, comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 27 or 28. 51. The anti-PSMA construct of embodiment 45, wherein the T cell is selected from the group consisting of a cytotoxic T cell, a helper T cell, and a natural killer T cell. 52. The anti-PSMA construct of any one of embodiments 45-51, wherein the expression of the anti-PSMA construct is induced by the activation of an engineered T cell. 53. The anti-PSMA construct of embodiment 52, wherein the engineered T cell is a T cell comprising a chimeric antigen receptor (CAR). 54. The anti-PSMA construct of embodiment 53, wherein the CAR specifically binds to PSMA. 55. The anti-PSMA construct of embodiment 53, wherein the CAR binds to an antigen other than PSMA. 56. The anti-PSMA construct of embodiment 52, wherein the engineered T cell is a T cell comprising a chimeric antibody-T cell receptor (TCR) construct (caTCR). 57. The anti-PSMA construct of embodiment 56, wherein the caTCR specifically binds to PSMA. 58. The anti-PSMA construct of embodiment 56, wherein the caTCR binds to an antigen other than PSMA. 59. The anti-PSMA construct of embodiment 44, wherein the second antigen is an antigen on the surface of a B cell, a natural killer cell, a dendritic cell, a macrophage, a monocyte, or a neutrophil. 60. The anti-PSMA construct of any one of embodiments 1-27, wherein the construct is a CAR comprising: (a) an extracellular domain comprising the anti-PSMA antibody moiety; (b) a transmembrane domain; and (c) an intracellular signaling domain. 61. The anti-PSMA construct of embodiment 60, wherein the intracellular signaling domain comprises a primary immune cell signaling sequence derived from CD3?, TCR?, FcR?, FcR?, CD3?, CD3?, CD3?, CD5, CD22, CD79a, CD79b, or CD66d. 62. The anti-PSMA construct of embodiment 61, wherein the intracellular signaling domain further comprise a costimulatory signaling sequence derived from CD28, 4-1BB, ICOS, or OX40. 63. The anti-PSMA construct of embodiment 60, 61, or 62, wherein the intracellular signaling domain comprises a primary immune cell signaling sequence derived from CD3? and a costimulatory signaling sequence derived from CD28. 64. The anti-PSMA construct of any one of embodiments 60-63, comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 29. 65. The anti-PSMA construct of any one of embodiments 60-63, comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 30. 66. The anti-PSMA construct of any one of embodiments 1-23, wherein the construct is a caTCR comprising: (a) an extracellular domain comprising the anti-PSMA antibody moiety; and (b) a T cell receptor module (TCRM) comprising a first TCR domain (TCRD) comprising a first TCR transmembrane domain (TCR-TM) and a second TCRD comprising a second TCR-TM, wherein the TCRM facilitates recruitment of at least one TCR-associated signaling molecule. 67. The anti-PSMA construct of embodiment 66, wherein the first TCR-TM is derived from one of the transmembrane domains of a first naturally occurring TCR and the second TCR-TM is derived from the other transmembrane domain of the first naturally occurring TCR. 68. The anti-PSMA construct of embodiment 67, wherein the at least one of the TCR-TMs is non-naturally occurring. 69. The anti-PSMA construct of embodiment 68, wherein the TCRM comprising the at least one non-naturally occurring TCR-TM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising the first naturally occurring T cell receptor transmembrane domains. 70. The anti-PSMA construct of embodiment 66 or 67, wherein the first and second TCR-TMs are naturally occurring. 71. The anti-PSMA construct of any one of embodiments 66-70, wherein the first TCR-TM and the second TCR-TM are derived from a ?/? TCR, optionally wherein the first TCR-TM is derived from a TCR ? chain and the second TCR-TM is derived from a TCR ? chain, or optionally wherein the first TCR-TM is derived from a TCR ? chain and the second TCR-TM is derived from a TCR ? chain. 72. The anti-PSMA construct of embodiment 71, wherein the construct comprises a first polypeptide chain comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 31 and a second polypeptide chain comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 32. 73. The anti-PSMA construct of embodiment 71, wherein the construct comprises a first polypeptide chain comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 34 and a second polypeptide chain comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 35. 74. The anti-PSMA construct of embodiment 71, wherein the construct comprises a first polypeptide chain comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 165 and a second polypeptide chain comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 166. 75. The anti-PSMA construct of embodiment 71, wherein the construct comprises a first polypeptide chain comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 167 and a second polypeptide chain comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 168. 76. The anti-PSMA construct of embodiment 71, wherein the construct comprises a first polypeptide chain comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 169 and a second polypeptide chain comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 170. 77. The anti-PSMA construct of embodiment 71, wherein the construct comprises a first polypeptide chain comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to EQ ID NO: 171 and a second polypeptide chain comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 172. 78. The anti-PSMA construct of embodiment 71, wherein the construct comprises a first polypeptide chain comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 173 and a second polypeptide chain comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 174. 79. The anti-PSMA construct of embodiment 71, wherein the construct comprises a first polypeptide chain comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 175 and a second polypeptide chain comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 176. 80. The anti-PSMA construct of embodiment 71, wherein the construct comprises a first polypeptide chain comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 177 and a second polypeptide chain comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 178. 81. The anti-PSMA construct of embodiment 71, wherein the construct comprises a first polypeptide chain comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 179 and a second polypeptide chain comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 180. 82. The anti-PSMA construct of any one of embodiments 66-70, wherein the first TCR-TM and the second TCR-TM are derived from an ?/? TCR, optionally wherein the first TCR-TM is derived from a TCR ? chain and the second TCR-TM is derived from a TCR ? chain, or optionally wherein the first TCR-TM is derived from a TCR ? chain and the second TCR-TM is derived from a TCR ? chain. 83. The anti-PSMA construct of any one of embodiments 66-82, wherein the TCR-associated signaling molecule is selected from the group consisting of CD3??, CD3??, and CD3??. 84. The anti-PSMA construct of any one of embodiments 66-83, wherein the caTCR lacks a functional primary immune cell signaling domain. 85. The anti-PSMA construct of any one of embodiments 1-23, wherein the construct is a chimeric signaling receptor (CSR) comprising: i) a ligand-binding module that is capable of binding or interacting with PSMA; ii) a transmembrane module; and iii) a co-stimulatory immune cell signaling module that is capable of providing a co-stimulatory signal to the effector cell, wherein the ligand-binding module and the co-stimulatory immune cell signaling module are not derived from the same molecule, and wherein the CSR lacks a functional primary immune cell signaling domain. 86. The anti-PSMA construct of embodiment 85, wherein the CSR lacks any primary immune cell signaling sequences. 87. The anti-PSMA construct of embodiment 85 or 86, wherein the ligand-binding module comprises the anti-PSMA construct of any one of embodiments 1-25. 88. The anti-PSMA construct of any one of embodiments 85 to 87, wherein the transmembrane module of the CSR and the co-stimulatory immune cell signaling module of the CSR are from the same molecule. 89. The anti-PSMA construct of embodiment 88, wherein the molecule is selected from the group consisting of CD28, 4-1BB (CD137), OX40, CD30, CD27, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83. 90. The anti-PSMA construct of embodiment 89, wherein the molecule is selected from the group consisting of CD28, 4-1BB (CD137), OX40, CD30, and CD27 91. The anti-PSMA construct of any one of embodiments 85 to 87, wherein the transmembrane module of the CSR and the co-stimulatory immune cell signaling module of the CSR are from different molecules. 92. The anti-PSMA construct of any one of embodiments 85-91, wherein the transmembrane module of the CSR comprises a transmembrane domain derived from CD28, CD3?, CD3?, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD27, CD30, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, 4-1BB, OX40, or the ?, ?, ?, ?, or ? chain of the T-cell receptor. 93. The anti-PSMA construct of any one of embodiments 85-92, wherein the transmembrane module of the CSR comprises a transmembrane domain derived from CD8, 4-1BB, CD27, CD28, CD30, or OX40. 94. The anti-PSMA construct of embodiment 93, wherein the transmembrane module of the CSR comprises a sequence that has at least 85%, 90%, 95%, or 100% sequence identity to any one of SEQ ID NOS: 94-99. 95. The anti-PSMA construct of any one of embodiments 85-94, wherein the co-stimulatory immune cell signaling module is derived from the intracellular domain of a co-stimulatory receptor of a TCR. 96. The anti-PSMA construct of embodiment 95, wherein the co-stimulatory receptor is selected from the group consisting of 4-1BB, CD27, CD28, CD30, OX40, ICOS, and CD40. 97. The anti-PSMA construct of embodiment 96, wherein the co-stimulatory immune cell signaling module of the CSR comprises a sequence that has at least 85%, 90%, 95%, or 100% sequence identity to any one of SEQ ID NOs: 100-103 and 183. 98. The anti-PSMA construct of any one of embodiments 85-97, wherein the expression of the CSR is inducible upon activation of an engineered T cell. 99. The anti-PSMA construct of embodiment 98, wherein the engineered T cell is a T cell comprising a CAR. 100. The anti-PSMA construct of embodiment 99, wherein the CAR specifically binds to PSMA. 101. The anti-PSMA construct of embodiment 99, wherein the CAR binds to an antigen other than PSMA. 102. The anti-PSMA construct of embodiment 98, wherein the engineered T cell is a T cell comprising a caTCR. 103. The anti-PSMA construct of embodiment 102, wherein the caTCR specifically binds to PSMA. 104. The anti-PSMA construct of embodiment 102, wherein the caTCR binds to an antigen other than PSMA. 105. The anti-PSMA construct of any one of embodiments 85-104, comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to any one of SEQ ID NOS: 3, 55-69, 93, and 184-186. 106. The anti-PSMA construct of embodiment 105, comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO: 37. 107. The anti-PSMA construct of any one of embodiments 85-104, comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to any one of SEQ ID NOS: 38, 70-84, 93, and 184-186. 108. The anti-PSMA construct of embodiment 107, comprising an amino acid sequence that has at least 85%, 90%, 95%, or 100% sequence identity to SEQ ID NO 38. 109. The anti-PSMA construct of any one of embodiments 85-108, comprising a signal peptide. 110. The anti-PSMA construct of embodiment 109, wherein the signal peptide comprises the sequence of METDTLLLWVLLLWVPGSTG SEQ ID NO: 128. 111. The anti-PSMA construct of any one of embodiments 1-42, conjugated to an effector molecule. 112. The anti-PSMA construct of embodiment 111, wherein the effector molecule is a therapeutic agent selected from the group consisting of: a drug, a toxin, a radioisotope, a protein, a peptide, and a nucleic acid. 113. The anti-PSMA construct of embodiment 112, wherein the therapeutic agent is a drug or a toxin. 114. The anti-PSMA construct of embodiment 111, wherein the effector molecule is a detectable label. 115. An effector cell that has been genetically modified with one or more nucleic acids encoding the anti-PSMA CAR of any one of embodiments 60-65 or the anti-PSMA caTCR of any one of embodiments 66-84. 116. The effector cell of embodiment 115, wherein the one or more nucleic acids encoding the anti-PSMA CAR or anti-PSMA caTCR also encode a CSR comprising a ligand binding module that binds a target antigen. 117. The effector cell of embodiment 115, which has been genetically modified with one or more additional nucleic acids encoding a CSR comprising a ligand binding module that binds a target antigen. 118. The effector cell of embodiment 116 or 117, wherein the target antigen is PSMA. 119. The effector cell of embodiment 116 or 117, wherein the target antigen is an antigen other than PSMA. 120. The effector cell of embodiment 115, wherein the one or more nucleic acids encoding the anti-PSMA CAR or anti-PSMA caTCR also encode a tandem scFv that comprises a first scFv that binds a target antigen. 121. The effector cell of embodiment 115, which has been genetically modified with one or more additional nucleic acids encoding a tandem scFv that comprises a first scFv that binds a target antigen. 122. The effector cell of embodiment 120 or 121, wherein the target antigen is PSMA. 123. the effector cell of embodiment 120 or 121, wherein the target is an antigen other than PSMA. 124. An effector cell that has been genetically modified with one or more nucleic acids encoding the anti-PSMA tandem scFv of any one of embodiments 43-59 or the anti-PSMA CSR of any one of embodiments 85-110. 125. The effector cell of embodiment 124, wherein the one or more nucleic acids encoding the anti-PSMA tandem scFv or anti-PSMA CSR also encode a CAR. 126. The effector cell of embodiment 124, which has been genetically modified with one or more additional nucleic acids encoding a CAR. 127. The effector cell of embodiment 125 or 126, wherein the CAR specifically binds PSMA. 128. The effector cell of embodiment 125 or 126, wherein the CAR specifically binds an antigen other than PSMA. 129. The effector cell of embodiment 124, wherein the one or more nucleic acids encoding the anti-PSMA tandem scFv or anti-PSMA CSR also encode a caTCR. 130. The effector cell of embodiment 124, which has been genetically modified with one or more additional nucleic acids encoding a caTCR. 131. The effector cell of embodiment 129 or 130, wherein the caTCR specifically binds PSMA. 132. The effector cell of embodiment 129 or 130, wherein the caTCR specifically binds an antigen other than PSMA. 133. The effector cell of any one of embodiments 115-132, wherein the effector cell is an immune cell. 134. The effector cell of embodiment 133, wherein the immune cell is a T cell. 135. The effector cell of embodiment 122, wherein the T cell is a cytotoxic T cell, a helper T cell, or a natural killer T cell. 136. A method of producing an effector cell, comprising genetically modifying a cell with one or more nucleic acids encoding the anti-PSMA CAR of any one of embodiments 60-65 or the anti-PSMA caTCR of any one of embodiments 66-84. 137. The method of embodiment 136, wherein the one or more nucleic acids encoding the anti-PSMA CAR or anti-PSMA caTCR also encode a CSR comprising a ligand binding module that binds a target antigen. 138. The method of embodiment 136, comprising further genetically modifying the cell with one or more additional nucleic acids encoding a CSR comprising a ligand binding module that binds a target antigen. 139. The method of embodiment 137 or 138 wherein the target antigen is PSMA. 140. The method of embodiment 137 or 138, wherein the target antigen is an antigen other than PSMA. 141. The method of embodiment 136, wherein the one or more nucleic acids encoding the anti-PSMA CAR or anti-PSMA caTCR also encode a tandem scFv that comprises a first scFv that binds a target antigen. 142. The method of embodiment 136, comprising further genetically modifying the cell with one or more additional nucleic acids encoding a tandem scFv that comprises a first scFv that binds a target antigen. 143. The method of embodiment 141 or 142, wherein the target antigen is PSMA. 144. The method of embodiment 141 or 142 wherein the target is an antigen other than PSMA. 145. A method of producing an effector cell, comprising genetically modifying a cell with one or more nucleic acids encoding the anti-PSMA tandem scFv of any one of embodiments 37-53 or the anti-PSMA CSR of any one of embodiments 85-110. 146. The method of embodiment 145, wherein the one or more nucleic acids encoding the anti-PSMA tandem scFv or anti-PSMA CSR also encode a CAR. 147. The method of embodiment 145, comprising further genetically modifying the cell with one or more additional nucleic acids encoding a CAR. 148. The method of embodiment 146 or 147, wherein the CAR specifically binds PSMA. 149. The method of embodiment 146 or 147, wherein the CAR specifically binds an antigen other than PSMA. 150. The method of embodiment 145, wherein the one or more nucleic acids encoding the anti-PSMA CAR or anti-PSMA caTCR also encode a caTCR. 151. The method of embodiment 145, comprising further genetically modifying the cell with one or more additional nucleic acids encoding a caTCR. 152. The method of embodiment 150 or 151, wherein the caTCR specifically binds PSMA. 153. The method of embodiment 150 or 151, wherein the caTCR specifically binds an antigen other than PSMA. 154. The method of any one of embodiments 136-153, wherein the effector cell is an immune cell. 155. The method of embodiment 154, wherein the immune cell is a T cell. 156. The method of embodiment 155, wherein the T cell is a cytotoxic T cell, a helper T cell, or a natural killer T cell. 157. A nucleic acid encoding the polypeptide portion(s) of the anti-PSMA construct of any one of embodiments 1-110. 158. A vector comprising the nucleic acid of embodiment 157. 159. A host cell comprising the nucleic acid of embodiment 157, or the vector of 158. 160. A method of producing the anti-PSMA construct of any one of embodiments 1-59, comprising culturing the host cell of embodiment 159 under conditions where the anti-PSMA construct is expressed, and recovering the anti-PSMA construct produced by the host cell. 161. A pharmaceutical composition comprising the anti-PSMA construct of any one of embodiments 1-59 and 111-113 the effector cell of any one of embodiments 115-135, the nucleic acid of embodiment 157, or the vector of embodiment 158 and a pharmaceutical acceptable carrier. 162. A kit comprising the anti-PSMA construct of any one of embodiments 1-59 and 111-113, the effector cell of any one of embodiments 115-135, the nucleic acid of embodiment 157, the vector of embodiment 158 and/or the host cell of embodiment 159. 163. A method of detecting PSMA in a sample, comprising contacting the sample with the anti-PSMA construct of embodiment 114 and detecting the presence of the label. 164. The method of embodiment 163, wherein the sample comprises cells expressing PSMA. 165. A method of treating an individual having a PSMA-associated disease or disorder, comprising administering to the individual an effective amount of the pharmaceutical composition of embodiment 161. 166. A method of treating an individual having a PSMA-associated disease or disorder, comprising administering to the individual an effector cell that has been genetically modified with one or more nucleic acids that encode the anti-PSMA CAR of any one of embodiments 60-65 or the anti-PSMA caTCR of any one of embodiments 66-84. 167. The method of embodiment 166, comprising genetically modifying the effector cell with the one or more nucleic acids prior to administration. 168. The method of embodiment 167, wherein the one or more nucleic acids that encode the anti-PSMA CAR or the anti-PSMA caTCR also encode a CSR or a tandem scFv. 169. The method of embodiment 167, comprising further genetically modifying the effector cell with one or more additional nucleic acids encoding a CSR or a tandem scFv. 170. The method of embodiment 168 or 169, wherein the tandem scFv specifically binds PSMA. 171. The method of embodiment 168 or 169, wherein the tandem scFv specifically binds an antigen other than PSMA. 172. The method of embodiment 168 or 169, wherein the CSR specifically binds PSMA. 173. The method of embodiment 168 or 169, wherein the CSR specifically binds an antigen other than PSMA. 174. A method of treating an individual having a PSMA-associated disease or disorder, comprising administering to the individual an effector cell that has been genetically modified with one or more nucleic acids that encode the anti-PSMA tandem scFv of any one of embodiments 43-59 or anti-PSMA CSR of any one of embodiments 85-110. 175. The method of embodiment 174, comprising genetically modifying the effector cell with the one or more nucleic acids prior to administration. 176. The method of embodiment 175, wherein the one or more nucleic acids that encode the anti-PSMA CSR or anti-PSMA tandem scFv also encode a CAR or a caTCR. 177. The method of embodiment 175, comprising further genetically modifying the effector cell with one or more additional nucleic acids encoding a CAR or a caTCR. 178. The method of embodiment 176 or 177, wherein the CAR specifically binds PSMA. 179. The method of embodiment 176 or 177, wherein the CAR specifically binds an antigen other than PSMA. 180. The method of embodiment 176 or 177, wherein the caTCR specifically binds PSMA. 181. The method of embodiment 176 or 177, wherein the caTCR specifically binds an antigen other than PSMA. 182. The method of any one of embodiments 166-181, wherein the effector cell is an immune cell. 183. The method of embodiment 182, wherein the immune cell is a T cell. 184. The method of embodiment 183, wherein the T cell is a cytotoxic T cell, a helper T cell, or a natural killer T cell. 185. The method of any one of embodiments 166-184, wherein the method further comprises obtaining an effector cell from an individual prior to genetically modifying and administering the effector cell. 186. The method of embodiment 185, wherein the individual from whom the effector cell is obtained is the individual to whom the genetically modified effector cell is administered. 187. The method of embodiment 186, wherein the individual from whom the effector cell is obtained is not the individual to whom the genetically modified effector cell is administered. 188. The method of embodiment 187, wherein the genetically modified effector cell is allogenic with respect to the individual to whom the genetically modified effector cell is administered. 189. The method of embodiment 188, wherein the genetically modified effector cell is syngeneic with respect to the individual to whom the genetically modified effector cell is administered. 190. The method of embodiment 188, wherein the genetically modified effector cell is xenogeneic respect to the individual to whom the genetically modified effector cell is administered. 191. The method of any one of embodiments 165-190, further comprising administering an additional therapy to the individual. 192. The method of any one of embodiments 165-191, wherein the PSMA-associated disease or disorder is cancer. 193. The method of embodiment 192, wherein the cancer is selected from the group consisting of: prostate cancer, renal cancer cell, uterine cancer, and liver cancer. 194. The method of embodiment 193, wherein the cancer is prostate cancer. 195. The method of embodiment 194, wherein the prostate cancer is hormone-refractory prostate cancer or metastatic prostate cancer. 196. The method of embodiment 193, wherein the cancer is renal cancer. 197. The method of embodiment 196, wherein the renal cancer is clear cell renal cell cancer (CCRCC). 198. The method of any one of embodiments 165-197, wherein the individual having the PSMA-associated disease or disorder is a mammal. 199. The method of embodiment 198, wherein the mammal is a human. 200. A method of diagnosing an individual suspected of having a PSMA-associated disease or disorder, comprising: a) administering an effective amount of the anti-PSMA construct of embodiment 114 to the individual; and b) determining the level of the label in the individual, wherein a level of the label above a threshold level indicates that the individual has the PSMA-associated disease or disorder. 201. A method of diagnosing an individual suspected of having a PSMA-associated disease or disorder, comprising: a) contacting a sample comprising cells derived from the individual with the anti-PSMA construct of embodiment 114; and b) determining the number of cells in the sample bound to the anti-PSMA construct, wherein a value for the number of cells bound to the anti-PSMA construct above a threshold level indicates that the individual has the PSMA-associated disease or disorder 202. The method of embodiment 200 or 201, wherein PSMA-associated disease or disorder is cancer. 203. The method of embodiment 202, wherein the cancer is selected from the group consisting of: prostate cancer, renal cancer cell, uterine cancer, and liver cancer. 204. The method of embodiment 203, wherein the cancer is prostate cancer. 205. The method of embodiment 204, wherein the prostate cancer is hormone-refractory prostate cancer or metastatic prostate cancer. 206. The method of embodiment 203, wherein the cancer is renal cancer. 207. The method of embodiment 206, wherein the renal cancer is clear cell renal cell cancer (CCRCC). 208. The method of any one of embodiments 200-207, wherein the individual suspected of having a disease or disorder associated with expression, aberrant expression, and/or aberrant activity of PSMA is a mammal. 209. The method of embodiment 208, wherein the mammal is a human.