HLA-RESTRICTED EPITOPES ENCODED BY SOMATICALLY MUTATED GENES
20240166751 ยท 2024-05-23
Inventors
- Bert Vogelstein (Baltimore, MD)
- Kenneth W. Kinzler (Frankford, DE, US)
- Shibin Zhou (Owings Mills, MD)
- Luis Diaz (Ellicott City, MD)
- Nickolas Papadopoulos (Towson, MD)
- Andrew Skora (Baltimore, MD, US)
- Jacqueline Douglass (Memphis, TN, US)
- Michael S. Hwang (Seattle, WA, US)
Cpc classification
C07K16/2863
CHEMISTRY; METALLURGY
C07K19/00
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
C07K2317/32
CHEMISTRY; METALLURGY
C07K7/00
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
International classification
C07K16/28
CHEMISTRY; METALLURGY
C07K19/00
CHEMISTRY; METALLURGY
C07K7/00
CHEMISTRY; METALLURGY
C07K16/00
CHEMISTRY; METALLURGY
Abstract
Mutant epitopes encoded by cancer genes are virtually always located in the interior of cells, making them invisible to conventional antibodies. We generated single chain variable fragments (scFvs) specific for mutant peptides presented on the cell surface by human leukocyte antigen (HLA) molecules. These scFvs can be converted to full-length antibodies, termed MANAbodies, targeting Mutation Associated Neo-Antigens bound to HLA. A phage display library representing a highly diverse array of single-chain variable fragment sequences was first designed and constructed. A competitive selection protocol was then used to identify clones specific for peptides bound to pre-defined HLA types. In this way, we obtained scFvs, including one specific for a peptide encoded by a common KRAS mutant and another by a common EGFR mutant. Molecules targeting MANA can be developed that specifically react with mutant peptide-HLA complexes even when these peptides differ by only one amino acid from the normal, wild-type form.
Claims
1. An isolated molecule comprising an antibody variable region which specifically binds to a complex of a human leukocyte antigen (HLA) molecule and a peptide which is a portion of a protein, wherein the peptide comprises a mutant residue, and wherein the mutant residue is in an intracellular epitope of the protein, wherein the molecule does not specifically bind to the HLA molecule when the HLA molecule is not in said complex, wherein the molecule does not specifically bind to the peptide in its wild-type form, and wherein the protein is an oncogenic KRAS protein comprising a G12 mutation.
2. The isolated molecule of claim 1, wherein said complex further comprises a ?-2-microglobulin molecule.
3. The isolated molecule comprising an antibody variable region of claim 1 which is an scFv, wherein the scFv comprises a sequence selected from SEQ ID NOs: 21-24 or 37-38.
4. The isolated molecule comprising an antibody variable region of claim 1 which is a Fab.
5-18. (canceled)
19. The isolated molecule comprising an antibody variable region of claim 1, wherein the oncogenic protein has a G12V mutation.
20. The isolated molecule comprising an antibody variable region of claim 19, wherein the oncogenic protein has a G12V mutation, wherein the peptide comprising a mutant residue is SEQ ID NO: 4 (KLVVVGAVGV).
21-22. (canceled)
23. The isolated molecule comprising an antibody variable region of claim 1 which does not bind to the peptide when it is not in the complex.
24. The isolated molecule comprising an antibody variable region of claim 2, wherein the HLA molecule is HLA-A2.
25. The isolated molecule comprising an antibody variable region of claim 2, wherein the HLA molecule is HLA-A3.
26. The isolated molecule comprising an antibody variable region of claim 1, further comprising a detectable label.
27. The isolated molecule comprising an antibody variable region of claim 1, further comprising a therapeutic agent.
28. (canceled)
29. The isolated molecule comprising an antibody variable region of claim 1, further comprising an scFv which specifically binds to CD3.
30-51. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
DETAILED DESCRIPTION OF THE INVENTION
[0036] We have developed an approach to generate and identify antibody variable regions that selectively target complexes containing common HLA types bound to peptide products of commonly mutated oncogenes. As these HLA-peptide complexes are expected to be exclusively present on the surface of cancer cells or other disease related cells, antibodies targeting them could in principle be used for therapeutic or monitoring purposes. These same approaches for identifying antibody variable regions can also be used to identify T cell receptors.
[0037] Mutations in oncogenes and tumor suppressor genes drive tumorigenesis, and their protein products form therapeutic targets that are absent from normal cells. However, nearly all such mutant epitopes lie in the interior of the cells, either in the cytoplasm or nucleus, complicating immunotherapies directed against the mutants. The antibody variable regions and T cell receptors described here overcome the shielding of intracellular targets lying within cells by targeting forms that are displayed on the surface of cells. Nonetheless, the methods and approaches described here may be used not solely for tumor suppressors and oncogenes, but also passenger mutations (not drivers of carcinogenesis) as well as for other proteins that are the product of somatic mutagenesis or which are expressed on cell surfaces as the result of somatic mutagenesis.
[0038] Examples of intracellular proteins which may be targeted include without limitations EGFR, KRAS, NRAS, HRAS, p53, PIK3CA, ABL1, beta-catenin, and IDH1/2. In order to have widest applicability, it is desirable to select mutations that are prevalent in cancer populations. Examples of such mutations include those in residues EGFR L858, KRAS G12, KRAS G13, HRAS G12, NRAS G12, HRAS Q61, NRAS Q61, IDH1 R132, beta-catenin S45, IDH2 R140, and IDH2 R172. Common mutants include EGFR L858R, KRAS G12V, KRAS G12C, KRAS G12D, HRAS Q61P, NRAS Q61P, HRAS Q61R, NRAS Q61R, HRAS Q61K, NRAS Q61K, EGFR T790M, IDH1 R132H, beta-catenin S45F, IDH2 R140Q, and IDH2 R172K. However, even a private or personal disease specific mutation coding for an epitope that is intracellular may be the target of an scFv or Fab or T cell receptors.
[0039] Libraries which can be made and screened include any that produce useful specific binding molecules, such as scFv, Fab, and TCR. The complexity of the repertoire of binding molecules is preferably very high. The libraries may be made in any suitable vector system, including but not limited to M13 phage, ribosomes, and yeast. For Fab libraries see Lee et al., J Mol Biol. High-affinity human antibodies from phage-displayed synthetic Fab libraries with a single framework scaffold, 2004 Jul. 23; 340:1073-93. For T cell receptor libraries see Kieke et al., Selection of functional T cell receptor mutants from a yeast surface-display library, Proc Natl Acad Sci USA. 1999; 96: 5651-5656. For ribosome display libraries see Stafford et al., Protein Eng Des Sel. In vitro Fab display: a cell-free system for IgG discovery. 2014; 27:97-109. Libraries may be made using synthetic oligonucleotides, synthetic trimers, or synthetic deoxyribonucleotides, for example. Each option permits biasing of the mixtures to bias the ultimate library composition.
[0040] The rarity of the desired scFv or Fab or TCR in a library is in some part due to the nature of the desired target. The desired target comprises a complex of an HLA molecule, a ?-2-microblobulin protein, and a peptide. However, of this whole complex, the desired scFv or Fab or TCR will only recognize a particular epitope that contains a mutant residue, most likely a substitution of one amino acid for another. Moreover, it will not specifically recognize the same macromolecular complex in which the residue is wild-type. Because of this extremely narrow focus, a strong selection process is required, in addition to an extraordinary amount of diversity in the library. A positive selection step for the desired scFv or Fab or T cell receptors has been devised which is performed in the presence of a competitor complex. The competitor complex comprises wild-type form of the peptide bound to HLA and ?-2 microglobulin. Alternatively, the competitor complex may comprise a peptide with a highly similar sequence to the mutant peptide, such as a peptide with one or more additional mutant residues or a peptide with an alternate, non-wild-type, residue at the same residue as the mutant peptide. The positive selection agent comprises HLA, ?-2-microglobulin, and the mutant peptide. Optionally, the competitive selection step will be performed repeatedly. As the step is repeatedly performed, the ratio of competitor complex to positive selection agent can be increased. Optionally, the competitive panning is followed by a negative selection step using the competitor complex. Optionally the competitive complex and/or the positive selection agent may be displayed or expressed on the surface of a cell for the selection step. In an alternative aspect of the invention, this type of selection process may be used to pan for binding molecules that recognize a single amino acid difference in a protein or peptide that is not part of an HLA/?-2 microglobulin complex. In a further option, the peptide does not represent an intracellular epitope.
[0041] The HLA molecule which is used to present peptide with a mutant residue may be from any HLA gene (A, B, C, E. F, and G) and allele of those genes. More prevalent genes and alleles, such as HLA-A2, HLA-A3, and HLA-B7, will find wider usage among human patients of some groups. Other HLA genes which may be used are HLA DP, DM, DOA, DOB, DQ, and DR.
[0042] When useful molecules are identified that specifically bind to a complex of (1) an HLA molecule, (2) a ?-2-microglobulin, and (3) a peptide comprising a mutant residue (found in an intracellular epitope in the full native protein) they can be used for various purposes and in various derivatives. The molecules can be bound or attached to a detectable label. Detectable labels can be any that are known in the art including, without limitation, radionuclides, chromophores, enzymes, and fluorescent molecules. Such molecules can be used, for example, to monitor anti-tumor therapy or to detect cancer cells in a sample, or to diagnose cancer. The molecules can alternatively be bound, conjugated, or attached to a therapeutic agent. Such therapeutic agents can be specifically targeted to cells expressing the protein by means of the scFv or Fab or T cell receptor identified. Another derivative of the identified molecule that may be usefully made is a chimeric antigen receptor (CAR). This derivative includes as part of a single protein, the identified molecule comprising an antibody variable region, a hinge region, a transmembrane region, and an intracellular domain. See, e.g., Curran et al., Chimeric antigen receptors for T cell immunotherapy: current understanding and future directions, J. Gene Med 2012; 14: 405-415. The CDR sequences of a useful molecule may be incorporated into an intact antibody, to form a MANAbody, as described in the examples. Alternatively, the useful molecule is not a part of an intact antibody molecule. The useful molecule may also be included as part of a chimeric protein with another scFv/antibody, such as an anti-CD3 scFv, to form a bispecific targeting agent. Such a chimeric protein may be used to target T cells to the tumor, inducing anti-tumor activity.
[0043] Any diagnostic technique known in the art, particularly any immunological diagnostic technique, can be used with the useful molecules. They can be used on samples that are tissue samples or tissue homogenates, for example. They can be used in immunohistochemistry, ELISA, immunoprecipitation, immunoblots, etc. Detection will be dependent on the detectable label that is attached or used to identify immune complexes. Any detection technique can be used. Therapeutic administration can be accomplished using any known means suitable for administering an antibody or specific binding molecule. Administration may be by injection or infusion into the peripheral circulatory system, for example, or intratumoral, intraspinal, intracerebellar, intraperitoneal, etc.
[0044] We have established a procedure for generating scFvs that selectively bind to mutant peptides embedded within HLA-beta-2 microglobulin complexes. Using this procedure, we obtained scFvs against the products of two commonly mutated oncogenes (KRAS and EGFR) when complexed with two common HLA types (A2 and A3, respectively). These scFvs bind to the peptide-HLA complexes on the surface of cells and can kill those cells when complement is present. Converting an scFv into a complete, bivalent antibody containing the Fc region sometimes results in loss of affinity (46, 47). However, we successfully generated a complete antibody using the D10 scFv sequence, and this MANAbody retained the specificity of the scFv (
[0045] Other antibodies, termed TCRmimics, have been generated against peptide-HLA complexes in the past (48-49). A first important aspect of our study is the generation of antibody-based reagents that differentially recognize HLA complexes containing peptides varying only by a single amino acid. A second important aspect of our study is that the variant peptides are commonly found in human cancers.
[0046] The greatest challenge in both cancer diagnosis and therapy is specificitydeveloping reagents that recognize or kill cancer cells but not normal cells. The relative lack of specificity currently presents a major obstacle for the wider implementation of powerful immunotherapeutic agents such as chimeric antigen receptors and bi-specific antibodies (57-60). In this context, specific somatic mutations that alter the encoded proteins of cancer driver genes represent biochemical features that distinguish cancer cells from normal cells in unparalleled fashion. The strength of the work described here is that it demonstrates the feasibility of generating highly specific reagents that recognize these altered proteins in a context that is clinically relevant (cell surface). This sets the stage for further exploration of such reagents and their incorporation into suitable diagnostic and therapeutic vehicles.
[0047] The above disclosure generally describes the present invention. All references disclosed herein are expressly incorporated by reference. A more complete understanding can be obtained by reference to the following specific examples which are provided herein for purposes of illustration only, and are not intended to limit the scope of the invention.
EXAMPLE 1
Materials and Methods
[0048] Cell Lines. T2 cells (ATCC, Manassas, VA) were cultured in RPMI-1640 (ATCC) with 10% FBS (GE Hyclone, Logan, Utah, USA), 1% penicillin streptomycin (Life Technologies), and 20 IU/mL recombinant human IL-2 (Proleukin?, Prometheus Laboratories) at 37? C. under 5% CO.sub.2. T2A3 cells (a kind gift from the Eric Lutz and Liz Jaffee, JHU) were grown in the same conditions as T2 cells but also with the addition of 500 ug/mL Geneticin (Life Technologies) and 1?Non-Essential Amino Acids (Life Technologies).
[0049] Phage Display Library Construction. Oligonucleotides were synthesized at DNA 2.0 (Menlo Park, CA) using mixed and split pool degenerate oligonucleotide syntheses. The oligonucleotides were incorporated into the pADL-10b phagemid (Antibody Design Labs, San Diego, CA). This phagemid contains an F1 origin, and a transcriptional repressor unit consisting of a lac operator and a lac repressor to limit uninduced expression. The scFv was synthesized with a pelB periplasmic secretion signal and was subcloned downstream of the lac operator. A myc epitope tag followed by a TEV protease cleavage recognition sequence was placed immediately downstream of the variable heavy chain, which was followed in frame by the full length M13 pIII coat protein sequence. (
[0050] Ten ng of the ligation product was mixed on ice with 10 ?L of electrocompetent SS320 cells (Lucigen, Middleton, WI) and 14 ?L of double-distilled water (ddH2O). This mixture was electroporated using a Gene Pulser electroporation system (Bio-Rad, Hercules, CA) and allowed to recover in Recovery Media (Lucigen) for 60 min at 37? C. Cells transformed with 60 ng of ligation product were pooled and plated on a 24-cm?24-cm plate containing 2?YT medium supplemented with carbenicillin (100 ?g/mL) and 2% glucose. Cells were grown at 37? C. for 6 hours and placed at 4? C. overnight. To determine the transformation efficiency for each series of electroporations, aliquots were taken and titered by serial dilution. Cells grown on plates were scraped into 850 mL of 2?YT medium with carbenicillin (100 ?g/mL) plus 2% glucose for a final OD.sub.600 of 5-15. Two mL of the 850 mL culture were taken and diluted ?1:200 to reach a final OD.sub.600 of 0.05-0.07. To the remaining culture, 150 mL of sterile glycerol was added before snap freezing to produce glycerol stocks. The diluted bacteria were grown to an OD.sub.600 of 0.2-0.4, infected with M13K07 Helper phage (NEB, Ipswich, MA or Antibody Design Labs) at an MOI of 1 and allowed to recover at 37? C. for 30 min before shaking at 37? C. for an additional 30 min. The culture was centrifuged and the cells were resuspended in 2?YT medium with carbenicillin (100 ?g/mL) and kanamycin (50 ?g/mL) and grown overnight at 30? C. for phage production. The following morning, the bacterial culture was aliquoted into 50 mL Falcon tubes and pelleted twice, first at 3000 g and then at 12000 g, to obtain clarified supernatant. The phage-laden supernatant was precipitated on ice for 40 min with a 20% PEG-8000/2.5 M NaCl solution at a 1:4 ratio of PEG/NaCl:supernatent. After precipitation, phage from each 50 mL-culture was centrifuged at 12,000 g for 40 minutes and resuspended in a 1 mL vol 1?TBS, 2 mM EDTA. Phage from multiple tubes were pooled, re-precipitated, and resuspended to an average titer of 1?10.sup.13 cfu/mL in 15% glycerol. The total number of transformants obtained was determined to be 5.5?10.sup.9. The library was aliquoted and stored in 15% glycerol at ?80? C.
[0051] Next-generation sequencing of the complete phage library. DNA from the library was amplified using the following primers (Forward: GGATACCGCTGTCTACTACTGTAGCCG, SEQ ID NO: 1 Reverse: CTGCTCACCGTCACCAATGTGCC, SEQ ID NO: 2) which flank the CDR-H3 region. Additional molecular barcode sequences were incorporated at the 5-ends of these primers to facilitate unambiguous enumeration of distinct phage sequences. The protocols for PCR-amplification and sequencing are previously published in (1). Sequences were processed and translated using a custom SQL database and both the nucleotide sequences and amino acid translations were analyzed using Microsoft Excel.
[0052] Peptides and HLA-Monomers. A wt KRAS peptide (KLVVVGAGGV; SEQ ID NO: 3) predicted to bind to HLA-A2, a mutant KRAS (G12V) peptide (KLVVVGAVGV; SEQ ID NO: 4) predicted to bind to HLA-A2, a mutant KRAS (G12C) peptide (KLVVVGACGV; SEQ ID NO: 5) predicted to bind to HLA-A2, a mutant KRAS (G12D) peptide (KLVVVGADGV; SEQ ID NO: 6) predicted to bind to HLA-A2, a mutant KRAS (G12V) peptide (VVGAVGVGK; SEQ ID NO: 7) predicted to bind to HLA-A3, a mutant KRAS (G12C) peptide (VVGACGVGK; SEQ ID NO: 8) predicted to bind to HLA-A3, a mutant EGFR (L858R) peptide (KITDFGRAK; SEQ ID NO: 9) predicted to bind to HLA-A3, a wt EGFR peptide (KITDFGLAK; SEQ ID NO: 10) predicted to bind to HLA-A3, and a wt KRAS peptide (VVGAGGVGK; SEQ ID NO: 11) predicted to bind to HLA-A3, and negative HLA-A2 control peptides ELA (ELAGIGILTV; SEQ ID NO: 12) and LLG (LLGRNSFEV; SEQ ID NO: 13) were synthesized at a purity of >90% by Peptide 2.0 (Chantilly, VA). Peptides were resuspended in DMSO at 10 mg/mL and stored at ?80? C. HLA-A2 and HLA-A3 monomers were synthesized by refolding recombinant HLA with peptide and beta-2 microglobulin, purified by gel-filtration, and biotinylated (Fred Hutchinson Immune Monitoring Lab, Seattle, WA). Monomers were confirmed to be folded prior to selection by performing an ELISA using W6/32 antibody (BioLegend, San Diego, CA), which recognizes only folded HLA (59). A rabbit anti-HLA-A antibody EP1395Y (Abcam, Cambridge, MA), which recognizes both folded and unfolded HLA, was used as a control for binding of unfolded monomers to the ELISA plates.
[0053] Selection for phages binding to mutant KRAS-HLA-A2. Biotinylated monomers containing HLA and beta-2-microglobulin proteins were conjugated to either MyOne T1 streptavidin magnetic beads (Life Technologies, Carlsbad, CA) or to streptavidin agarose (Novagen, Millipore, Darmstadt, Germany). The biotinylated monomers were incubated with either 25 ?L of MyOne T1 beads or 100 ?L of streptavidin agarose in blocking buffer (PBS, 0.5% BSA, 0.1% Na-azide) for 1 hr at room temperature (RT). After the initial incubation, the complexes were washed 3 times with 1 ml blocking buffer and resuspended in 100 uL blocking buffer.
[0054] Enrichment phase: The enrichment phase of selection consists of rounds 1 to 3. In round one, 1.4?10.sup.12 phage (140 uL), representing 250-fold coverage of the library, were incubated for 30 minutes in a mixture of 25 ul washed naked MyOne T1 beads and 1 ug (100 uL) heat-denatured HLA-A2 conjugated to MyOne T1 beads. It should be noted that after heat-denaturation, only the biotinylated HLA molecule, but not the peptide or beta-2-microglobulin, will be able to bind the MyOne T1 beads. This step is referred to as negative selection, necessary to remove any phage recognizing either streptavidin or denatured monomer, present to a small extent in every preparation of biotinylated monomer. After this negative selection, beads were immobilized with a DynaMag-2 magnet (Life Technologies) and the supernatant containing unbound phage was transferred for positive selection against the mutant KRAS-HLA-A2 monomer. The amount of monomer was decreased from 1 ug in round 1 to 500 ng in round 2 and 250 ng in round 3 and phage were incubated for 30 minutes. Prior to elution, beads were washed 10 times with 1 ml, 1?TBS containing 0.05%, 0.1%, and 0.25% Tween-20 in rounds 1 to 3 respectively. Phage were eluted by resuspending the beads in 1 mL of 0.2 M glycine, pH 2.2. After a 10-minute incubation, the solution was neutralized by the addition of 150 ?L of 1 M Tris, pH 9.0. Eluted phage were used to infect 10 mL cultures of mid-log-phase SS320s, with the addition of M13K07 helper phage (MOI of 4) and 2% glucose. Bacteria were then incubated as previously described and the phage were precipitated the next morning with PEG/NaCl.
[0055] Competitive phase: In the competitive phase (rounds 4 to 8), negative selection incorporated the same heat-denatured HLA-A2 monomer and naked streptavidin-coated magnetic beads, but also incorporated 1 ug of native HLA-A3 monomer. After negative selection, beads were isolated with a magnet and the supernatant containing unbound phage was transferred for competitive selection. This was performed by co-incubating phage with mutant KRAS-HLA-A2 monomer conjugated to magnetic streptavidin-coated magnetic MyOne T1 beads in the presence of wt KRAS-HLA-A2 monomer conjugated to streptavidin-coated agarose beads (Novagen EMD Millipore, Darmstadt, Germany). The ratio of mutant monomer to wt monomer was dropped 2-fold each round, from 1:1-1:32, holding the amount of the wt monomer constant at 1 ?g. Prior to elution, beads were washed 10 times in 1 ml 1?TBS containing 0.5% Tween-20. Phage were eluted and used to infect mid-log phase SS320 cells as described above for the enrichment phase.
[0056] Final selection phase: In the final selection phase (rounds 9-10), 1 ?g each of denatured and native KRAS-(WT)-HLA-A2 monomers was used for negative selection to remove residual wt monomer-binding phage. After negative selection, beads were immobilized with a magnet and the supernatant containing unbound phage was transferred for positive selection with 62.5 ng of mutant KRAS-HLA-A2 monomer, as described for the enrichment phase above.
[0057] Selection for phage binding to mutant EGFR-HLA-A3. This was performed as described above for the isolation of phages binding to mutant KRAS-HLA-A2, but with the following modifications. Selection was initiated with 2.5?10.sup.12 input phage and the number of input phage was decreased over the course of selection (see below). To increase expression of the scFv-pIII fusion protein in the early rounds, IPTG was employed to de-repress the lac operon. IPTG was added at an initial concentration of 10 ?M through round three, and subsequently lowered to 5 ?M for the remaining 6 rounds of selection. Additionally, in rounds 1 to 8, negative selection was performed with 2 ?g of heat-denatured biotinylated HLA-A2 and HLA-A3 conjugated to streptavidin magnetic beads (MyOne T1) as well as 25 uL naked streptavidin -coated magnetic beads. In the competitive phase, the ratio of mutant to wt monomers was gradually decreased from 1:2 to 1:64 and the amount of phage added was gradually reduced from 2.5?10.sup.12 to 10?10.sup.6.
[0058] Affinity Maturation. Affinity maturation of D10 was performed at AxioMx as follows. Briefly, the D10 scFv sequence (SEQ ID NO: 37) was synthesized and used as template for error-prone PCR-based mutagenesis. The resulting mutagenized library underwent three rounds of selection and amplification where the phage was negatively selected against KRAS(WT)-HLA-A2 monomer prior to positive selection against KRAS(G12V)-HLA-A2 monomer and subsequent amplification. Following selection and amplication, potential phage were isolated, sequenced, and tested via ELISA. To identify higher affinity D10 variants. Eight clones were identified as having higher affinity to KRAS(G12V)-HLA-A2 with no KRAS(WT)-HLA-A2 binding, of which one clone D10-7 (SEQ ID NO: 38) was chosen for further characterization.
[0059] ELISA. Streptavidin-coated, 96-well plates (Thermo Scientific, Walthan, MA) were coated with a 200 nM solution of biotinylated monomers in blocking buffer (PBS with 0.5% BSA, 2 mM EDTA, and 0.1% sodium azide) at 4? C. overnight. Plates were briefly washed with 1?TBST (TBS+0.05% Tween-20). Phage were serially diluted to the specified dilutions in 1?TBST and 100 uL was added to each well. Phage were incubated for 1 hr at RT, followed by vigorous washing (6 washes with 1?TBST using a spray bottle (Fisher Scientific, Waltham, MA). The bound phage were incubated with 100 ?L of rabbit anti-M13 antibody (Pierce, Rockford, IL) diluted 1:2000 in 1?TBST for 1 hr at RT, followed by washing an additional 6? times and incubation with 100 ?L of anti-Rabbit IgG-HRP (Jackson Labs, Bar Harbor, Maine) diluted 1:10,000 in 1?TBST for 45 min at RT. After a final 6 washes with 1?TBST, 100 ?L of TMB substrate (Biolegend, San Diego, CA) was added to the well and the reaction was quenched with 1 N HCl or 2 N sulfuric acid. Absorbance at 450 nm was measured with a SpectraMax Plus 384 plate reader (Molecular Devices, Sunnyvale, CA) or a Synergy H1 Multi-Mode Reader (BioTek, Winooski, VT).
[0060] Monoclonal phage ELISA was performed by selecting individual colonies of SS320 cells transduced with a limiting dilution of phage obtained from the final selection phase. Individual colonies were inoculated into 200 ?l of 2?YT medium containing 100 ?g/mL carbenicillin and 2% glucose and grown for three hours at 37? C. The cells were then infected with 1.6?10.sup.7 M13K07 helper phage (Antibody Design Labs, San Diego, CA) at MOI of 4 in a dep-well 96-well plate and incubated for 30 min at 37? C. with no shaking followed by 30 min of shaking. The cells were pelleted, resuspended in 300 ?L of 2?YT medium containing carbenicillin (100 ?g/mL) and kanamycin (50 ?g/mL) and grown overnight at 30? C. Cells were pelleted and the phage-laden supernatant was used for ELISA as described above. ELISA with purified scFvs was performed essentially as above, with serial dilutions from a starting concentration of 1 ?g/mL and the use of a 1:2000 diluted anti-Flag-HRP antibody (Abcam) for detection. ELISAs with the full-length D10 MANAbody were performed similarly, with serial dilutions from a starting concentration of 1 ?g/mL and a 1:2000 diluted anti-human IgG-HRP antibody as the secondary antibody (Life Technologies). Monomer heat denaturation was first performed by diluting monomer into 100 ?L ddH2O followed by a 5 minute heat block incubation at 100? C.
[0061] scFv Production. Primers were designed to amplify the entire scFv coding region. A Gateway? directional cloning sequence was added to the forward primer to facilitate subcloning into Gateway? entry vectors and an AviTag? sequence was added to the reverse primer to allow for future biotinylation of the recombinant scFv. The clones were sequence verified and recombined into a pET-DEST42 destination vector containing C-terminal V5 and His epitope tags (Life Technologies).
[0062] BL21 DE3 Gold cells transformed with recombinant plasmids were, grown in 1 liter batches to an OD.sub.600 of 1.0 chilled to approximately 20? C. and induced with 500 uM IPTG. Protein was expressed overnight at 20? C. The next morning bacteria were pelleted, resuspended in periplasmic extraction buffer (50 mM Tris pH 7.4, 20% sucrose, 1 mM EDTA, 5 mM MgCl2) and incubated on ice for 30 minutes in the presence of 1/10 volume 1 mg/ml lysozyme. After cells were pelleted at 12,000 g for 30 minutes, the supernatant was filtered through a 22 uM filter (Millipore) and incubated with 1 ml Ni-NTA resin (Qiagen) for one hour. The supernatant and bead mixture were loaded onto a gravity column, washed, and eluted with increasing amounts of imidazole. Samples from each aliquot were run on an SDS polyacrylamide gel and the fractions containing pure protein were dialyzed overnight at 4? C. in 1?PBS pH 7.4. ELISAs were performed per standard protocol to ensure scFv binding capability and specificity using an anti-V5 HRP antibody (Life Technologies).
[0063] Alternatively, scFv sequences were provided to AxioMx Inc., subcloned into a vector containing a periplasmic localization sequence, and N-terminal Flag and C-terminal His tags. scFv was then purified via nickel chromatography.
[0064] Antibody Production. The scFv sequence was grafted on to the trastuzamab (4D5) sequence for recombinant antibody expression. Both heavy and light chain sequences were provided to Geneart. for codon optimization, synthesis, subcloning, and protein production (Geneart, Life Technologies, Carlsbad, CA). An IgG signal sequence was included on each chain for protein expression and antibody secretion using the Expi293? cell culture system. Following 72 hours of protein expression, antibodies from the one liter culture were purified with column chromatography and eluted in 17 mL PBS aliquoted and shipped at 8.25 mg/mL.
[0065] T2 and T2A3 Cell Staining. For peptide pulsing, T2 and T2A3 cells were washed once in 50 mL PBS and once in 50 mL RPMI-1640 without serum before incubation at 5?10.sup.5 cells per mL in serum-free RPMI-1640 containing 50 ?g/mL peptide and 10 ?g/mL human beta-2 microglobulin (ProSpec, East Brunswick, NJ) for 4 hr or overnight at 37? C. The pulsed cells were pelleted, washed once in stain buffer (PBS containing 0.5% BSA, 2 mM EDTA, and 0.1% sodium azide) and resuspended in stain buffer. Phage staining was performed at 4? C. with ?1?10.sup.9 phage for 30 min in 200 ul total volume, followed by 3?4 mL rinses in stain buffer by centrifugation at 500 g for 5 min at 6? C. Cells were resuspended in 200 uL stain buffer and stained with 1 uL of rabbit anti-M13 antibody (Pierce, Rockford, IL) on ice for 30 min, followed by three rinses with 4 mL stain buffer. Cells were then resuspended in 200 uL stain buffer and incubated with 1 uL anti-rabbit-Alexa Fluor 488? (Life Technologies) on ice for 30 min, and rinsed an additional three times before analysis. ScFv staining was performed with 1 ?g of scFv for 30 min on ice in 100 uL stain buffer, followed by three rinses in stain buffer at 4? C. Cells were then stained with 1 ?L of mouse anti-V5-FITC (Life Technologies, Grand Island, NY) for 30 min on ice, followed by three rinses in stain buffer at 6 C. Antibody staining was performed by resuspending cells in 100 uL stain buffer, and blocking with 1 ug goat anti-human antibody (Life Technologies) on ice 30 min, followed by three rinses at 4? C. Cells were resuspended in 200 uL stain buffer, and stained with 5 ug of D10 antibody (or isotype control) for 30 min on ice, followed by three rinses. Cells were resuspended in 200 uL stain buffer, and stained with 2 uL goat anti-human-PE antibody (Life Technologies) for 30 min on ice, followed by three rinses. Peptide pulsing was assessed by incubation of pulsed T2 or T2A3 cells with 5 uL of W6/32-PE (Bilegend) in 100 uL of stain buffer, followed by three washes. Stained T2 and T2A3 cells were analyzed using a FACSCalibur or LSRII flow cytometer (Becton Dickinson, Mansfield, MA).
[0066] T2 Cell Complement-Dependent Cytotoxicity. scFvs were conjugated to an anti-V5 mouse monoclonal antibody (Life Technologies, Grand Island, NY) at a 2:1 molar ratio overnight at 4? C. Conjugated scFvs or control anti-HLA antibody W6/32 (Bio-X-Cell) were serially diluted in serum-free RPMI-1640 on ice. Baby rabbit complement (Cedarlane), resuspended with ice cold ddH.sub.2O, was added to the serially diluted antibody conjugates before transferring 60 ?L to a 96-well plate. An additional 40 ?L of pre-chilled peptide-pulsed T2 cells containing 20,000 cells was transferred to the plate and gently mixed. In all cases, a final complement concentration of 10% was used for the assay. The plate was incubated at 37? C. for 1 hr and subsequently read by the CellTiter-Glo? Luminescent Cell Viability Assay (Promega,) as per manufacturer's instructions. Cell death was calculated by first normalizing each of the three cell subtypes (cells pulsed with different peptides or beta-2 microglobulin-only control) to the maximum luciferase signal (no antibody control) followed by subtraction from 100%. Specific cell death was defined as the cell death at a particular antibody concentration divided by the maximum cell death observed after treatment with W6/32 antibody for each of the given three cell subtypes.
[0067] Affinity and k.sub.off Measurements. AlphaScreen? affinity measurements were performed at AxioMx Inc. as follows. Biotinylated KRAS(G12V)-HLA-A2 monomer, unbiotinylated KRAS(G12V)-HLA-A2 monomer, and Flag-tagged D10 scFv were simultaneously added to a solution containing streptavidin-coated Donor beads with an excitation wavelength of 680 nm and Acceptor beads conjugated with an anti-Flag antibody. Stimulation of Acceptor beads is dependent on proximity of Donor beads and results in an excitation between 520-620 nm when both beads are in close proximity. The EC.sub.50, and therefore affinity, of D10 scFv to KRAS(G12V)-HLA-A2 was determined by varying the amounts of competing unbiotinylated monomer and measuring the resulting absorbance.
[0068] To conserve limited amounts of antigen and to expedite screening of new scFvs, we developed an off-rate ELISA-based kinetic assay to measure the k.sub.off, and therefore half-life, of scFv/monomer disassociation. 100 ?L of a 20 nM solution of the respective biotinylated monomer was conjugated to streptavidin-coated 96-well strip plates (R&D Systems). After washing, 100 ?L of a 37.0 nM, 9.3 nM, or 2.3 nM solution of D10 scFv, D10-7 scFv, or C9 scFv were added to the plate and allowed to equilibrate on the monomer-coated wells for 2 hr at 22? C. At various timepoints, one strip of the plate was removed, vigorously washed, and placed into 2 liters of 1?TBST with shaking at 22? C. until all timepoints were complete. After the 0 hr timepoint, allowing for a total of 16 hr of scFv dissociation from the time the first strip was washed, all strips were reassembled on the plate and an ELISA was performed as previously described, using an anti-Flag-HRP antibody and TMB substrate. The half-life was determined by fitting an exponential function (A.sub.t=A.sub.oe.sup.?kt) to the resulting datapoints following background subtraction, and using the first-order reaction equation t.sub.1/2=ln(2)/k. Off-rate estimates for the D10 MANAbody were performed as above with the following exceptions: 100 ?L of a 10 nM of monomer was coated on the plate to allow for a 1:2 ratio of streptavidin complexes to monomer, a lower concentration (1.8 nM) of antibody was used, and the assay was carried out to a 32-hr time point.
[0069] Statistics. All statistical analyses were performed with Prism 5 (GraphPad Software). Unless otherwise indicated, error bars represent the standard deviation of three technical replicates. Statistical significance was performed with an unpaired, two-tailed t-test.
EXAMPLE 2
[0070] Design and construction of an scFv-based phage display-based scFv library. We began these studies with attempts to generate an antibody against a mutant KRAS peptide in mice (basis for this choice described below). Using conventional approaches to derive monoclonal antibodies after mouse immunization, these efforts failed, as no antibodies specifically reactive with the MANAs were identified. We therefore turned to phage display approaches for generating MANAbodies (
[0071] The synthesized oligonucleotide library was cloned into a phagemid vector for scFv expression. This scFv carried a myc tag and was fused to the bacteriophage M13 pIII coat protein through a tobacco etch virus (TEV) cleavage site (
EXAMPLE 3
[0072] Target selection and competitive strategy for identifying selectively reactive phage clones. We chose MANAbody targets based on the frequency of particular mutations and the strength of their predicted binding to HLA alleles. KRAS is one of the most commonly mutated genes in human cancers, with mutations particularly prevalent in pancreatic, colorectal, and lung adenocarcinomas. We chose the G12V mutation as the target because a relevant peptide containing it was predicted to bind with high affinity to the HLA-A2, which is the most common HLA allele in many ethnic groups (32). This in silico prediction was made using the NetMHC v3.4 algorithm (33-35). Additionally, the critical mutant residue (V at codon 12) was expected to be exposed on the surface of the HLA protein based on structural studies of other peptide HLA-complexes (36). The peptide KLVVVGAVGV (SEQ ID NO: 4), in which the valine residue (V) at position 8 represents the G12V mutation, was chemically synthesized by conventional means. Peptides corresponding to the product of a mutant allele will henceforth be termed mutant peptides, while peptides representing the product of a wt allele will be referred to as wt peptides. The mutant KRAS peptide was then folded into a complex (monomer) of HLA-A2 and beta-2-microglobulin [KRAS(G12V)-HLA-A2]. Two peptides corresponding to wt KRAS sequences were also synthesized and folded with HLA-A2 or HLA-A3 to form KRAS(WT)-HLA-A2 and KRAS(WT)-HLA-A3 monomers, respectively. Additional mutant KRAS monomers corresponding to other codon 12 mutations were also assembled. In most cases, monomers were biotinylated to facilitate purification and subsequent experimentation (see Materials and Methods).
[0073] The phage display selection process consisted of 10 rounds of selection and amplification, which were divided into three distinct phases: an enrichment phase (rounds 1-3), a competitive phase (rounds 4-8), and a final selection phase (rounds 9-10) (
[0074] The novel competitive phase described in this study was intended to enrich for the rare mutant KRAS-(G12V)-HLA-A2 binders over KRAS(WT)-HLA-A2 binders and the much more frequent pan-HLA binders that we expected to be present in the library following the enrichment phase. Each round of the competitive phase began with negative selection using denatured HLA-A2 and native HLA-A3 monomers (
EXAMPLE 4
[0075] Evaluation of the selected phage clones. We used an enzyme-linked immunosorbant assay (ELISA) to evaluate the binding of phage to peptide-HLA complexes. After the enrichment phase (
[0076] To produce D10 scFv uncoupled from M13 pIII, single-stranded DNA (ssDNA) from the D10 phage was purified. The scFv portion was amplified by polymerase chain reaction (PCR), sequenced, and cloned into a prokaryotic expression vector containing either a Flag or a V5 epitope tag in addition to a 6?His tag. This facilitated high-level expression and affinity purification of D10 scFv. Similar to the phage expressing D10 scFv:pIII fusion protein, purified D10 scFv interacted with KRAS(G12V)-HLA-A2 in a highly specific fashion (
[0077] Affinity Maturation. The affinity of the D10 scFv for KRAS(G12V)-HLA-A2 was estimated to be 49 nM, using the AlphaScreen? method of affinity measurement (37). We next proceeded to affinity mature D10. Briefly, a library of D10 scFv mutagenized through error-prone PCR was generated from the original D10 scFv sequence and subject to three rounds of selection against the KRAS(G12V)-HLA-A2 and KRAS(WT)-HLA-A2 monomers. Evaluation of the clones yielded a candidate, D10-7, which showed a newly acquired capacity to bind to KRAS(G12C)-HLA-A2, while still retaining the ability to differentiate between mutant and wild type KRAS epitopes (
EXAMPLE 5
[0078] Identification of phage that can bind to a different MANA. To determine whether this approach was applicable to other MANAs, we sought to identify scFvs specific for a mutant EGFR peptide complexed to different HLA allele. The EGFR L858R mutation is found in ?10% of lung adenocarcinomas and accounts for ?40% of all EGFR mutations in this cancer type (39). Codon 858 is in the cytoplasmic domain, rather than the extracellular or membrane domains, of the EGFR protein and normally should not be visible on the cell surface (40). A peptide (KITDFGRAK; SEQ ID NO: 9) containing this mutation was predicted to bind at high-affinity to the HLA-A3 allele when analyzed by the NetMHC v3.4 algorithm. To identify scFvs specific to this peptide-HLA complex, we adopted a modified scheme of selection and amplification in which decreasing concentrations of Isopropyl ?-D-1-thiogalactopyranoside (IPTG) were used to reduce scFv expression in the later rounds. Additionally, the number of rounds in each selection phase was adjusted to favor the enrichment of desired phage rather than the elimination of undesired ones (
EXAMPLE 6
[0079] Selective binding to cells displaying mutant peptides on the cell surface. We next attempted to determine whether the D10 and C9 scFvs would bind to mutant KRAS and EGFR peptide-HLA complexes on the surface of cells. The T2 cell line was derived from an Epstein-Barr virus-transformed human lymphoblast line defective in presentation of endogenous HLA-associated peptide antigens due to a deletion that involves genes for TAP1 and TAP2 peptide transporters (41). T2A3 is a modified version of T2 with stable expression of the HLA-A3 transgene (42, 43). T2 and T2A3 cells express low levels of HLA that can be stabilized by addition of exogenous HLA-binding peptides, and thus can serve as a platform for assaying interactions with specific HLA-binding peptides (44, 45). We first pulsed T2 cells with KRAS(G12V), KRAS(WT), or a negative control peptide. To assess loading efficiency, we used the W6/32 antibody that targets HLA molecules stabilized by any HLA-binding peptides. The efficiency of peptide loading between wild type and mutant peptides were comparable as suggested by anti-W6/32 staining (
[0080] We next sought to determine whether T2 cells pulsed with the mutant KRAS(G12V) peptide could be targeted by D10 scFv and killed in a Complement-Dependent Cytotoxicity (CDC) assay. As a positive control, we pulsed T2 cells with KRAS(G12V) or KRAS(WT), peptides and performed a CDC assay with the W6/32 antibody. As expected, the antibody killed peptide-pulsed T2 cells efficiently in the presence of complement (
EXAMPLE 7
[0081] Generation of a full-length MANAbody. Clinical applications of immunotherapeutic reagents generally employ complete antibodies, including the Fc domain, rather than just the scFv component. Another attribute of complete antibodies is the higher avidity achieved as a result of bivalency of the initially monovalent scFvs. To generate a complete MANAbody from the D10 scFv, we grafted the D10 scFv sequence onto the constant region of the clinically used humanized 4D5 antibody trastuzumab. High levels of expression of the D10 MANAbody were achieved in mammalian cells (139 milligrams of protein per liter of Expi293 cell culture). Similar to the D10 scFv, the D10 MANAbody interacted with KRAS(G12V)-HLA-A2, as assessed by ELISA (
EXAMPLE 8
[0082] Modifications to phage panning protocols. Variations of the phage selection method previously described were performed to identify antibodies against additional HLA-peptide complexes (CTNNB1 S45F) and (EGFR T790M). CTNNB1 is the gene name coding for protein beta-catenin. These names are used interchangeably in this document.
[0083] The first change is the inclusion of cells from cell lines that express the particular HLA allele that is being screened for. However, these cells that do not contain the relevant mutation of interest. We add these cells to the negative selection step that occurs at the beginning of each round (the same step where we interrogate the phage against denatured HLA and naked streptavidin beads). The cells can be added to this step for the first two rounds or for the duration of screening. The purpose of this step is to remove any phage that bind to similar HLA-epitope sequences as our mutant epitope.
[0084] We also demonstrate that by altering the number of rounds of enrichment, competitive, and final selection phases we are able to identify antibodies had not been detected previously. In particular, 0 or 1 rounds of enrichment phase were performed, followed by up to 5 rounds of competitive selection. However, starting after the second round of competitive selection, aliquots of phage were shifted to negative selection at each day (this both shortens the number of rounds of phage selection and allows us to identify scFv candidates that were not present in later rounds of panning).
[0085] After 2, 3, and 4 rounds of competitive selection, phage were subjected to two consecutive rounds of negative selection, resulting in phage that had undergone 4 to 8 rounds of total selection.
[0086] These changes resulted in identifying scFv candidates against beta-catenin/CTNNB1 (S45F)-HLA-A3 and EGFR T790M-HLA-A2 mutations and potentially p53 mutations.
EXAMPLE 9
[0087] KRAS G12V-HLA-A2 clone F10. Phage selection for the F10 clone was carried out as described for C9 phage selection, with the exception that mutant [KRAS(G12V)-HLA-A2] and wild type [KRAS(WT)-HLA-A2] monomers were used. This demonstrates that multiple scFv candidates can be identified for a given HLA complex.
The F10 Clone:
[0088]
TABLE-US-00001 (SEQIDNO:21) DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYS ASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYYYYPPTFGQ GTKVEIKRTGGGSGGGGSGASEVQLVESGGGLVQPGGSLRLSCAASGFNI NSNYIHWVRQAPGKGLEWVAYITPETGYYRYADSVKGRFTISADTSKNTA YLQMNSLRAEDTAVYYCSRNYYSAYAMDVWGQGTLVTVSS
EXAMPLE 10
[0089] Affinity maturation of KRAS F10 clone. As with KRAS D10 clone, the F10 scFv is also able to undergo effective affinity maturation and variants retain their specificity for KRAS mutant over KRAS wild type.
[0090] KRAS(wt)-HLA-A2 signal remains near background, as does the F10 scFv (this is due to the inclusion of an N-terminal epitope tag). F10 affinity matured variants display remarkable binding (as much as a 131-fold increase in mean fluorescence intensity).
scFv Sequences for F10 Affinity Matured Derivatives:
TABLE-US-00002 KRASG12V_F10AM#1 (SEQIDNO:22) DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYS ASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYYYYPPTFGQ GTKVEIKRTGGGSGGGGSGASEVQLVESGGGLVQPGGSLRLSCAASGFNI NSNYIHWVRQAPGKGLEWVAYITPETGYYHYADSVKGRFTISADTSKNTA YLQMNSLRAEDTAVYYCSRNYYSAYAMDVWGQGTLVTVSS KRASG12V_F10AM#2 (SEQIDNO:23) DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYG ASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYYYYPPTFGQ GTKVEIKRTGGGSGGGGSGASEVQLVESGGGLVQPGGSLRLSCAASGFYI NSNYIHWVRQAPGKGLEWVAYITPETGYYHYADSVKGRFTISADTSKNTA YLQMNSLRAEDTAVYYCSRNYYSAYAMDVWGQGTLVTVSS KRASG12V_F10AM#3 (SEQIDNO:24) DIQMSQSPSSLSASVGDRVTITCRTSQDANTAVAWYQQKPGKAPKLLFYS ASFLFSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYYYYPPTFGQ GTKVEIKRTGGGSGGGGSGASEVQLVESGGGLVQPGGSLRLSCAASGFNI NSNYIHWVRQAPGKGLEWVAYITPETGYYRYADSVKGRFTISADTSKNTA YLQMNSLRAEDTAVYYCSRNYYSAYAMDVWGQGTLVTVSS
EXAMPLE 11
[0091] CTNNB1 (S45F)-HLA-A3 oncogenic mutation (TTAPFLSGK; SEQ ID NO: 27). Mutations at residue 45 of the protein product of CTNNB1 (beta-catenin) are the second most common in the oncogene. (The S->F mutation is the most prevalent Amino acid change). Identifying an antibody against S45F also suggests that antibody derivatives against S45P are possible. Additionally the T41A mutation, which is the most common CTNNB1 mutation, is also predicted to bind HLA-A3 with the same amino acid coordinates (ATAPSLSGK; SEQ ID NO: 36). This demonstrates the feasibility of targeting this mutation as well.
[0092] Changes to panning for beta-catenin/CTNNB1 S4F5 and EGFR T790M mutations are described below. This demonstrates the flexibility inherent in the competition based screening.
The E10 scFv Sequence:
TABLE-US-00003 (SEQIDNO:16) DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYS ASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSYYSPPTFGQ GTKVEIKRTGGGSGGGASEVQLVESGGGLVQPGGSLRLSCAASGFNINNT YIHWVRQAPGKGLEWVASIYPTDGYTRYADSVKGRFTISADTSKNTAYLQ MNSLRAEDTAVYYCSRTYYSYYSAMDVWGQGTLVTVSS
[0093] W6/32 data shows an increase in antibody binding over b2m (negative control) showing that the peptide is presented by HLA-A3 complexes. E10 phage staining shows that the scFv binds specifically to S45F epitopes (80,400 k MFIs) over control peptides (600-800 MFI).
[0094] Phage clone E10 is specific to CTNNB S45F peptide-pulsed cells.
EXAMPLE 12
[0095] EGFR T790M. The EGFR T790M mutation is the second most frequent EGFR mutation (after L858R). This is a significant mutation because it appears frequently in response to anti-EGFR therapies as a resistance mutation. Additionally evidence in the literature suggests that the T790M mutation is endogenously processed and presented on tumor cells by HLA-A2 complexes (as both 9 and 10 amino acid epitopes).
[0096] The 9 amino acid mutant epitope is:
[0097] IMQLMPFGC (SEQ ID NO: 28; mutant residue T->M is underlined and bolded)
[0098] The 10 amino acid mutant epitope is:
[0099] LIMQLMPFGC (SEQ ID NO: 29; mutant residue T->M is underlined and bolded)
EXAMPLE 13
[0100] Phage Selection. Phage selection was done as described above. Potential candidates (with different scFv sequences) from two and three and four days of competitive selection (followed by two days of negative selection) were identified. These candidates are referred to as D2D6, D3E6, D2D8. D3E6 looked the most promising among this cohort.
The D3E6 scFv Sequence is:
TABLE-US-00004 (SEQIDNO:18) DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYS ASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYYYYPPTFGQ GTKVEIKRTGGGSGGGGSGGGASEVQLVESGGGLVQPGGSLRLSCAASGF NISTSYIHWVRQAPGKGLEWVATIDPNDGYSRYADSVKGRFTISADTSKN TAYLQMNSLRAEDTAVYYCSRTNNTAADAMDVWGQGTLVTVSS
The D2D6 scFv Sequence is:
TABLE-US-00005 (SEQIDNO:40) DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYS ASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSYYSPPTFGQ GTKVEIKRTGGGSGGGGSGGGASEVQLVESGGGLVQPGGSLRLSCAASGF NITSSYIHWVRQAPGKGLEWVAYISPADGYNRYADSVKGRFTISADTSKN TAYLQMNSLRAEDTAVYYCSRTDSTAYTAMDVWGQGTLVTVSS
The D2D8 scFv Sequence is:
TABLE-US-00006 (SEQIDNO:41) DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYS ASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYYSYPPTFGQ GTKVEIKRTGGGSGGGGSGGGASEVQLVESGGGLVQPGGSLRLSCAASGF NINSSYIHWVRQAPGKGLEWVAYISPTDGYYRYADSVKGRFTISADTSKN TAYLQMNSLRAEDTAVYYCSRTSDTSYAAMDVWGQGTLVTVSS
EXAMPLE 14
[0101] p53 R248W Clones. TP53 is the most commonly mutated gene in cancer. We have obtained scFVs capable of binding to the p53 R248W mutation. We are currently testing their specificity, but demonstrate that antibodies against this epitope may be obtained. Another common mutation p53 R248Q, which is identical in sequence except for the W to Q change, binds in a similar fashion to HLA-A2.
Clone D2F2 Sequence:
[0102]
TABLE-US-00007 (SEQIDNO:25) DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYS ASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSYSSPPTFGQ GTKVEIKRTGGGSGGGASEVQLVESGGGLVQPGGSLRLSCAASGFNINDT YIHWVRQAPGKGLEWVAYISPASGNSRYADSVKGRFTISADTSKNTAYLQ MNSLRAEDTAVYYCSRSYAAMDVWGQGTLVTVSS
EXAMPLE 15
[0103] ABL1 E255K mutation (KVYEGVWKK; SEQ ID NO: 26). ABL1 is mutated in ?30% of all CMLs. E255K mutation confers drug resistance to imatinab and nilotinab. The mutation is predicted to reside at position 1 within the epitope. This makes it very difficult for an antibody or TCR to distinguish between mutant and wild type. However, the predicted affinity of HLA-A3 for the mutant epitope is 10-fold higher than the predicted wild type affinity (29 nM vs. 228 nM). Additionally, proteolytic processing of epitopes with different N-terminal amino acids may results in different cleavage products, thus affecting endogenous presentation. This suggests that scFv recognition of both mutant and wild type epitopes (with mutations at position 1) may not hinder in vivo mutant epitope specificity.
TABLE-US-00008 Abl1E255K_hit1 (SEQIDNO:14) MASDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLL IYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYYSSPPT FGQGTKVEIKRTGGGSGGGGSGGGASEVQLVESGGGLVQPGGSLRLSCAA SGFNINSSSIHWVRQAPGKGLEWVASIAPARGSTRYADSVKGRFTISADT SKNTAYLQMNSLRAEDTAVYYCSRNYYAYTAMDVWGQGTLVTVSS Abl1E255K_hit2 (SEQIDNO:15) DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYS ASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYSSSPPTFGQ GTKVEIKRTGGGSGGGASEVQLVESGGGLVQPGGSLRLSCAASGFNINTS YIHWVRQAPGKGLEWVASIYPNDGYNRYADSVKGRFTISADTSKNTAYLQ MNSLRAEDTAVYYCSRAAYAMDVWGQGTLVTVSS
References
[0104] The disclosure of each reference cited is expressly incorporated herein. [0105] 1. Fearon E R & Vogelstein B (1990) A genetic model for colorectal tumorigenesis. Cell 61(5):759-767. [0106] 2. Vogelstein B, et al. (2013) Cancer genome landscapes. Science 339(6127):1546-1558. [0107] 3. Tsai J, et al. (2008) Discovery of a selective inhibitor of oncogenic B-Raf kinase with potent antimelanoma activity. Proc Natl Acad Sci USA 105(8):3041-3046. [0108] 4. Halilovic E & Solit D B (2008) Therapeutic strategies for inhibiting oncogenic BRAF signaling. Curr Opin Pharmacol 8(4):419-426. [0109] 5. Bradbury A R, Sidhu S, Dubel S, & McCafferty J (2011) Beyond natural antibodies: the power of in vitro display technologies. Nat Biotechnol 29(3):245-254. [0110] 6. Sliwkowski M X & Mellman I (2013) Antibody therapeutics in cancer. Science 341(6151): 1192-1198. [0111] 7. Weiner L M, Surana R, & Wang S (2010) Monoclonal antibodies: versatile platforms for cancer immunotherapy. Nature reviews. Immunology 10(5):317-327. [0112] 8. Ayriss J, Woods T, Bradbury A, & Pavlik P (2007) High-throughput screening of single-chain antibodies using multiplexed flow cytometry. J Proteome Res 6(3): 1072-1082. [0113] 9. Kato Y, et al. (2009) A monoclonal antibody IMab-1 specifically recognizes IDH1R132H, the most common glioma-derived mutation. Biochem Biophys Res Commun 390(3):547-551. [0114] 10. Yu J, et al. (2009) Mutation-specific antibodies for the detection of EGFR mutations in non-small-cell lung cancer. Clin Cancer Res 15(9):3023-3028. [0115] 11. Roblek M, et al. (2010) Monoclonal antibodies specific for disease-associated point-mutants: lamin A/C R453W and R482W. PLOS One 5(5):e10604. [0116] 12. Segal N H, et al. (2008) Epitope landscape in breast and colorectal cancer. Cancer Res 68(3):889-892. [0117] 13. Rahma O E, et al. (2014) The immunological and clinical effects of mutated ras peptide vaccine in combination with IL-2, GM-CSF, or both in patients with solid tumors. Journal of translational medicine 12:55. [0118] 14. Abrams S I, Hand P H, Tsang K Y, & Schlom J (1996) Mutant ras epitopes as targets for cancer vaccines. Semin Oncol 23(1):118-134. [0119] 15. Gubin M M, et al. (2014) Checkpoint blockade cancer immunotherapy targets tumour-specific mutant antigens. Nature 515(7528):577-581. [0120] 16. Castle J C, et al. (2012) Exploiting the mutanome for tumor vaccination. Cancer Res 72(5): 1081-1091. [0121] 17. Vonderheide R H & June C H (2014) Engineering T cells for cancer: our synthetic future. Immunol Rev 257(1):7-13. [0122] 18. Schreiber R D, Old L J, & Smyth M J (2011) Cancer immunoediting: integrating immunity's roles in cancer suppression and promotion. Science 331(6024): 1565-1570. [0123] 19. Robbins P F, et al. (2013) Mining exomic sequencing data to identify mutated antigens recognized by adoptively transferred tumor-reactive T cells. Nat Med 19(6): 747-752. [0124] 20. Yadav M, et al. (2014) Predicting immunogenic tumour mutations by combining mass spectrometry and exome sequencing. Nature 515(7528):572-576. [0125] 21. Bondgaard A L, Hogdall E, Mellemgaard A, & Skov B G (2014) High specificity but low sensitivity of mutation-specific antibodies against EGFR mutations in non-small-cell lung cancer. Mod Pathol 27(12): 1590-1598. [0126] 22 Sidhu S S, et al. (2004) Phage-displayed antibody libraries of synthetic heavy chain complementarity determining regions. J Mol Biol 338(2):299-310. [0127] 23. Carter P, et al. (1992) Humanization of an anti-p185HER2 antibody for human cancer therapy. Proc Natl Acad Sci USA 89(10):4285-4289. [0128] 24. Bostrom J & Fuh G (2009) Design and construction of synthetic phage-displayed Fab libraries. Methods in molecular biology 562:17-35. [0129] 25. Eigenbrot C, Randal M, Presta L, Carter P, & Kossiakoff A A (1993) X-ray structures of the antigen-binding domains from three variants of humanized anti-p185HER2 antibody 4D5 and comparison with molecular modeling. J Mol Biol 229(4): 969-995. [0130] 26. Fellouse F A, et al. (2007) High-throughput generation of synthetic antibodies from highly functional minimalist phage-displayed libraries. J Mol Biol 373(4):924-940. [0131] 27. Koide S & Sidhu S S (2009) The importance of being tyrosine: lessons in molecular recognition from minimalist synthetic binding proteins. ACS chemical biology 4(5): 325-334. [0132] 28. Kuroda D, Shirai H, Kobori M, & Nakamura H (2008) Structural classification of CDR-H3 revisited: a lesson in antibody modeling. Proteins 73(3):608-620. [0133] 29. Kunik V, Peters B, & Ofran Y (2012) Structural consensus among antibodies defines the antigen binding site. PLoS computational biology 8(2):e1002388. [0134] 30. Sela-Culang I, Kunik V, & Ofran Y (2013) The structural basis of antibody-antigen recognition. Frontiers in immunology 4:302. [0135] 31. Kinde I, Wu J, Papadopoulos N, Kinzler K W, & Vogelstein B (2011) Detection and quantification of rare mutations with massively parallel sequencing. Proc Natl Acad Sci USA 108(23):9530-9535. [0136] 32. Ellis J M, et al. (2000) Frequencies of HLA-A2 alleles in five U.S. population groups. Predominance Of A*02011 and identification of HLA-A*0231. Human immunology 61(3):334-340. [0137] 33. Nielsen M, et al. (2003) Reliable prediction of T-cell epitopes using neural networks with novel sequence representations. Protein science: a publication of the Protein Society 12(5):1007-1017. [0138] 34. Lundegaard C, et al. (2008) NetMHC-3.0: accurate web accessible predictions of human, mouse and monkey MHC class I affinities for peptides of length 8-11. Nucleic Acids Res 36(Web Server issue):W509-512. [0139] 35. Lundegaard C, Lund O, & Nielsen M (2008) Accurate approximation method for prediction of class I MHC affinities for peptides of length 8, 10 and 11 using prediction tools trained on 9mers. Bioinformatics 24(11): 1397-1398. [0140] 36. Bouvier M, Guo H C, Smith K J, & Wiley D C (1998) Crystal structures of HLA-A*0201 complexed with antigenic peptides with either the amino- or carboxyl-terminal group substituted by a methyl group. Proteins 33(1):97-106. [0141] 37. Miller, M. D., et al. (2005). A human monoclonal antibody neutralizes diverse HIV-1 isolates by binding a critical gp41 epitope. Proc Natl Acad Sci USA 102(41): 14759-14764. [0142] 38. Ylera, F., et al. (2013). Off-rate screening for selection of high-affinity anti-drug antibodies. Anal Biochem 441(2): 208-213. [0143] 39. D'Angelo S P, et al. (2011) Incidence of EGFR exon 19 deletions and L858R in tumor specimens from men and cigarette smokers with lung adenocarcinomas. J Clin Oncol 29(15):2066-2070. [0144] 40. Sharma S V, Bell D W, Settleman J, & Haber D A (2007) Epidermal growth factor receptor mutations in lung cancer. Nat Rev Cancer 7(3):169-181. [0145] 41. Salter R D, Howell D N, & Cresswell P (1985) Genes regulating HLA class I antigen expression in T-B lymphoblast hybrids. Immunogenetics 21(3):235-246. [0146] 42. Anderson K S, Alexander J, Wei M, & Cresswell P (1993) Intracellular transport of class I MHC molecules in antigen processing mutant cell lines. J Immunol 151(7):3407-3419. [0147] 43. Thomas A M, et al. (2004) Mesothelin-specific CD8(+) T cell responses provide evidence of in vivo cross-priming by antigen-presenting cells in vaccinated pancreatic cancer patients. J Exp Med 200(3):297-306. [0148] 44. Luft T, et al. (2001) Exogenous peptides presented by transporter associated with antigen processing (TAP)-deficient and TAP-competent cells: intracellular loading and kinetics of presentation. J Immunol 167(5):2529-2537. [0149] 45. Brickner A G, et al. (2006) The PANE1 gene encodes a novel human minor histocompatibility antigen that is selectively expressed in B-lymphoid cells and B-CLL. Blood 107(9):3779-3786. [0150] 46. Steinwand M, et al. (2014) The influence of antibody fragment format on phage display based affinity maturation of IgG. mAbs 6(1):204-218. [0151] 47. McConnell A D, et al. (2013) An integrated approach to extreme thermostabilization and affinity maturation of an antibody. Protein engineering, design & selection: PEDS 26(2):151-164. [0152] 48. Miller K R, et al. (2012) T cell receptor-like recognition of tumor in vivo by synthetic antibody fragment. PLoS One 7(8):e43746. [0153] 49. Verma B, et al. (2010) TCR mimic monoclonal antibody targets a specific peptide/HLA class I complex and significantly impedes tumor growth in vivo using breast cancer models. J Immunol 184(4):2156-2165. [0154] 50. Bernal M, et al. (2012) Implication of the ?2-microglobulin gene in the generation of tumor escape phenotypes. Cancer Immunol Immunother 61(9): 1359-71. [0155] 51. Nolan J P, Lauer S, Prossnitz E R, & Sklar L A (1999) Flow cytometry: a versatile tool for all phases of drug discovery. Drug Discov Today 4(4):173-180. [0156] 52. Porgador A, Yewdell J W, Deng Y, Bennink J R, & Germain R N (1997) Localization, quantitation, and in situ detection of specific peptide-MHC class I complexes using a monoclonal antibody. Immunity 6(6):715-726. [0157] 53. Hoof I, van Baarle D, Hildebrand W H, & Kesmir C (2012) Proteome sampling by the HLA class I antigen processing pathway. PLoS computational biology 8(5):e1002517. [0158] 54. Wang W, et al. (1997) A naturally processed peptide presented by HLA-A*0201 is expressed at low abundance and recognized by an alloreactive CD8+ cytotoxic T cell with apparent high affinity. J Immunol 158(12):5797-5804. [0159] 55. de Verteuil D, Granados D P, Thibault P, & Perreault C (2012) Origin and plasticity of MHC I-associated self peptides. Autoimmunity reviews 11(9):627-635. [0160] 56. Stone J D, Aggen D H, Schietinger A, Schreiber H, & Kranz D M (2012) A sensitivity scale for targeting T cells with chimeric antigen receptors (CARs) and bispecific T-cell Engagers (BiTEs). Oncoimmunology 1(6):863-873. [0161] 57. Jena B, Dotti G, & Cooper L J (2010) Redirecting T-cell specificity by introducing a tumor-specific chimeric antigen receptor. Blood 116(7):1035-1044. [0162] 58. Kershaw M H, Westwood J A, Slaney C Y, & Darcy P K (2014) Clinical application of genetically modified T cells in cancer therapy. Clinical & translational immunology 3(5):e16. [0163] 59. Link B K, et al. (1998) Anti-CD3-based bispecific antibody designed for therapy of human B-cell malignancy can induce T-cell activation by antigen-dependent and antigen-independent mechanisms. Int J Cancer 77(2):251-256. [0164] 60. Thakur A & Lum L G (2010) Cancer therapy with bispecific antibodies: Clinical experience. Current opinion in molecular therapeutics 12(3):340-349.