3'3' CYCLIC DINUCLEOTIDES CONTAINING ISONUCLEOTIDIC UNITS

20240166681 ยท 2024-05-23

    Inventors

    Cpc classification

    International classification

    Abstract

    The present disclosure relates to 33 cyclic dinucleotides containing isonucleotidic units, their pharmaceutically acceptable salts, their pharmaceutical composition and combinations of substances and other medicaments or pharmaceuticals. The disclosure also relates to the compounds for the treatment or prevention of diseases or conditions modifiable by STING protein modulation, such as cancer or viral, allergic and inflammatory diseases. In addition, these substances can be used as adjuvants in vaccines.

    Claims

    1. A compound of formula (J): ##STR00048## or an enantiomer, hydrate, solvate, or pharmaceutically acceptable salt or addition salt thereof, wherein Y.sup.1 and Y.sup.2 are each independently O or CH.sub.2; X.sup.1 and X.sup.3 are each independently OH, SH, OR.sup.15, or SR.sup.15; X.sup.2 and X.sup.4 are each independently O or S; RB.sup.1 is selected from Base and H, RB.sup.2 is selected from Base and H, wherein one of RB.sup.1 and RB.sup.2 is Base; R.sup.1 is H or CN or F or Cl; R.sup.4 is H or OH or F; R.sup.6 is selected from H, CN, N3, F, Cl, COOR.sup.15, CON(R.sup.15).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, OR.sup.15, SR.sup.15, and N(R.sup.15).sub.2; each R.sup.15 is independently H, C(?Z)R.sup.16, C(?Z)OR.sup.16, C(?Z)SR.sup.16, C(?Z)N(R.sup.16).sub.2, CH.sub.2ZC(?Z)R.sup.16, C.sub.1-C.sub.6 alkyl, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, C.sub.3-C.sub.7 cycloalkyl, C.sub.2-C.sub.10 heterocycloalkyl, C.sub.6-C.sub.10 aryl, or C.sub.2-C.sub.10 heteroaryl; each R.sup.16 is independently H, C.sub.1-C.sub.12 alkyl, C.sub.2-C.sub.12 alkenyl, C.sub.2-C.sub.12 alkynyl, C.sub.3-C.sub.7 cycloalkyl, C.sub.2-C.sub.10 heterocycloalkyl, C.sub.6-C.sub.10 aryl, or C.sub.2-C.sub.10 heteroaryl; preferably each R.sup.16 is independently H, C.sub.1-C.sub.6 alkyl, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, C.sub.3-C.sub.7 cycloalkyl, C.sub.2-C.sub.10 heterocycloalkyl, C.sub.6-C.sub.10 aryl, or C.sub.2-C.sub.10 heteroaryl; each Z is independently O or S; Base and Base are each independently: ##STR00049## wherein A.sup.1, A.sup.2, A.sup.3 and A.sup.4 are each independently H, OH, SH, F, Cl, Br, I, NH.sub.2, OR.sup.15, SR.sup.15, NHR.sup.15, N(R.sup.15).sub.2, or R.sup.16; and wherein the C.sub.1-C.sub.6 alkyl, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, C.sub.3-C.sub.7 cycloalkyl, C.sub.2-C.sub.10 heterocycloalkyl, C.sub.6-C.sub.10 aryl, or C.sub.2-C.sub.10 heteroaryl independently in each instance is optionally substituted with 1, 2, or 3 substituents independently selected from OH; SH; NH.sub.2; ?O; ?NH; ?S; halogen; N.sub.3; C.sub.6-C.sub.10 aryl optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, O(C?O)OR.sup.B, O(C?O)R.sup.B, and COOR.sup.B; unsubstituted C.sub.1-C.sub.6 alkyl; unsubstituted C.sub.1-C.sub.6 alkoxy; unsubstituted C.sub.1-C.sub.6 alkylthio; unsubstituted C.sub.1-C.sub.6 alkylamino; unsubstituted C.sub.1-C.sub.6 dialkylamino; CN; O(C?O)OR.sup.B; O(C?O)R.sup.B; and COOR.sup.B; wherein R.sup.B is H or unsubstituted C.sub.1-C.sub.6 alkyl.

    2. The compound according to claim 1, having the structure Ja ##STR00050##

    3. The compound according to claim 1, having the structure I ##STR00051##

    4. The compound according to claim 1, having the structure II ##STR00052##

    5. The compound according to claim 1, having the structure III ##STR00053##

    6. The compound according to claim 1, wherein R.sup.4 is H or F.

    7. The compound according to claim 1, wherein Base and Base are each independently selected from: ##STR00054## wherein A, A.sup.1, A.sup.2, A.sup.3 and A.sup.4 are each independently H, OH, SH, F, Cl, Br, I, NH.sub.2, OR.sup.15, SR.sup.15, NHR.sup.15, N(R.sup.15).sub.2, or R.sup.16.

    8. The compound according to claim 1, wherein Base and Base are each independently selected from: ##STR00055## ##STR00056##

    9. The compound according to claim 1, wherein Base and Base are each independently selected from: ##STR00057##

    10. The compound according to, wherein Base is and Base is ##STR00058## or Base is and Base is ##STR00059## or Base is and Base is ##STR00060##

    11. The compound of claim 1, wherein the compound is selected from: ##STR00061## ##STR00062## ##STR00063## wherein X.sup.1, X.sup.2, X.sup.3, X.sup.4 are as defined in claim 1.

    12. A pharmaceutical composition comprising the compound of claim 1, or an enantiomer, solvate, hydrate, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier, excipient, and/or diluent.

    13. A method of administering a medicament comprising the compound according to claim 1 for treatment to a subject in need thereof.-

    14. The method of treatment comprising the step of administering the compound according to claim 1 for in vivo modulating the activity of STING adaptor protein to induce production of a type I interferon, cytokine and/or chemokine dependent on the STING adaptor protein.

    15. The method of treatment comprising the compound according to claim 1 in treating or preventing a viral infection, hepatitis B virus infection, HIV infection, a coronavirus infection (including SARS-CoV-2 infection), a flavivirus infection, allergic diseases, inflammatory diseases, hyperproliferative disease or cancer in a human or animal.

    16. The method of treatment comprising the compound according to claim 1 for in vitro modulating the activity of STING adaptor protein to induce production of a type I interferon, cytokine and/or chemokine dependent on the STING adaptor protein.

    17. The method of prophylactic treatments according to claim 1 for immunomodulation as a component of an immunomodulating composition.

    18. The method of treatment comprising the component of an immunomodulation composition according to claim 1 as a vaccine adjuvans.

    Description

    DESCRIPTION OF THE INVENTION

    [0009] In an aspect, this disclosure describes novel 33 cyclic di-nucleotides and derivatives thereof that bind to and activate protein STING and, consequently, stimulate the signal transduction pathway that induces interferons and other cytokines/chemokines. One advantage compared to previously disclosed CDNs arises from the replacement of one or both of the nucleotide unit(s) with an isonucleotidea nucleotide with a nucleobase shifted from 1 position to 2. Such compounds may find utility as an anti-viral and anti-cancer agent, act as adjuvants in vaccines or may be used in the treatment of allergic or other inflammatory diseases.

    [0010] In one embodiment, the present disclosure provides a compound of formula (J):

    ##STR00001##

    or an enantiomer, hydrate, solvate, or pharmaceutically acceptable salt or addition salt thereof, wherein [0011] Y.sup.1 and Y.sup.2 are each independently O or CH.sub.2; [0012] X.sup.1 and X.sup.3 are each independently OH, SH, OR.sup.15, or SR.sup.15; [0013] X.sup.2 and X.sup.4 are each independently O or S; [0014] RB.sup.1 is selected from Base and H, [0015] RB.sup.2 is selected from Base and H, [0016] wherein one of RB.sup.1 and RB.sup.2 is Base; [0017] R.sup.1 is H or CN or F or Cl; [0018] R.sup.4 is H or OH or F; [0019] R.sup.6 is selected from H, CN, N.sub.3, F, Cl, COOR.sup.15, CON(R.sup.15).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, OR.sup.15, SR.sup.15, and N(R.sup.15).sub.2; [0020] each R.sup.15 is independently H, C(?Z)R.sup.16, C(?Z)OR.sup.16, C(?Z)SR.sup.16, C(?Z)N(R.sup.16).sub.2, CH.sub.2ZC(?Z)R.sup.16, C.sub.1-C.sub.6 alkyl, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, C.sub.3-C.sub.7 cycloalkyl, C.sub.2-C.sub.10 heterocycloalkyl, C.sub.6-C.sub.10 aryl, or C.sub.2-C.sub.10 heteroaryl; [0021] each R.sup.16 is independently H, C.sub.1-C.sub.12 alkyl, C.sub.2-C.sub.12 alkenyl, C.sub.2-C.sub.12 alkynyl, C.sub.3-C.sub.7 cycloalkyl, C.sub.2-C.sub.10 heterocycloalkyl, C.sub.6-C.sub.10 aryl, or C.sub.2-C.sub.10 heteroaryl; preferably each R.sup.16 is independently H, C.sub.1-C.sub.6 alkyl, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, C.sub.3-C.sub.7 cycloalkyl, C.sub.2-C.sub.10 heterocycloalkyl, C.sub.6-C.sub.10 aryl, or C.sub.2-C.sub.10 heteroaryl; [0022] each Z is independently O or S; [0023] Base and Base are each independently:

    ##STR00002## [0024] wherein [0025] A.sup.1, A.sup.2, A.sup.3 and A.sup.4 are each independently H, OH, SH, F, Cl, Br, I, NH.sub.2, OR.sup.15, SR.sup.15, NHR.sup.15, N(R.sup.15).sub.2, or R.sup.16; and
    wherein the C.sub.1-C.sub.6 alkyl, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, C.sub.3-C.sub.7 cycloalkyl, C.sub.2-C.sub.10 heterocycloalkyl, C.sub.6-C.sub.10 aryl, or C.sub.2-C.sub.10 heteroaryl independently in each instance is optionally substituted with 1, 2, or 3 substituents independently selected from OH; SH; NH.sub.2; ?O; ?NH; ?S; halogen; N.sub.3; C.sub.6-C.sub.10 aryl optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, O(C?O)OR.sup.B, O(C?O)R.sup.B, and COOR.sup.B; unsubstituted C.sub.1-C.sub.6 alkyl; unsubstituted C.sub.1-C.sub.6 alkoxy; unsubstituted C.sub.1-C.sub.6 alkylthio; unsubstituted C.sub.1-C.sub.6 alkylamino; unsubstituted C.sub.1-C.sub.6 dialkylamino; CN; O(C?O)OR.sup.B; O(C?O)R.sup.B; and COOR.sup.B; wherein R.sup.B is H or unsubstituted C.sub.1-C.sub.6 alkyl.

    [0026] In some embodiments of formula (J), R.sup.6 is H.

    [0027] In some embodiments of formula (J), R.sup.15 is CH.sub.2ZC(?Z)R.sup.16.

    [0028] In some embodiments, Y.sup.1 is O and Y.sup.2 is CH.sub.2, or Y.sup.1 is CH.sub.2 and Y.sup.2 is O.

    [0029] In some embodiments, the present disclosure provides a compound of formula (J) for use as a medicament.

    [0030] Preferably, the present disclosure provides a compound of formula (J) for use in treatment of inflammation, allergic and autoimmune diseases, cancer, and diseases caused by viruses such as hepatitis B virus, human immunodeficiency virus, coronaviruses (e.g. SARS-CoV-2) and flaviviruses.

    [0031] In some embodiments, the present disclosure provides a compound of formula (J) for use as component of immunogenic compositions or for use as vaccine adjuvant.

    [0032] In some embodiments, a pharmaceutical composition comprises the compound of formula (J), or an enantiomer, hydrate, solvate, or pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier, excipient, and/or diluent.

    [0033] In some embodiments, the invention provides a method of treating or preventing a disease or disorder, e.g., a method of treating or preventing a viral infection, hepatitis B virus infection, HIV infection, coronavirus infection, flavivirus infection, hyperproliferative disease or cancer, comprises administering to a human or animal in need thereof a therapeutically effective amount of a compound of formula (J), or an enantiomer, hydrate, solvate, or pharmaceutically acceptable salt thereof, or a pharmaceutical composition of any of the foregoing.

    [0034] In some embodiments, the invention provides a method of enhancing the efficacy of a vaccine comprises administering a therapeutically effective amount of a compound of formula (J), or an enantiomer, hydrate, solvate, or pharmaceutically acceptable salt thereof, or a pharmaceutical composition of any of the foregoing.

    [0035] In some embodiments, the invention provides a method of modulating the activity of STING adaptor protein to induce production of a type I interferon, cytokine and/or chemokine dependent on the STING adaptor protein, e.g., inducing a STING adaptor protein-dependent type I interferon, cytokine or chemokine in a human or animal, comprises administering a therapeutically effective amount of a compound of Formula (J), or an enantiomer, hydrate, solvate, or pharmaceutically acceptable salt thereof, or a pharmaceutical composition of any of the foregoing.

    [0036] The disclosure provides novel 33 cyclic dinucleotides, comprising at least one isonucleotidic unit, that bind to and modulate the activity of, e.g., activate, the STING protein. The dinucleotides have at least one nucleobase shifted from a C-1 position to a C-2 position of a sugar ring as a difference to naturally occurring nucleotides.

    [0037] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. A dash at the front or end of a chemical group is a matter of convenience to indicate the point of attachment to a parent moiety; chemical groups may be depicted with or without one or more dashes without losing their ordinary meaning. A prefix such as C.sub.u-v or C.sub.u-C.sub.v indicates that the following group has from u to v carbon atoms, where u and v are integers. For example, C.sub.1-6alkyl or C.sub.1-C.sub.6 alkyl indicates that the alkyl group has from 1 to 6 carbon atoms.

    [0038] Alkyl is a linear or branched saturated monovalent hydrocarbon. For example, an alkyl group can have 1 to 12 carbon atoms (i.e., C.sub.1-12 alkyl) or 1 to 8 carbon atoms (i.e., C.sub.1-8 alkyl) or 1 to 6 carbon atoms (i.e., C.sub.1-6 alkyl) or 1 to 4 carbon atoms (i.e., C.sub.1-4 alkyl). Examples of alkyl groups include, but are not limited to, methyl (Me, CH.sub.3), ethyl (Et, CH.sub.2CH.sub.3), 1-propyl (n-Pr, n-propyl, CH.sub.2CH.sub.2CH.sub.3), 2-propyl (i-Pr, i-propyl, CH(CH.sub.3).sub.2), 1-butyl (n-Bu, n-butyl, CH.sub.2CH.sub.2CH.sub.2CH.sub.3), 2-methyl-1-propyl (i-Bu, i-butyl, CH.sub.2CH(CH.sub.3).sub.2), 2-butyl (s-Bu, s-butyl, CH(CH.sub.3)CH.sub.2CH.sub.3), 2-methyl-2-propyl (t-Bu, t-butyl, C(CH.sub.3).sub.3), 1-pentyl (n-pentyl, CH.sub.2CH.sub.2CH.sub.2CH.sub.2CH.sub.3), 2-pentyl (CH(CH.sub.3)CH.sub.2CH.sub.2CH.sub.3), 3-pentyl (CH(CH.sub.2CH.sub.3).sub.2), 2-methyl-2-butyl (C(CH.sub.3).sub.2CH.sub.2CH.sub.3), 3-methyl-2-butyl (CH(CH.sub.3)CH(CH.sub.3).sub.2), 3-methyl-1-butyl (CH.sub.2CH.sub.2CH(CH.sub.3).sub.2), 2-methyl-1-butyl (CH.sub.2CH(CH.sub.3)CH.sub.2CH.sub.3), 1-hexyl (CH.sub.2CH.sub.2CH.sub.2CH.sub.2CH.sub.2CH.sub.3), 2-hexyl (CH(CH.sub.3)CH.sub.2CH.sub.2CH.sub.2CH.sub.3), 3-hexyl (CH(CH.sub.2CH.sub.3)(CH.sub.2CH.sub.2CH.sub.3)), 2-methyl-2-pentyl (C(CH.sub.3).sub.2CH.sub.2CH.sub.2CH.sub.3), 3-methyl-2-pentyl (CH(CH.sub.3)CH(CH.sub.3)CH.sub.2CH.sub.3), 4-methyl-2-pentyl (CH(CH.sub.3)CH.sub.2CH(CH.sub.3).sub.2), 3-methyl-3-pentyl (C(CH.sub.3)(CH.sub.2CH.sub.3).sub.2), 2-methyl-3-pentyl (CH(CH.sub.2CH.sub.3)CH(CH.sub.3).sub.2), 2,3-dimethyl-2-butyl (C(CH.sub.3).sub.2CH(CH.sub.3).sub.2), 3,3-dimethyl-2-butyl (CH(CH.sub.3)C(CH.sub.3).sub.3), and octyl ((CH.sub.2).sub.7CH.sub.3).

    [0039] Alkoxy refers to the group O-alkyl, where alkyl is as defined above. For example, C.sub.1-4alkoxy refers to an O-alkyl group having 1 to 4 carbons.

    [0040] Alkenyl is a linear or branched monovalent hydrocarbon radical with at least one carbon-carbon double bond. For example, an alkenyl group can have 2 to 8 carbon atoms (i.e., C.sub.2-8 alkenyl) or 2 to 6 carbon atoms (i.e., C.sub.2-6 alkenyl) or 2 to 4 carbon atoms (i.e., C.sub.2-4 alkenyl). Examples of alkenyl groups include, but are not limited to, ethenyl (CH?CH.sub.2), allyl (CH.sub.2CH?CH.sub.2), and CH.sub.2CH?CHCH.sub.3. Alkenyl groups can be unsubstituted or substituted.

    [0041] Alkynyl is a linear or branched monovalent hydrocarbon radical with at least one carbon-carbon triple bond. For example, an alkynyl group can have 2 to 8 carbon atoms (i.e., C.sub.2-8 alkynyl) or 2 to 6 carbon atoms (i.e., C.sub.2-6 alkynyl) or 2 to 4 carbon atoms (i.e., C.sub.2-4 alkynyl). Examples of alkynyl groups include, but are not limited to, acetylenyl (C?CH), propargyl (CH.sub.2C?CH), and CH.sub.2C?CCH.sub.3. Alkynyl groups can be unsubstituted or substituted.

    [0042] Alkylamino is HNR.sub.b group, where R.sub.b is an alkyl.

    [0043] Alkylthio is SR.sub.b group, where R.sub.b is an alkyl.

    [0044] Halo or halogen as used herein refers to fluoro (F), chloro (Cl), bromo (Br) and iodo (I).

    [0045] Aryl as used herein refers to a single all carbon aromatic ring or a multiple condensed all carbon ring system wherein at least one of the rings is aromatic. For example, in certain embodiments, an aryl group has 6 to 20 carbon atoms, 6 to 14 carbon atoms, or 6 to 12 carbon atoms. Aryl includes a phenyl radical. Aryl also includes multiple condensed ring systems (e.g., ring systems comprising 2, 3 or 4 rings) having about 9 to 20 carbon atoms in which at least one ring is aromatic and wherein the other rings may be aromatic or not aromatic (i.e., carbocycle). Such multiple condensed ring systems are optionally substituted with one or more (e.g., 1, 2 or 3) oxo groups on any carbocycle portion of the multiple condensed ring system. The rings of the multiple condensed ring system can be connected to each other via fused, spiro and bridged bonds when allowed by valency requirements. Non-limiting examples of aryl groups include, but are not limited to, phenyl, indenyl, naphthyl, 1,2,3,4-tetrahydronaphthyl, anthracenyl, and the like. Aryl groups can be unsubstituted or substituted.

    [0046] Heteroaryl as used herein refers to a single aromatic ring that has at least one atom other than carbon in the ring, wherein the atom is selected from the group consisting of oxygen, nitrogen and sulfur; heteroaryl also includes multiple condensed ring systems that have at least one such aromatic ring, which multiple condensed ring systems are further described below. Thus, heteroaryl includes single aromatic rings of from about 1 to 6 carbon atoms and about 1-4 heteroatoms selected from the group consisting of oxygen, nitrogen and sulfur. The sulfur and nitrogen atoms may also be present in an oxidized form provided the ring is aromatic. Exemplary heteroaryl ring systems include but are not limited to pyridyl, pyrimidinyl, oxazolyl or furyl. Heteroaryl also includes multiple condensed ring systems (e.g., ring systems comprising 2, 3 or 4 rings) wherein a heteroaryl group, as defined above, is condensed with one or more rings selected from heteroaryls (to form for example 1,8-naphthyridinyl), heterocycles, (to form for example 1,2,3,4-tetrahydro-1,8-naphthyridinyl), carbocycles (to form for example 5,6,7,8-tetrahydroquinolyl) and aryls (to form for example indazolyl) to form the multiple condensed ring system. Thus, a heteroaryl (a single aromatic ring or multiple condensed ring system) has about 1-20 carbon atoms and about 1-6 heteroatoms within the heteroaryl ring. Such multiple condensed ring systems may be optionally substituted with one or more (e.g., 1, 2, 3 or 4) oxo groups on the carbocycle or heterocycle portions of the condensed ring. The rings of the multiple condensed ring system can be connected to each other via fused, spiro and bridged bonds when allowed by valency requirements. It is to be understood that the individual rings of the multiple condensed ring system may be connected in any order relative to one another. It is to be understood that the point of attachment for a heteroaryl or heteroaryl multiple condensed ring system can be at any suitable atom of the heteroaryl or heteroaryl multiple condensed ring system including a carbon atom and a heteroatom (e.g., a nitrogen). It also to be understood that when a reference is made to a certain atom-range membered heteroaryl (e.g., a 5 to 10 membered heteroaryl), the atom range is for the total ring atoms of the heteroaryl and includes carbon atoms and heteroatoms. For example, a 5-membered heteroaryl would include a thiazolyl and a 10-membered heteroaryl would include a quinolinyl. Exemplary heteroaryls include but are not limited to pyridyl, pyrrolyl, pyrazinyl, pyrimidinyl, pyridazinyl, pyrazolyl, thienyl, indolyl, imidazolyl, oxazolyl, isoxazolyl, thiazolyl, furyl, oxadiazolyl, thiadiazolyl, quinolyl, isoquinolyl, benzothiazolyl, benzoxazolyl, indazolyl, quinoxalyl, quinazolyl, 5,6,7,8-tetrahydroisoquinolinyl benzofuranyl, benzimidazolyl, thianaphthenyl, pyrrolo[2,3-b]pyridinyl, quinazolinyl-4(3H)-one, and triazolyl. Heteroaryl groups can be unsubstituted or substituted.

    [0047] Cycloalkyl refers to a single saturated or partially unsaturated all carbon ring having 3 to 20 annular carbon atoms (i.e., C.sub.3-20 cycloalkyl), for example from 3 to 12 annular atoms, for example from 3 to 10 annular atoms, or 3 to 8 annular atoms, or 3 to 6 annular atoms, or 3 to 5 annular atoms, or 3 to 4 annular atoms. The term cycloalkyl also includes multiple condensed, saturated and partially unsaturated all carbon ring systems (e.g., ring systems comprising 2, 3 or 4 carbocyclic rings). Accordingly, cycloalkyl includes multicyclic carbocyles such as a bicyclic carbocycles (e.g., bicyclic carbocycles having about 6 to 12 annular carbon atoms such as bicyclo[3.1.0]hexane and bicyclo[2.1.1]hexane), and polycyclic carbocycles (e.g tricyclic and tetracyclic carbocycles with up to about 20 annular carbon atoms). The rings of a multiple condensed ring system can be connected to each other via fused, spiro and bridged bonds when allowed by valency requirements. Non-limiting examples of monocyclic cycloalkyl include cyclopropyl, cyclobutyl, cyclopentyl, 1-cyclopent-1-enyl, 1-cyclopent-2-enyl, 1-cyclopent-3-enyl, cyclohexyl, 1-cyclohex-1-enyl, 1-cyclohex-2-enyl and 1-cyclohex-3-enyl. Cycloalkyl groups can be unsubstituted or substituted.

    [0048] Heterocyclyl or heterocycle or heterocycloalkyl as used herein refers to a single saturated or partially unsaturated non-aromatic ring or a non-aromatic multiple ring system that has at least one heteroatom in the ring (i.e., at least one annular heteroatom selected from oxygen, nitrogen, and sulfur). Unless otherwise specified, a heterocyclyl group has from 3 to about 20 annular atoms, for example from 3 to 12 annular atoms, for example from 3 to 10 annular atoms, or 3 to 8 annular atoms, or 3 to 6 annular atoms, or 3 to 5 annular atoms, or 4 to 6 annular atoms, or 4 to 5 annular atoms. Thus, the term includes single saturated or partially unsaturated rings (e.g., 3, 4, 5, 6 or 7-membered rings) having from about 1 to 6 annular carbon atoms and from about 1 to 3 annular heteroatoms selected from the group consisting of oxygen, nitrogen and sulfur in the ring. The rings of the multiple condensed ring (e.g. bicyclic heterocyclyl) system can be connected to each other via fused, spiro and bridged bonds when allowed by valency requirements. Heterocycles include, but are not limited to, azetidine, aziridine, imidazolidine, morpholine, oxirane (epoxide), oxetane, thietane, piperazine, piperidine, pyrazolidine, piperidine, pyrrolidine, pyrrolidinone, tetrahydrofuran, tetrahydrothiophene, dihydropyridine, tetrahydropyridine, quinuclidine, 2-oxa-6-azaspiro [3.3 ]heptan-6-yl, 6-oxa-1-azaspiro [3.3] heptan-1-yl, 2-thia-6-azaspiro [3.3]heptan-6-yl, 2,6-diazaspiro [3.3]heptan-2-yl, 2-azabicyclo [3.1.0]hexan-2-yl, 3-azabicyclo [3.1.0] hexanyl, 2-azabicyclo [2.1.1]hexanyl, 2-azabicyclo [2.2.1]heptan-2-yl, 4-azaspiro[2.4]heptanyl, 5-azaspiro[2.4]heptanyl, and the like. Heterocyclyl groups can be unsubstituted or substituted.

    [0049] Oxo as used herein refers to ?O.

    [0050] Substituted as used herein, and unless defined otherwise in the immediate context, refers to substitution with one or more substituents (e.g., 1, 2, 3, or 4 or more) selected from the group consisting of OH, SH, NH.sub.2, ?O, ?NH, ?S, ?N, halogen, N.sub.3, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 alkylthio, C.sub.1-6 alkylamino, C.sub.1-6 dialkylamino, CN, O(C?O)OR.sup.B, O(C?O)R.sup.B and COOR.sup.B, where R B is hydrogen or C.sub.1 to C.sub.6 alkyl.

    [0051] A compound of the present disclosure includes compounds disclosed herein, for example a compound of the present disclosure includes compounds of Formula (J), (Ja), (Jb), (I), (Ia), (Ib), (IIa), (IIb), (IIIa) and/or (IIIb), including the compounds of the Examples.

    [0052] Treatment or treat or treating as used herein includes one or more of the following: decreasing one or more symptoms resulting from the disease or condition, and/or diminishing the extent of the disease or condition; ameliorating the disease state, delaying the progression of the disease, increasing the quality of life, and/or prolonging survival.

    [0053] Delaying as used herein means to defer, hinder, slow, retard, stabilize and/or postpone development of the disease or condition. As is evident to one skilled in the art, a sufficient or significant delay can, in effect, encompass prevention, in that the individual does not develop the disease or condition.

    [0054] Prevent or prevention or preventing as used herein refers to a regimen that protects against the onset of the disease or disorder such that the clinical symptoms of the disease do not develop. In some instances, prevention may be understood as a reduction of the risk of cancer, but not a complete elimination of the occurrence of a cancer.

    [0055] In certain embodiments, the term preventing HBV infection refers to administering to a subject who does not have a detectable HBV infection an anti-HBV therapeutic substance.

    [0056] Modulation or modulating the activity of a protein, e.g., a STING adaptor protein, as used herein refers to alteration of the activity such that the activity increases or decreases. In some embodiments, the modulation increases the activity.

    [0057] As used herein, the term viral infection or disease caused by virus describes a diseased state in which a virus invades healthy cells, uses the cell's reproductive machinery to multiply or replicate and ultimately lyse the cell resulting in cell death, release of viral particles and the infection of other cells by the newly produced progeny viruses. Latent infection by certain viruses is also a possible result of viral infection.

    [0058] As used herein, the term enhancing refers to any form of increase in the immunogenic activity of an effective dosage of a vaccine as a result of administering to an animal or a human a therapeutically effective dose of a compound of the present disclosure, at any time prior to, simultaneous with, or just after administration to the same animal or human of the effective dosage of a vaccine.

    [0059] At risk individual as used herein refers to an individual who is at risk of developing a condition to be treated. An individual at risk may or may not have detectable disease or condition, and may or may not have displayed detectable disease prior to the treatment of methods described herein. At risk denotes that an individual has one or more so-called risk factors, which are measurable parameters that correlate with development of a disease or condition and are known in the art

    [0060] Therapeutically effective amount or effective amount as used herein refers to an amount that is effective to elicit the desired biological or medical response, including the amount of a compound that, when administered to a subject for treating a disease, is sufficient to effect such treatment for the disease. The effective amount will vary depending on the compound, the disease, and its severity and the age, weight, etc., of the subject to be treated. The effective amount can include a range of amounts. As is understood in the art, an effective amount may be in one or more doses, i.e., a single dose or multiple doses may be required to achieve the desired treatment endpoint. An effective amount may be considered in the context of administering one or more therapeutic agents.

    [0061] In some embodiments, a therapeutically effective amount of a compound provided herein or pharmaceutically acceptable salt thereof, may (i) reduce the number of diseased cells; (ii) reduce tumor size; (iii) inhibit, retard, slow to some extent, and preferably stop the diseased cell infiltration into peripheral organs; (iv) inhibit tumor metastasis; (v) inhibit tumor growth; (vi) prevent or delay occurrence and/or recurrence of a tumor; and/or (vii) relieve to some extent one or more of the symptoms associated with cancer or hyperproliferative disease. In some embodiments, a therapeutically effective amount is sufficient to ameliorate, palliate, lessen, and/or delay one or more of symptoms of cancer or hyperproliferative disease.

    [0062] Pharmaceutically acceptable excipient includes without limitation any adjuvant, carrier, excipient, glidant, sweetening agent, diluent, preservative, dye/colorant, flavor enhancer, surfactant, wetting agent, dispersing agent, suspending agent, stabilizer, isotonic agent, solvent, or emulsifier which has been approved as being acceptable for use in humans or domestic animals.

    [0063] Provided are also pharmaceutically acceptable salts, addition salts, hydrates, solvates, tautomeric forms, polymorphs, and prodrugs of the compounds described herein. Pharmaceutically acceptable or physiologically acceptable refer to compounds, salts, compositions, dosage forms and other materials which are useful in preparing a pharmaceutical composition that is suitable for veterinary or human pharmaceutical use.

    [0064] The compounds described herein may be prepared and/or formulated as pharmaceutically acceptable salts or when appropriate as a free base. Pharmaceutically acceptable salts are non-toxic salts of a free base form of a compound that possesses the desired pharmacological activity of the free base. These salts may be derived from inorganic or organic acids or bases. For example, a compound that contains a basic nitrogen may be prepared as a pharmaceutically acceptable salt by contacting the compound with an inorganic or organic acid. Non-limiting examples of pharmaceutically acceptable salts include sulfates, pyrosulfates, bisulfates, sulfites, bisulfites, phosphates, monohydrogen-phosphates, dihydrogenphosphates, metaphosphates, pyrophosphates, chlorides, bromides, iodides, acetates, propionates, decanoates, caprylates, acrylates, formates, isobutyrates, caproates, heptanoates, propiolates, oxalates, malonates, succinates, suberates, sebacates, fumarates, maleates, butyne-1,4-dioates, hexyne-1,6-dioates, benzoates, chlorobenzoates, methylbenzoates, dinitrobenzoates, hydroxybenzoates, methoxybenzoates, phthalates, sulfonates, methylsulfonates, propylsulfonates, besylates, xylenesulfonates, naphthalene-1-sulfonates, naphthalene-2-sulfonates, phenylacetates, phenylpropionates, phenylbutyrates, citrates, lactates, y-hydroxybutyrates, glycolates, tartrates, and mandelates. Lists of other suitable pharmaceutically acceptable salts are found in Remington: The Science and Practice of Pharmacy, 21.sup.st Edition, Lippincott Wiliams and Wilkins, Philadelphia, Pa., 2006.

    [0065] Examples of pharmaceutically acceptable salts of the compounds disclosed herein also include salts derived from an appropriate base, such as an alkali metal, an alkaline earth metal, ammonium and NX.sub.4.sup.+ (wherein X is C.sub.1-C.sub.4 alkyl). Also included are base addition salts, such as sodium or potassium salts.

    [0066] Provided are also compounds described herein or pharmaceutically acceptable salts, isomers, or a mixture thereof, in which from 1 to n hydrogen atoms attached to a carbon atom may be replaced by a deuterium atom or D, in which n is the number of hydrogen atoms in the molecule.

    [0067] Examples of isotopes that can be incorporated into the disclosed compounds also include isotopes, such as .sup.2H, .sup.3H, .sup.11C, .sup.13C, .sup.14C, .sup.13N , .sup.15N , .sup.1O, .sup.17O, .sup.18O, .sup.31P, .sup.32P, .sup.35S, .sup.18F, .sup.36Cl, .sup.123I, and .sup.125I, respectively. Substitution with positron emitting isotopes, such as .sup.13C, .sup.18F, .sup.15O and .sup.13N, can be useful in Positron Emission Topography (PET) studies for examining substrate receptor occupancy. Isotopically-labeled compounds of Formula (J) can generally be prepared by conventional techniques known to those skilled in the art or by processes analogous to those described in the Examples as set out below using an appropriate isotopically-labeled reagent in place of the non-labeled reagent previously employed.

    [0068] The compounds of the embodiments disclosed herein, or their pharmaceutically acceptable salts may contain one or more asymmetric centers and may thus give rise to enantiomers, diastereomers, and other stereoisomeric forms that may be defined, in terms of absolute stereochemistry, as (R)- or (S)- or, as (D)- or (L)- for amino acids. The present disclosure is meant to include all such possible isomers, as well as their racemic, scalemic and optically pure forms. When the compounds described herein contain olefinic double bonds or other centres of geometric asymmetry, and unless specified otherwise, it is intended that the compounds include both E and Z geometric isomers. Likewise, all tautomeric forms are also intended to be included. Where chirality is not specified but is present, it is understood that the embodiment is directed to either the specific diastereomerically or enantiomerically enriched form; or a racemic or scalemic mixture of such compound(s). As used herein, scalemic mixture is a mixture of stereoisomers at a ratio other than 1:1.

    [0069] Stereoisomer as used herein refers to a compound made up of the same atoms bonded by the same bonds but having different three-dimensional structures, which are not interchangeable. The present disclosure includes enantiomers, which refers to two stereoisomers whose molecules are non-superimposable mirror images of one another.

    [0070] Tautomer as used herein refers to a proton shift from one atom of a molecule to another atom of the same molecule. The present disclosure includes tautomers of any said compounds.

    [0071] Solvate as used herein refers to the result of the interaction of a solvent and a compound. Solvates of salts of the compounds described herein are also provided. Hydrates of the compounds described herein are also provided.

    [0072] Hydrate as used herein refers to a compound of the disclosure that is chemically associated with one or more molecules of water.

    [0073] In one preferred embodiment, the compound of formula (J) is a compound of formula (Ja):

    ##STR00003##

    or an enantiomer, hydrate, solvate, or pharmaceutically acceptable salt or addition salt thereof, wherein [0074] X.sup.1 and X.sup.3 are each independently OH, SH, OR.sup.15 or SR.sup.15; [0075] X.sup.2 and X.sup.4 are each independently O or S; [0076] R.sup.1 is H or CN or F or Cl; [0077] R.sup.4 is H or OH or F; [0078] R.sup.6 is selected from H, CN, N.sub.3, F, Cl, COOR.sup.15, CON(R.sup.15).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, OR.sup.15, SR.sup.15, and N(R.sup.15).sub.2; [0079] each R.sup.15 is independently H, C(?Z)R.sup.16, C(?Z)OR.sup.16, C(?Z)SR.sup.16, C(?Z)N(R.sup.16).sub.2, CH.sub.2ZC(?Z)R.sup.16, C.sub.1-C.sub.6 alkyl, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, C.sub.3-C.sub.7 cycloalkyl, C.sub.2-C.sub.10 heterocycloalkyl, C.sub.6-C.sub.10 aryl, or C.sub.2-C.sub.10 heteroaryl; [0080] each R.sup.16 is independently H, C.sub.1-C.sub.2 alkyl, C.sub.2-C.sub.12 alkenyl, C.sub.2-C.sub.12 alkynyl, C.sub.3-C.sub.7 cycloalkyl, C.sub.2-C.sub.10 heterocycloalkyl, C.sub.6-C.sub.10 aryl, or C.sub.2-C.sub.10 heteroaryl; preferably each R.sup.16 is independently H, C.sub.1-C.sub.6 alkyl, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, C.sub.3-C.sub.7 cycloalkyl, C.sub.2-C.sub.10 heterocycloalkyl, C.sub.6-C.sub.10 aryl, or C.sub.2-C.sub.10 heteroaryl; [0081] each Z is independently O or S; [0082] and the remaining substituents are as defined for formula (J).

    [0083] In some embodiments, the compound of formula (J) has the structure of formula (I):

    ##STR00004##

    or an enantiomer, hydrate, solvate, or pharmaceutically acceptable salt thereof,
    wherein the substituents R.sup.1, R.sup.4, and R.sup.6, X.sup.1, X.sup.2, X.sup.3, X.sup.4 have the meanings as defined for formula (J). Preferably, in formula (I), R.sup.6 is H.

    [0084] In some embodiments of the compound of formula (J), (Ja) and/or (I), X.sup.2 and/or X.sup.4 is/are S and X.sup.1 and/or X.sup.3 is/are OH.

    [0085] In some embodiments of the compound of formula (J), (Ja) and/or (I), X.sup.2 and/or X.sup.4 is/are O and X.sup.1 and/or X.sup.3 is/are SR.sup.15.

    [0086] In some embodiments, the compound of formula (J) has a structure of formula (II):

    ##STR00005##

    or an enantiomer, hydrate, solvate, or pharmaceutically acceptable salt thereof.

    [0087] In some embodiments, the compound of formula (J) has a structure of formula (III):

    ##STR00006##

    or an enantiomer, hydrate, solvate, or pharmaceutically acceptable salt thereof.

    [0088] In some embodiments of the compound of formula (J), (Ja), (I), (II) and/or (III), X.sup.1 and X.sup.3 are each independently OR.sup.15 or SH. In some embodiments, X.sup.1 and X.sup.3 are each independently SR.sup.15 or OR.sup.15. In some embodiments, R.sup.15 is C.sub.1-C.sub.6 alkyl optionally substituted with 1 or 2 O(C?O)OR.sup.B; O(C?O)R.sup.B; or COOR.sup.B, for example, R.sup.15 can be a C.sub.1-C.sub.6 alkyl substituted with a O(C?O)OR.sup.B. In some embodiments, R.sup.B is a C.sub.1-C.sub.6 alkyl, such as methyl, ethyl, n-propyl, isopropyl, n-butyl, tert-butyl, sec-butyl, n-pentyl, n-hexyl, sec-hexyl, or tert-hexyl. In some embodiments, R.sup.15 is CH.sub.2ZC(?Z)R.sup.16, wherein Z is O or S (preferably O) and wherein R.sup.16 is a C.sub.1-C.sub.12 alkyl, such as methyl, ethyl, n-propyl, isopropyl, n-butyl, tert-butyl, sec-butyl, n-pentyl, sec-pentyl, tert-pentyl, n-hexyl, sec-hexyl, tert-hexyl, octyl, or methylcyclohexyl (preferably tert-butyl, tert-pentyl, octyl or methylcyclohexyl).

    [0089] In some embodiments, X.sup.1 and X.sup.3 are each OR.sup.15, wherein R.sup.15 is CH.sub.2 substituted with an O(C?O)R.sup.B, wherein R.sup.B is tert-butyl. In some embodiments, X.sup.1 and X.sup.3 are each OR.sup.15, wherein R.sup.15 is CH.sub.2 substituted with an O(C?O)OR.sup.B, wherein R.sup.B is isopropyl. In some embodiments, X.sup.1 is OH or SH, and X.sup.3 is OH. In some embodiments, X.sup.1 and X.sup.3 are each OH. In some embodiments, X.sup.1 is SH and X.sup.3 is OH.

    [0090] In some embodiments, X.sup.1 and X.sup.3 are each OR.sup.15, wherein R.sup.15 is CH.sub.2OC(?O)R.sup.16, wherein R.sup.16 is C.sub.1-C.sub.12 alkyl or C.sub.3-C.sub.7 cycloalkyl. Preferably, R.sup.16 is tert-butyl, methylcyclohexyl, dimethylpropyl, heptyl, octyl, isopropyl.

    [0091] In some embodiments of the compound of formula (J), (Ja), (I), (II) and/or (III), R.sup.6 is H, OH, CN, N.sub.3, or C.sub.1-C.sub.6 alkyl. In some embodiments, R.sup.6 is H, OH, CN, or C.sub.1-C.sub.6 alkyl. In some embodiments, R.sup.6 is H, OH. In some embodiments, R.sup.6 is H. In some embodiments, R.sup.6 is OH.

    [0092] In some embodiments of the compound of formula (J), (Ja), (I), (II) and/or (III), Base and Base are each independently selected from:

    ##STR00007## [0093] wherein
    A, A.sup.1, A.sup.2, A.sup.3 and A.sup.4 are each independently H, OH, SH, F, Cl, Br, I, NH.sub.2, OR.sup.15, SR.sup.15, NHR.sup.15, N(R.sup.15).sub.2, or R.sup.16.

    [0094] In some embodiments of the compound of formula (J), (Ja), (I), (II) and/or (III), Base and Base are each independently selected from:

    ##STR00008## ##STR00009##

    [0095] In some embodiments, Base is:

    ##STR00010##

    and Base is

    [0096] ##STR00011##

    [0097] In some embodiments, Base is

    ##STR00012##

    and Base is:

    [0098] ##STR00013## ##STR00014##

    [0099] In some embodiments of the compound of formula (J), (Ja), (I), (II) and/or (III), Base and Base are each independently:

    ##STR00015##

    [0100] In some embodiments of the compound of formula (J), (Ja), (I), (II) and/or (III), Base is Base is

    ##STR00016##

    or

    [0101] Base is Base is

    ##STR00017##

    or

    [0102] Base is Base is

    ##STR00018##

    [0103] In some embodiments of the compound of formula (J), the compound has the structure selected from:

    ##STR00019## ##STR00020##

    wherein X.sup.1, X.sup.2, X.sup.3, X.sup.4 are as defined for structure (J);
    or an enantiomer, hydrate, solvate, or pharmaceutically acceptable salt thereof.

    [0104] A compound of the disclosure, e.g, a compound of formula (J), (Ja), (I), (II) and/or (III), can be shown in a number of equivalent depictions. For example, a compound of Formula (III) is typically depicted herein as shown above wherein each nucleoside is shown in the 5 to 3-direction from upper left to lower right:

    ##STR00021##

    [0105] The above compound of Formula (III) is equivalent to a compound of Formula (III) as shown below:

    ##STR00022##

    [0106] Further, each of the previous depictions are equivalent to the below depiction of a compound of Formula (III):

    ##STR00023##

    I. COPOSITIONS

    [0107] In certain embodiments, the present disclosure provides a pharmaceutical composition comprising a compound of the present disclosure (e.g. a compound of Formula (J), (Ja), (I), (II) and/or (III)), or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable excipient.

    [0108] In certain embodiments, the pharmaceutical composition comprises one or more additional therapeutic agent, as more fully set forth below.

    [0109] Pharmaceutical compositions comprising the compounds disclosed herein, or pharmaceutically acceptable salts thereof, may be prepared with one or more pharmaceutically acceptable excipients which may be selected in accord with ordinary practice. Tablets may contain excipients including glidants, fillers, binders and the like. Aqueous compositions may be prepared in sterile form, and when intended for delivery by other than oral administration generally may be isotonic. Excipients can include ascorbic acid and other antioxidants, chelating agents such as EDTA, carbohydrates such as dextrin, hydroxyalkylcellulose, hydroxyalkylmethylcellulose, stearic acid and the like. In certain embodiments, the composition is provided as a solid dosage form, including a solid oral dosage form, including capsules, sachets or tablets each containing a predetermined amount of the active ingredient. In one embodiment, the pharmaceutical composition is a tablet.

    [0110] The compositions include those suitable for various administration routes, including oral administration. The compositions may be presented in unit dosage form and may be prepared by any of the methods well known in the art of pharmacy.

    [0111] Pharmaceutical compositions disclosed herein comprise one or more compounds disclosed herein, or a pharmaceutically acceptable salt thereof, together with a pharmaceutically acceptable excipient and optionally other therapeutic agents. Pharmaceutical compositions containing the active ingredient may be in any form suitable for the intended method of administration. When used for oral use for example, tablets, troches, lozenges, aqueous or oil suspensions, dispersible powders or granules, emulsions, hard or soft capsules, syrups or elixirs may be prepared. Compositions intended for oral use may be prepared according to any method known to the art for the manufacture of pharmaceutical compositions and such compositions may contain one or more excipients including sweetening agents, flavoring agents, coloring agents and preserving agents, in order to provide a palatable preparation. Tablets containing the active ingredient in admixture with non-toxic pharmaceutically acceptable excipients which are suitable for manufacture of tablets are acceptable. These excipients may be, for example, inert diluents, such as calcium or sodium carbonate, lactose, lactose monohydrate, croscarmellose sodium, povidone, calcium or sodium phosphate; granulating and disintegrating agents, such as maize starch, or alginic acid; binding agents, such as cellulose, microcrystalline cellulose, starch, gelatin or acacia; and lubricating agents, such as magnesium stearate, stearic acid or talc. Tablets may be uncoated or may be coated by known techniques including microencapsulation to delay disintegration and adsorption in the gastrointestinal tract and thereby provide a sustained action over a longer period. For example, a time delay material such as glyceryl monostearate or glyceryl distearate alone or with a wax may be employed.

    [0112] The amount of active ingredient that may be combined with the inactive ingredients to produce a dosage form may vary depending upon the intended treatment subject and the particular mode of administration. For example, in some embodiments, a dosage form for oral administration to humans may contain approximately 1 to 1000 mg of active material formulated with an appropriate and convenient amount of a pharmaceutically acceptable excipient. In certain embodiments, the pharmaceutically acceptable excipient varies from about 5 to about 95% of the total compositions (weight:weight).

    [0113] The compounds of the present disclosure (also referred to herein as the active ingredients) can be administered by any route appropriate to the condition to be treated. Suitable routes include oral, rectal, nasal, topical (including buccal and sublingual), transdermal, vaginal and parenteral (including subcutaneous, intramuscular, intravenous, intradermal, intratumoral, intrathecal and epidural), and the like. It will be appreciated that the preferred route may vary with for example the condition of the recipient. An advantage of certain compounds disclosed herein is that they are orally bioavailable and can be dosed orally.

    [0114] A compound of the present disclosure may be administered to an individual in accordance with an effective dosing regimen for a desired period of time or duration, such as at least about one month, at least about 2 months, at least about 3 months, at least about 6 months, or at least about 12 months or longer

    [0115] A compound of the present disclosure may be combined with one or more additional therapeutic agents in any dosage amount of the compound of the present disclosure (e.g., from 1 mg to 1000 mg of compound).

    [0116] Kits that comprise a compound of the present disclosure, or an enantiomer, or pharmaceutically acceptable salt thereof, or a pharmaceutical composition containing any of the above, are also included in the present disclosure.

    [0117] In one embodiment, kits comprising a compound of the present disclosure, or an enantiomer, hydrate, solvate, or a pharmaceutically acceptable salt thereof, in combination with one or more (e.g., one, two, three, four, one or two, or one to three, or one to four) additional therapeutic agents are provided.

    [0118] The disclosure further includes a compound of the invention or a pharmaceutical composition as described above for use in modulating STING protein activity, to induce STING-dependent production of type I interferons, cytokines or chemokines.

    [0119] The disclosure further includes a compound of the invention or a pharmaceutical composition as described above for use in treating or preventing viral infection, infection caused by hepatitis B virus, by human immunodeficiency virus, coronaviruses (e.g. SARS-CoV-2) and flaviviruses, allergic diseases, inflammatory diseases, hyperproliferative disease or cancer.

    [0120] In some embodiments, the compound of the invention or the pharmaceutical compositions described above are for use in a human or an animal.

    [0121] The Stimulator of interferon genes (STING) adaptor protein, also known as STING, STING protein, transmembrane protein 173 (TMEM173), MPYS, mediator of IRF3 activation (MITA), or endoplasmic reticulum interferon stimulator (ERIS), is a protein that in humans is encoded by the TMEM173 gene (UniProt code Q86WV6; NCBI Reference Sequences: NP_938023.1 (isoform 1) and NP_001288667 (isoform 2)). STING adaptor protein is believed to function as both a direct cytosolic DNA sensor (CDS) and an adaptor protein in Type I interferon signaling through different molecular mechanisms. STING adaptor protein has been shown to activate downstream transcription factors STAT6 and IRF3 through TBK1, and NF-?B through IKK?, which can effect an antiviral response or innate immune response against an intracellular pathogen. STING adaptor protein plays a role in innate immunity by inducing type I interferon production when cells are infected with intracellular pathogens, such as viruses, mycobacteria and intracellular parasites. Type I interferon, mediated by STING adaptor protein, protects infected cells and nearby cells from local infection by autocrine and paracrine signaling.

    [0122] Activation of STING adaptor protein in turn activates protein kinase TBK1, which subsequently activates downstream transcription factors NF-?B and IRF-3. Activation of STING adaptor protein ultimately is believed to result in the release of type I and III interferons as well as a variety of cytokines and chemokines such as IL-6, TNF-? and INF-?. Accordingly, induction of a STING adaptor protein-dependent type I interferon, cytokine or chemokine in a human or animal results in the activation of one or more of NF-?B, IRF-3, a type I interferon, a type III interferon, IL-6, TNF-?, and INF-? in said human or animal.

    [0123] Viral infections that can be treated or prevented by the compounds of the present disclosure can be any infection caused by a virus, e.g., a virus from the Hepadnaviridae family of viruses, e.g., hepatitis B; or any retrovirus, e.g., an alpharetrovirus, such as Rous sarcoma virus;a coronavirus, such as SARS-CoV-2; a flavivirus, such as Tick-borne encephalitis virus, Dengue virus or Zika virus; a betaretrovirus, such as simian retrovirus; a deltaretrovirus, such as bovine leukemia virus or human T-lymphotrophic virus (HTLV) including HTLV-1, HTLV-2, and HTLV-3; a gammaretrovirus, such as murine leukemia virus or feline leukemia virus; or a lentivirus, such as human immunodeficiency virus (HIV) including HIV-1 and HIV-2, simian immunodeficiency virus, equine infectious anemia virus, bovine immunodeficiency virus, rabbit endogenous lentivirus type K (RELIK), or feline immunodeficiency virus.

    [0124] Hyperproliferative diseases that can be treated or prevented by the compounds of the present disclosure include diseases caused by excessive growth of non-cancer cells. Such conditions include but are not limited to psoriasis, actinic keratoses, and seborrheic keratoses, warts, keloids, and eczema.

    [0125] Cancers that can be treated or prevented by the compounds of the disclosure include solid tumors and lymphomas, including but not limited to adrenal cancer, bladder cancer, bone cancer, brain cancer, breast cancer, colon cancer, colorectal cancer, eye cancer, head-and-neck cancer, kidney cancer such as renal cell carcinoma, liver cancer, lung cancer such as non-small cell lung cancer, ovarian cancer, pancreatic cancer, prostate cancer, skin cancer such as squamous cell carcinoma and melanoma, thyroid cancer, uterine cancer, vaginal cancer, and myeloma such as multiple myeloma. The cancer can be na?ve, or relapsed and/or refractory.

    [0126] In some embodiments, the cancer is Burkitt's lymphoma, Hodgkin's lymphoma, non-Hodgkin's lymphoma (NHL), indolent non-Hodgkin's lymphoma (iNHL), refractory iNHL, multiple myeloma (MM), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), B-cell ALL, acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), myelodysplastic syndrome (MDS), myeloproliferative disease (MPD), mantle cell lymphoma (MCL), follicular lymphoma (FL), Waldestrom's macroglobulinemia (WM), T-cell lymphoma, B-cell lymphoma, diffuse large B-cell lymphoma (DLBCL), or marginal zone lymphoma (MZL). In one embodiment, the cancer is minimal residual disease (MRD). In some embodiments, the cancer is selected from Hodgkin's lymphoma, non-Hodgkin's lymphoma (NHL), indolent non-Hodgkin's lymphoma (iNHL), and refractory iNHL. In some embodiments, the cancer is indolent non-Hodgkin's lymphoma (iNHL). In some embodiments, the cancer is refractory iNHL. In some embodiments, the cancer is chronic lymphocytic leukemia (CLL). In some embodiments, the cancer is diffuse large B-cell lymphoma (DLBCL).

    [0127] In some embodiments, the cancer is a solid tumor selected from the group consisting of pancreatic cancer; bladder cancer; colorectal cancer; breast cancer, including metastatic breast cancer; prostate cancer, including androgen-dependent and androgen-independent prostate cancer; kidney or renal cancer, including, e.g., metastatic renal cell carcinoma; hepatocellular cancer; lung cancer, including, e.g., non-small cell lung cancer (NSCLC), bronchioloalveolar carcinoma (BAC), and adenocarcinoma of the lung; ovarian cancer, including, e.g., progressive epithelial or primary peritoneal cancer; cervical cancer; gastric cancer; esophageal cancer; head and neck cancer, including, e.g., squamous cell carcinoma of the head and neck; melanoma; neuroendocrine cancer, including metastatic neuroendocrine tumors; brain tumors, including, e.g., glioma, anaplastic oligodendroglioma, adult glioblastoma multiforme, and adult anaplastic astrocytoma; bone cancer; and soft tissue sarcoma, hepatic carcinoma, rectal cancer, penile carcinoma, vulval cancer, thyroid cancer, salivary gland carcinoma, endometrial or uterine carcinoma, hepatoma, hepatocellular cancer, liver cancer, gastric or stomach cancer including gastrointestinal cancer, cancer of the peritoneum, squamous carcinoma of the lung, gastroesophagal cancer, biliary tract cancer, gall bladder cancer, colorectal/appendiceal cancer, squamous cell cancer (e.g., epithelial squamous cell cancer).

    [0128] Any of the compounds provided herein may be used to treat cancer at various stages. By way of example, the cancer stage includes but is not limited to early, advanced, locally advanced, remission, refractory, reoccurred after remission and progressive.

    Subjects

    [0129] The compounds of the invention provided herein may be used to treat a subject (e.g., human) who has been diagnosed with or is suspected of having cancer. As used herein, a subject refers to a mammal, including, for example, a human.

    [0130] The disclosure includes a cyclic dinucleotide provided herein, including compounds of the disclosure, or an enantiomer, hydrate, solvate, or pharmaceutically acceptable salt thereof for use as a medicament in a human or animal.

    [0131] In certain embodiments, a method for treating or preventing an infectious disease, a viral infection, hepatitis B infection, HIV infection, cancer, or a hyperproliferative disease in a human having or at risk of having the disease is provided, comprising administering to the human a therapeutically effective amount of a compound disclosed herein, e.g., a compound of Formula (J), (Ja), (I), (II) and/or (III), or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of one or more (e.g., one, two, three, four, one or two, one to three, or one to four) additional therapeutic agents. In one embodiment, a method for treating an infectious disease, a viral infection, hepatitis B infection, HIV infection, coronavirus infection (e.g. SARS-CoV-2), flavivirus infection, cancer, or a hyperproliferative disease in a human having or at risk of having the disease is provided, comprising administering to the human a therapeutically effective amount of a compound disclosed herein, or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of one or more (e.g., one, two, three, four, one or two, one to three, or one to four) additional therapeutic agents.

    EXAMPLES

    [0132] The embodiments are also directed to processes and intermediates useful for preparing the subject compounds or pharmaceutically acceptable salts thereof.

    [0133] Compounds as described herein can be purified by any of the means known in the art, including chromatographic means, such as high performance liquid chromatography (HPLC), preparative thin layer chromatography, flash column chromatography and ion exchange chromatography. Any suitable stationary phase can be used, including normal and reversed phases as well as ionic resins. Most typically the disclosed compounds are purified via silica gel and/or alumina chromatography. See, e.g., Introduction to Modern Liquid Chromatography, 2nd ed., ed. L. R. Snyder and J. J. Kirkland, John Wiley and Sons, 1979; and Thin Layer Chromatography, E. Stahl (ed.), Springer-Verlag, New York, 1969.

    [0134] During any of the processes for preparation of the subject compounds, it may be necessary and/or desirable to protect sensitive or reactive groups on any of the molecules concerned. This may be achieved by means of conventional protecting groups as described in standard works, such as T. W. Greene and P. G. M. Wuts, Protective Groups in Organic Synthesis, 4.sup.th ed., Wiley, New York 2006. The protecting groups may be removed at a convenient subsequent stage using methods known from the art.

    [0135] Exemplary chemical entities useful in methods of the embodiments will now be described by reference to illustrative synthetic schemes for their general preparation herein and the specific examples that follow. Artisans will recognize that, to obtain the various compounds herein, starting materials may be suitably selected so that the ultimately desired substituents will be carried through the reaction scheme with or without protection as appropriate to yield the desired product. Alternatively, it may be necessary or desirable to employ, in the place of the ultimately desired substituent, a suitable group that may be carried through the reaction scheme and replaced as appropriate with the desired substituent. Furthermore, one of skill in the art will recognize that the transformations shown in the schemes below may be performed in any order that is compatible with the functionality of the particular pendant groups. Each of the reactions depicted in the general schemes is preferably run at a temperature from about 0? C. to the reflux temperature of the organic solvent used.

    [0136] The Examples provided herein describe the synthesis of compounds disclosed herein as well as intermediates used to prepare the compounds. It is to be understood that individual steps described herein may be combined. It is also to be understood that separate batches of a compound may be combined and then carried forth in the next synthetic step.

    [0137] The methods of the present disclosure generally provide a specific enantiomer or diastereomer as the desired product, although the stereochemistry of the enantiomer or diastereomer was not determined in all cases. When the stereochemistry of the specific stereocenter in the enantiomer or diastereomer is not determined, the compound is drawn without showing any stereochemistry at that specific stereocenter even though the compound can be substantially enantiomerically or disatereomerically pure.

    [0138] Representative syntheses of compounds of the present disclosure are described in schemes below, and the particular examples that follow.

    [0139] The specific 33-cyclic dinucleotides detailed in the Examples were synthesized according to the general synthetic method described below. Compounds were named using ChemAxon (Budapest, HU) unless otherwise indicated.

    [0140] Analytical HPLC, mass spectra, UV absorbancy and purity of compounds were measured on Waters UPLC-MS system consisted of Waters UPLC H-Class Core System, UPLC PDA detector and Mass spectrometer Waters SQD2. MS method used was ESI+and/or ESI-, cone voltage=30 V, mass detector range 100-1000 Da or 500-1600 Da. Two sets of HPLC conditions were used as indicated: (a) C18 (column: ProntoSIL, Prontopearl C18 SH 2.2 ?m, 100?2.0 mm; LC method: H.sub.2O/CH.sub.3CN, 0.1% formic acid as modifier, gradient 0-100%, run length 7 min, flow 0.5 ml/min) and (b) HILIC (column: SeQuant ZIC-pHILIC, 5 ?m, polymeric, 50?2.1 mm; LC method: CH.sub.3CN/0.01M aqueous ammonium acetate gradient 10-60%, run length 7 min, flow 0.3 ml/min).

    [0141] The abbreviations used in the Examples shown below include the following:

    TABLE-US-00001 Abbreviations Ac Acetyl ACN Acetonitrile AcOH Acetic acid Boc tert-Butylcarbonyl Bz Benzoyl CE 2-cyanoethyl DCA Dichloroacetic acid DCE 1,2-dichloroethane DCM Dichloromethane DIAD Diisopropyl azodicarboxylate DMF Dimethylformamide DMTr 4,4-dimethoxytrityl DMOCP 2-Chloro-5,5-dimethyl-1,3,2-dioxaphosphorinane 2-oxide DMSO Dimethylsulfoxide EtOH Ethanol HILIC Hydrophilic interaction chromatography iPr Isopropyl MeOH Methanol NIS N-Iodosuccinimide Ph Phenyl PNT 4-pentenoyl PNT.sub.2O 4-Pentenoic anhydride POM Pivaloyloxymethyl py Pytidine THF tetrahydrofuran TBHP tert-Butyl hydroperoxide solution TEA Triethylamine TEAB triethylammonium bicarbonate TES Triethylsilane TMS Trimethylsilyl TFA Trifluoroacetic acid FBS Fetal bovine serum HEPES 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid BSA Bovine serum albumin

    Synthesis of (2R,3S,4R)-4-(6-benzamido-9H-purin-9-0-2-(hydroxymethyl)tetrahydrofuran-3-yl hydrogen phosphonate (6)

    [0142] The synthesis of compound 6 from compound 1 was accomplished according to the synthetic scheme depicted in Scheme 3 below, and detailed in the following description.

    ##STR00024##

    6-Chloro-9-46aR,9R,9aS)-2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2-f][1,3,5,2,4]trioxadisilocin-9-yl)-9H-purine (2)

    [0143] A mixture of 1 (1.9 g, 5.05 mmol, Nucleosides Nucleotides & Nucleic Acids, 1997, 16, 67), 6-chlorpurine (1.169 g, 7.58 mmol) and triphenylphospine (2.66 g, 10.1 mmol) in THF (66 mL) was cooled to 0? C. and DIAD (2.02 ml, 10.1 mmol) was added dropwise in 10 minutes. After 30 minutes at ambient temperature was the reaction mixture heated to 65? C. (bath) for 20 h. Volatiles were evaporated and the residue was purified by flash chromatography on silica gel (cyclohexane: ethyl acetate 0.fwdarw.35%). Product was contaminated by triphenylphosphine oxide and was used without further purification in the next step. ESI MS m/z (%): 513.2 (100) [M+H].

    (2R,3S,4R)-4-(6-amino-9H-purin-9-yl)-2-(hydroxymethyl)tetrahydrofuran-3-ol (3)

    [0144] Intermediate 2 was suspended in a mixture of ethanolic ammonia (60 mL, 4 M) and dioxane (30 mL) and this mixture was heated in a sealed tube at 90? C. for 24 hours. Volatiles were evaporated and the residue was azeotroped with dioxane (2?75 mL). The oily intermediate was dissolved in aq. HCOOH (110 mL. 80%) and the reaction mixture was heated to 65? C. for 18 h. Volatiles were evaporated, residue was azeotroped with ethanol (3?150 mL) and then dissolved in a mixture of ethanol (70 mL) and aq. ammonia (35 mL, 25%). Resulting solution was stirred for 3 h, volatiles were evaporated and the residue was azeotroped with ethanol (3?150 mL). Nucleoside 3 was purified by chromatography on silica gel (ethyl acetate.fwdarw.ethyl acetate:acetone:ethanol:water 36:6:5:3, 0-100%) to afford 3 (981 mg over two steps). .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? 8.19 (s, 1H), 8.15 (s, 1H), 7.23 (s, 2H), 5.76 (s, 1H), 4.96-4.83 (br s and m, 2H), 4.42-4.36 (m, 1H), 4.17 (dd, J=9.6, 6.6 Hz, 1H), 4.09 (dd, J=9.6, 5.0 Hz, 1H), 3.69 (ddd, J=6.1, 5.0, 3.2 Hz, 1H), 3.65-3.51 (m, 2H). .sup.13C NMR (101 MHz, DMSO-d.sub.6) ? 156.21, 152.99, 149.61, 139.37, 118.91, 86.07, 75.86, 69.72, 62.12, 61.05. HRMS ESI (C.sub.10H.sub.13N.sub.5O.sub.3) calculated 252.1097, found: 252.1091.

    N-(9-((3R,4S,5R)-4-hydroxy-5-(hydroxymethyl)tetrahydrofuran-3-yl)-9H-purin-6-yl)benzamide (4)

    [0145] 3 (498 mg, 1.98 mmol) was azeotroped with pyridine (3?20 mL), dissolved in pyridine (15 mL), cooled to 0? C. and TMSCl (1.89 mL, 14.7 mmol) was added dropwise during 3 minutes. Reaction mixture was stirred at 0? C. for 20 minutes and then at ambient temperature for 1.5 hours. Benzoyl chloride (0.45 mL, 3.9 mmol) was slowly added at 0? C. and the resulting solution was stirred overnight at ambient temperature. The reaction mixture was cooled to 0? C., quenched with water (1.6 mL), and, after 15 minutes, aq. ammonia (4 mL, 25%). After further 15 minutes at 0? C. and 20 minutes at ambient temperature were all volatiles evaporated and the residue was extracted with ethyl acetate-ethanol mixture (50 ml, 2:1) and solids were filtered-off on a celite pad. Product was purified on silica gel (ethyl acetate.fwdarw.ethyl acetate:acetone:ethanol:water 36:6:5:3, 0-100%) to afford 580 mg of 4. .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? 11.17 (s, 1H), 8.75 (s, 1H), 8.54 (s, 1H), 8.09-8.01 (m, 2H), 7.69-7.60 (m, 1H), 7.60-7.51 (m, 2H), 5.82 (d, J=5.4 Hz, 1H), 5.03 (dt, J=6.2, 4.8 Hz, 1H), 4.93 (t, J=5.6 Hz, 1H), 4.44 (td, J=5.6, 4.3 Hz, 1H), 4.28-4.16 (m, 2H), 3.73 (ddd, J=6.1, 4.8, 3.1 Hz, 1H), 3.65 (ddd, J=12.0, 5.3, 3.1 Hz, 1H), 3.58 (ddd, J=12.0, 5.9, 4.8 Hz, 1H). 13 C NMR (101 MHz, DMSO-d.sub.6) ? 166.2, 153.20, 152.47, 151.50, 150.38, 143.16, 133.63, 132.58, 128.63, 125.57, 86.16, 75.90, 69.59, 62.44, 60.92. HRMS ESI (C.sub.17H.sub.17N.sub.5O.sub.4) calculated 356.1359, found: 356.1360.

    N-(9-((3R,4S ,5R)-5-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-4-hy droxytetrahydrofuran-3-yl)-9H -purin-6-yl)benzamide (5)

    [0146] Compound 4 (559 mg, 1.57 mmol) was azeotroped with pyridine (2?20 mL), dissolved in pyridine (15 mL) and DMTrCl (556 mg, 1.73 mmol) was added in one portion at 0? C. Reaction mixture was stirred at ambient temperature for 15 h, quenched with satd. aq. NaHCO 3 (8 mL) and evaporated. Residue was dissolved in ethyl acetate (400 mL) and washed with saturated aqueous solution of NaHCO.sub.3 (2?150 mL) and brine (150 mL). Organic phase was dried over sodium sulfate and evaporated. Product was purified by chromatography (toluene:acetone 1:1.fwdarw.1:2) on a TEA-deactivated silica to afford 5 (882 mg). .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? 11.19 (bs, 1H), 8.75 (s, 1H), 8.50 (s, 1H), 8.07-8.03 (m, 2H), 7.67-7.62 (m, 1H), 7.58-7.52 (m, 2H), 7.437.38 (m, 2H), 7.33-7.19 (m, 7H), 6.91-6.86 (m, 4H), 5.82 (d, 1H, J=5.7 Hz), 5.05 (dt, 1H, J=7.2, 6.0 Hz), 4.56 (dt, 1H, J=6.8, 5.6 Hz), 4.37 (dd, 1H, J=9.6, 6.1 Hz), 4.30 (dd, 1H, J=9.6, 7.2 Hz), 3.94 (dt, 1H, J=6.9, 4.5 Hz), 3.73 (s, 6H), 3.19 (d, 2H, J=4.4 Hz). .sup.13C NMR (101 MHz, DMSO-d.sub.6) ? 165.62, 158.23, 152.55, 151.51, 150.49, 145.06, 143.37, 135.82, 135.79, 133.63, 132.61, 129.90, 128.66, 128.65, 128.00, 127.92, 126.83, 125.88, 113.36, 85.51, 83.49, 75.20, 68.74, 63.71, 62.32, 55.21. HRMS ESI (C.sub.38H.sub.35N.sub.5O.sub.6) calculated 658.2666, found: 658.2663.

    (2R,3S,4R)-4-(6-benzamido-9H-purin-9-yl)-2-(hydroxymethyl)tetrahydrofuran-3-yl hydrogen phosphonate (6)

    [0147] Compound 5 (403 mg, 0.61 mmol) was azeotroped with pyridine (2?10 mL), dissolved in pyridine (10 mL), and diphenyl phosphite (85%, 417 4, 1.9 mmol) was added in one portion. After stirring at ambient temperature for 20 minutes, TEA (0.92 mL) was added followed by water (0.92 mL) and the reaction was stirred for further 20 minutes. Resulting solution was diluted with DCM (200 mL) and washed with saturated aqueous solution of NaHCO.sub.3 (2?75 mL). Organic layer was dried over sodium sulfate and evaporated. Resulting intermediate was purified on FCC (DCM/1% Et.sub.3N-MeOH 0-30%). To a solution of obtained intermediate in DCM (10 mL) was added water (200 ?L, 11.1 mmol) followed by a solution of DCA (457 ?L, 5.6 mmol) in DCM (5.1 mL). Reaction mixture was stirred at ambient temperature for 30 minutes and volatiles were evaporated. Purification on reverse phase FCC (ACN in 50 mM aqueous NH.sub.4HCO.sub.3, 0-30%) afforded 6 (192 mg, ammonium salt). .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? 11.17 (s, 1H), 8.74 (s, 1H), 8.63 (s, 1H), 8.07-8.02 (m, 2H), 7.67-7.61 (m, 1H), 7.58-7.52 (m, 2H), 6.48 (d, 1H, J=588.2 Hz), 5.20 (dt, 1H, J=6.8, 5.2 Hz), 4.90 (ddd, 1H, J=10.8, 6.1, 4.9 Hz), 4.23 (dd, 1H, J=9.7, 6.8 Hz), 4.18 (dd, 1H, J=9.6, 5.4 Hz), 3.86 (dt, 1H, J=6.2, 4.4 Hz), 3.71 (dd, 1H, J=11.9, 4.5 Hz), 3.65 (dd, 1H, J=11.9, 4.3 Hz). .sup.13C NMR (101 MHz, DMSO-d.sub.6) ? 165.81, 152.46, 151.63, 150.37, 143.51, 133.63, 132.63, 128.68, 125.61, 84.81 (d,J=3.0 Hz), 77.35 (d, J=4.4 Hz), 69.31, 61.36 (d, J=5.5 Hz), 61.30. .sup.31P NMR (162 MHz, DMSO-d.sub.6) ? 3.56. HRMS ESI (C.sub.17H.sub.18N.sub.5O.sub.6P) calculated 420.1073, found: 420.1073.

    Synthesis of (2R,3S,4R)-2-(hydroxymethyl)-4-(6-(pent-4-enamido)-9H-purin-9-yl)tetrahydrofuran-3-yl hydrogen phosphonate (9)

    [0148] The synthesis of compound 9 from compound 3 was accomplished according to the synthetic scheme depicted below, and detailed in the following description.

    ##STR00025##

    N-(9-((3R,4S,5R)-4-hydroxy-5-(hydroxymethyl)tetrahydrofuran-3-yl)-9H-purin-6-yl)pent-4-enamide (7)

    [0149] Intermediate 3 (1 g, 4 mmol) was azeotroped with pyridine (2?10 mL), dissolved in pyridine (15 mL), and TMSCl (2.5 mL, 20 mmol) was added dropwise. After stirring the reaction mixture at ambient temperature for 1 hour, pentenoic anhydride (2.9 mL, 16 mmol) was added dropwise and stirring was continued for further 12 hours. TEA (1 mL) was added, and, after cooling to 0? C., water (4 mL) was added and stirring was continued for 5 minutes. Then aqueous ammonia was added (32%, 4 mL), while still at 0? C. and stirring was continued for another 30 minutes. Volatiles were quickly evaporated at 30? C. and the residue was passed through a plug of silica in DCM-MeOH 19:1 affording product (1.2 g) of ca 80% purity, suitable for next reaction. ESI MS m/z (%): 334.2 (100) [M+H].

    N-(9-43R,4S,5R)-5-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-4-hydroxytetrahydrofuran-3-yl)-9H-purin-6-yl)pent-4-enamide (8)

    [0150] Partially protected nucleoside 7 (1.2 g, 80% purity, 3.0 mmol of pure) was azeotroped with pyridine (2?10 mL), dissolved in pyridine (15 mL) and DMTrCl (1.12 g, 3.2 mmol) was added at 0? C. in five portions. Reaction mixture was stirred at ambient temperature for 12 hours, after which all volatiles were evaporated. Residue was dissolved in small volume of DCM and applied to a preconditioned silicagel column (10% acetone in cyclohexane, 1% TEA), and flash chromatography (10-60% acetone in cyclohexane) afforded 8 (1.6 g). .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? 10.69 (s, 1H), 8.64 (s, 1H), 8.47 (s, 1H), 7.42-7.36 (m, 2H), 7.32-7.18 (m, 7H), 6.90-6.84 (m, 4H), 5.88 (ddt, 1H, J=17.3, 10.3, 6.4 Hz), 5.79 (d, 1H, J=5.7 Hz), 5.08 (dq, 1H, J=17.3, 1.7 Hz), 5.05-4.91 (m, 2H), 4.53 (dt, 1H, J=6.8, 5.6 Hz), 4.36 (dd, 1H, J=9.6, 5.9 Hz), 4.27 (dd, 1H, J=9.6, 7.1 Hz), 3.92 (dt, 1H, J=6.7, 4.5 5 Hz), 3.73 (s, 6H), 3.16 (d, 2H, J=4.5 Hz), 2.68 (t, 2H, J=7.4 Hz), 2.36 (dtt, 2H, J=8.7, 7.3, 1.6 Hz). .sup.13C NMR (101 MHz, DMSO-d.sub.6) ? 171.07, 158.23, 152.13, 151.59, 149.66, 145.05, 142.94, 137.68, 135.80, 135.77, 129.89, 127.99, 127.91, 126.83, 123.77, 115.48, 113.35, 85.50, 83.59, 75.20, 68.70, 63.68, 62.34, 55.21, 35.56, 28.83. HRMS ESI (C.sub.36H.sub.37N.sub.5O.sub.6) calculated 636.2822, found: 636.2819.

    (2R,3S,4R)-2-(hydroxymethyl)-4-(6-(pent-4-enamido)-9H-purin-9-yl)tetrahydrofuran-3-yl hydrogen phosphonate (9)

    [0151] Partially protected nucleoside 8 (200 mg, 0.31 mmol) was azeotroped with pyridine (2?10 mL), dissolved in pyridine (10 mL) and diphenyl phosphite (85%, 860 ?L, 3.82 mmol) was added in one portion. After stirring at ambient temperature for 20 minutes TEA (1.5 mL) was added followed by water (1.5 mL) and the reaction was stirred for further 20 minutes. Resulting solution was diluted with DCM and washed with saturated aqueous solution of NaHCO.sub.3 and with water. Organic layer was dried over sodium sulfate and evaporated. To a solution of obtained intermediate in DCM (15 mL) was added water (229 ?L, 12.7 mmol) and a solution of DCA (0.94 mL, 11.4 mmol) in DCM (10 mL) and the reactioin mixture was stirred at ambient temperature for 30 minutes, after which it was quenched with pyridine (2 ml). Purification and separation of isomers on reverse phase FCC (ACN in water, 0-50%) afforded 24 (119 mg) as triethylammonium salt. .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? 10.68 (s, 1H), 8.64 (s, 1H), 8.61 (s, 1H), 6.45 (d, 1H, J=587.4 Hz), 5.87 (ddt, 1H, J=16.8, 10.2, 6.4 Hz), 5.19-5.13 (m, 1H), 5.08 (dq, 1H, J=17.2, 1.7 Hz), 4.98 (ddt, 1.3 Hz, 1H, J=10.2, 2.3), 4.88 (ddd, 1H, J=11.1, 6.2, 5.1 Hz), 4.23-4.12 (m, 2H), 3.84 (dt, 1H, J=6.3, 4.4 Hz), 3.69 (dd, 1H, J=11.8, 4.7 Hz), 3.63 (dd, 1H, J=11.8, 4.3 Hz), 2.99 (q, 1.5H, J=7.3 Hz), 2.71-2.65 (m, 2H), 2.35 (dtd, 2H, J=7.3, 6.4, 1.6 Hz), 1.12 (t, 2.1H, J=7.3 Hz). .sup.13C NMR (101 MHz, DMSO-d.sub.6) ? 171.09, 152.01, 151.02, 149.57, 143.08, 137.09, 123.50, 115.48, 84.60 (d, J=2.9 Hz), 77.31 (d, J=4.5 Hz), 69.15, 61.38, 61.27 (d, J=5.3 Hz), 45.55, 35.54, 28.82, 8.62. .sup.31P NMR (162 MHz, DMSO-d.sub.6) ? 3.74. HRMS ESI (C.sub.15H.sub.20N.sub.5O.sub.6P) calculated 398.1229, found: 398.1230.

    Synthesis of (2R,3R,4R,5R)-2-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-4-fluoro-5-(6-(pent-4-enamido)-9H-purin-9-yl)tetrahydrofuran-3-yl(2-cyanoethyl) diisourouvluhosuhoramidite (13)

    [0152] The synthesis of compound 13 from compound 10 was accomplished according to the synthetic scheme depicted below, and detailed in the following description.

    ##STR00026##

    N-(9-42R,3R,4R,5R)-3-fluoro-4-hydroxy-5-(hydroxymethyptetrahydrofuran-2-yl)-9H-purin-6-yl)pent-4-enamide (11)

    [0153] 10 (1 g, 3.7 mmol, CAS: 64183-27-3, Chemgenes corp.) was azeotroped with pyridine (2?10 mL), dissolved in pyridine (15 mL), and TMSCl (2.36 mL, 18.6 mmol) was added dropwise. After stirring the reaction mixture at ambient temperature for 1 hour, pentenoic anhydride (1.7 mL, 9.3 mmol) was added dropwise and stirring was continued for further 12 hours. TEA (1 mL) was added, and, after cooling to 0? C., water (4 mL) was added and stirring was continued for 5 minutes. Then aqueous ammonia was added (32%, 4 mL), while still at 0? C. and stirring was continued for another 30 minutes. Volatiles were quickly evaporated at 30? C. and the residue was passed through a plug of silica in DCM-MeOH 19:1 affording product (1.1 g) of ca 90% purity, suitable for next reaction. ESI MS m/z (%): 352.1 (100) [M+H].

    N-(9-((2R,3R,4R,5R)-5-((bis(4-methoxyphenyl)(phenyOmethoxy)methyl)-3-fluoro-4-hydroxytetrahydrofuran-2-yl)-9H-purin-6-yl)pent-4-enamide (12)

    [0154] Partially protected nucleoside 11 (1.09 g, 3.1 mmol) was azeotroped with pyridine (2?10 mL), dissolved in pyridine (15 mL) and DMTrCl (1.15 g, 3.4 mmol) was added at 0? C. in five portions. Reaction mixture was stirred at ambient temperature for 12 hours, after which all volatiles were evaporated. Residue was dissolved in small volume of DCM and applied to a preconditioned silicagel column (10% acetone in cyclohexane, 1% TEA), and flash chromatography (10-80% acetone in cyclohexane) afforded 12 (1.7 g). .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? 10.76 (s, 1H), 8.64 (s, 1H), 8.60 (s, 1H), 7.32-7.28 (m, 2H), 7.24-7.14 (m, 7H), 6.82-6.75 (m, 4H), 6.40 (dd, 1H, J=20.0, 1.5 Hz), 5.87 (ddt, 1H, J=16.8, 10.2, 6.4 Hz), 5.75 (d, 1H, J=6.9 Hz), 5.65 (ddd, 1H, J=52.7, 4.5, 1.4 Hz), 5.08 (dq, 1H, J=17.2, 1.7 Hz), 4.98 (ddt, 1H, J=10.2, 2.2, 1.4 Hz), 4.84 (dddd, 1H, J=23.2, 8.3, 6.9, 4.5 Hz), 4.12 (ddd, 1H, J=8.0, 5.1, 2.4 Hz), 3.71 (s, 6H), 3.28 (dd, 1H, J=10.7, 2.5 Hz), 3.22 (dd, 1H, J=10.8, 5.3 Hz), 2.68 (t, 2H, J=7.4 Hz), 2.35 (dtt, 2H, J=8.7, 7.4, 1.5 Hz). .sup.13C NMR (101 MHz, DMSO-d.sub.6) ? 171.05, 158.20, 151.99, 151.29, 149.90, 144.91, 143.24, 137.65, 135.63, 135.60, 129.82, 127.90, 127.81, 126.79, 123.83, 115.47, 113.27, 93.48 (d, J=184.6 Hz), 86.83 (d, J=34.7 Hz), 85.55, 81.59, 68.85 (d, J=16.5 Hz) 62.77, 55.17, 35.56, 28.78. .sup.19F NMR (377 MHz, DMSO-d.sub.6) ?-201.20 (ddd, J=52.9, 23.2, 20.1 Hz). HRMS ESI (C.sub.36H.sub.36FN.sub.5O.sub.6) calculated 654.2728, found: 654.2726.

    (2R,3R,4R,5R)-2-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-4-fluoro-5-(6-(pent-4-enamido)-9H-purin-9-yl)tetrahydrofuran-3-yl (2-cyanoethyl) diisopropylphosphoramidite (13)

    [0155] To a solution of 12 (688 mg, 1.05 mmol) in DCE (11 mL) under argon atmosphere was via syringe added 2-cyanoethyl N,N,N,N-tetraisopropylphosphorodiamidite (0.67 mL, 2.1 mmol) followed by tetrazole (0.45M in ACN, 5.85 mL, 2.63 mmol). Reactio mixture was stirred at ambient temperature for 30 minutes, diluted with DCM (150 mL), washed with sat. aq. NaHCO.sub.3 (50 mL), dried over sodium sulfate and evaporated. Crude product was dissolved in DCM (2 mL) and applied to a preconditioned (10% acetone in cyclohexane, 1% TEA) silicagel column and eluted with a gradient of acetone in cyclohexane 10-60%. Product was freeze-dried from benzene to afford 13 (700 mg) as a 3:2 mixture of diastereomers. .sup.31P NMR (162 MHz, Benzene-d.sub.6) ? 151.69, 151.66. 19 F NMR (377 MHz, Benzene-d.sub.6) ?-198.55 (dt, J=51.2, 17.7 Hz), -198.96 (ddd, J=51.1, 21.6, 15.6 Hz).

    Synthesis of (1R,2R,5R)-2-(6-benzamido-9H-purin-9-0-5-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)cyclopent-3-en-1-yl(2-cyanoethyl) diisopropylphosphoramidite (19)

    [0156] The synthesis of compound 19 from compound 14 was accomplished according to the synthetic scheme depicted below, and detailed in the following description.

    ##STR00027##

    6-chloro-9-((6aR,9R,9aR)-2,2,4,4-tetraisopropyl-6,6a,9,9a-tetrahydrocyclopenta[f][13,5,2,4]trioxadisilocin-9-yl)-9H-purine (15)

    [0157] Mixture of starting material 14 (2.43 g, 6.52 mmol, J. Org. Chem, 2014, 79, 3917), 6-chlorpurine (1.51 g, 9.78 mmol), triphenylphospine (3.42 g, 13.0 mmol) in THF (85 mL) was cooled to ?10? C. and DIAD (2.61 ml, 13.0 mmol) was added dropwise during 5 minutes. Reaction mixture was allowed to reach 0? C. during 15 minutes and then kept at this temperature for another 2 hours. Volatiles were evaporated and the the product was purified by flash chromatography on silica (cyclohexane: ethyl acetate 5.fwdarw.40%). Product of the reaction (1.85 g) was a mixture of two inseparable isomers and was used in the next reaction without further purification. ESI MS m/z (%): 509.2 (100) [M+H].

    (1R,2R,5R)-2-(6-amino-9H-purin-9-yl)-5-(hydroxymethyl)cyclopent-3-en-1-ol (16)

    [0158] Protected nucleoside 15 (1.85 g, 3.64 mmol) was dissolved in mixture of ethanolic ammonia (44 mL, 4 M) and dioxane (28 mL). Reaction mixture was heated to 90? C. for 48 hours, evaporated and co-evaporated with ethanol (2?150 mL). To the residue was added aq. HCOOH (75 ml, 80%) and reaction mixture was heated to 65? C. for 21 hours. Volatiles were evaporated and the residue was azeotroped with ethanol (3?100 mL). Then a mixture of ethanol (50 mL) and aq. NH.sub.3 (25 mL, 25%) was added and the solution was stirred for 90 minutes, evaporated and azeotroped with ethanol (3?100 mL). 16 (578 mg) was isolated by column chromatography on silica (ethyl acetate.fwdarw.ethyl acetate:acetone:ethanol:water 36:6:5:3). .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? 8.14 (s, 1H), 8.07 (s, 1H), 7.25 (s, 2H), 6.04 (dt, J=6.1, 2.1 Hz, 1H), 5.80 (dt, J=6.1, 2.1 Hz, 1H), 5.49 (br s, 1H), 5.34 (dq, J=6.0, 2.1 Hz, 1H), 4.74 (br s, 1H), 4.22 (t, J=5.7 Hz, 1H), 3.63 (dd, J=10.6, 4.6 Hz, 1H), 3.49 (dd, J=10.6, 6.3 Hz, 1H), 2.67 (ddm, J=6.5, 4.5 Hz, 1H). .sup.13C NMR (101 MHz, DMSO-d.sub.6) ? 156.05, 152.84, 149.75, 139.42, 135.92, 128.47, 119.16, 80.06, 67.54, 61.91, 57.13. HRMS ESI (C.sub.11H.sub.13N.sub.5O.sub.2) calculated 248.1148, found: 248.1144.

    N-(94(1R,4R,5R)-5-hydroxy-4-(hydroxymethyl)cyclopent-2-en-1-yl)-9H-purin-6-yl)benzamide (17)

    [0159] 16 (196 mg, 0.79 mmol) was azeotroped with pyridine (2?15 mL), then dissolved in pyridine (10 mL), cooled to 0? C. and then TMSCl (0.76 mL, 5.9 mmol) was added dropwise during 2 minutes. Reaction mixture was stirred at 0? C. for 30 minutes and then at r.t. for 1 hour. After cooling it down to 0? C., benzoyl chloride (0.2 mL, 1.7 mmol) was slowly added and the resulting solution was left at 0? C. for 1 h and then overnight at ambient temperature. The reaction mixture was then cooled to 0? C. again, quenched with water (0.6 mL), and, after 15 minutes, aq. ammonia (1.6 mL, 25%) was added. After further 15 minutes at 0? C. the reaction mixture was evaporated to dryness. Residue was extracted with ethyl acetate-ethanol mixture (50 ml, 2:1) and solids were filtered-off on a celite pad. Product was purified on silica (ethyl acetate.fwdarw.ethyl acetate:acetone:ethanol:water 100:15:6:4) to afford 218 mg of compound 17. .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? 11.16 (s, 1H), 8.71 (s, 1H), 8.39 (s, 1H), 8.19-7.86 (m, 2H), 7.68-7.59 (m, 1H), 7.59-7.50 (m, 2H), 6.09 (dt, J=6.1, 2.1 Hz, 1H), 5.84 (dt, J=6.1, 2.1 Hz, 1H), 5.54 (br s, 1H), 5.49 (dq, J=6.0, 2.1 Hz, 1H), 4.76 (br s, 1H), 4.30-4.25 (m, 1H), 3.70-3.62 (m, 1H), 3.55-3.48 (m, 1H), 2.74-2.65 (m, 1H). .sup.13C NMR (101 MHz, DMSO-d.sub.6) ? 165.98, 152.57, 151.45, 150.83, 143.08, 136.33, 134.52, 132.41, 128.63, 128.58, 128.18, 125.34, 80.04, 67.84, 61.85, 55.21. HRMS ESI (C.sub.18H.sub.17N.sub.5O.sub.3) calculated 352.1410, found: 352.1411.

    N-(9-41R,4R,5R)-4-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-5-hydroxycyclopent-2-en-1-yl)-9H-purin-6-yl)benzamide (18)

    [0160] 17 (360 mg, 1.03 mmol) was azeotroped with pyridine (3?15 mL), dissolved in pyridine (15 mL), cooled to 0? C. and DMTrCl (382 mg, 1.13 mmol) was added in one portion at 0? C. Reaction mixture was allowed to warm to ambient temperature and stirred for 20 h, after which it was cooled to 0? C. again and a second portion of DMTrCl (115 mg, 0.34 mmol). The reaction mixture was stirred at ambient temperature for another 16 h, then quenched with satd. aq. NaHCO.sub.3 (4 mL) and evaporated. Residue was dissolved in ethyl acetate (200 mL) and washed with saturated aqueous solution of NaHCO.sub.3 (2?100 mL) and brine (100 mL). Organic phase was dried over sodium sulfate and evaporated. Product was purified by chromatography (toluene:ethyl acetate 1:1 and then toluene:acetone 1:1) on a TEA-deactivated silica to afford 485 mg of 18. .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? 11.14 (s, 1H), 8.68 (s, 1H), 8.37 (s, 1H), 8.09-8.02 (m, 2H), 7.69-7.60 (m, 1H), 7.59-7.51 (m, 2H), 7.45-7.38 (m, 2H), 7.36-7.14 (m, 7H), 6.94-6.85 (m, 4H), 6.15 (dt, J=6.1, 2.1 Hz, 1H), 5.92 (dt, J=6.1, 2.1 Hz, 1H), 5.57 (d, J=6.2 Hz, 1H), 5.49 (dq, J=6.4, 2.2 Hz, 1H), 4.40 (q, J=6.3 Hz, 1H), 3.74 (s, 6H), 3.26 (dd, J=8.9, 4.9 Hz, 1H), 3.11 (dd, J=8.9, 6.7 Hz, 1H), 2.94-2.86 (m, 1H). .sup.13C NMR (101 MHz, DMSO) ? 165.72,158.21, 152.72, 151.41, 150.34, 144.87,143.45, 135.98, 135.91, 135.26, 132.55, 129.90, 128.62, 128.00, 127.89, 126.80, 126.10, 113.36, 84.80, 80.17, 67.87, 63.51, 55.19, 52.23, 46.75. HRMS ESI (C.sub.39H.sub.35N.sub.5O.sub.5) calculated 654.2716, found: 654.2712.

    (1R,2R,5R)-2-(6-benzamido-9H-purin-9-yl)-5-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)cyclopent-3-en-1-yl (2-cyanoethyl) diisopropylphosphoramidite (19)

    [0161] Compound 18 (465 mg, 0.71 mmol) was azeotroped with acetonitrile (3?15 mL), dissolved in DCE (10 mL) and the flask was backfilled with argon. 2-cyanoethyl N,N,N,N-tetraisopropylphosphorodiamidite (0.45 mL, 1.42 mmol) followed by tetrazole (0.45M in acetonitrile, 3.95 mL, 1.78 mmol) were sequentially added to the solution was via syringe. Reaction mixture was stirred at r.t. for 1.5 hours, diluted with DCM (200 mL), washed with sat. aq. NaHCO.sub.3 (100 mL), dried over sodium sulfate and evaporated. Product was isolated on a TEA-deactivated silica gel column (toluene:acetone 4:1). 19 (450 mg) was isolated as a mixture of diastereomers. .sup.31P NMR (162 MHz, d6-benzene) ? 152.24, 152.22.

    Synthesis of (1R,6R,8R,9RJOR,13Z,15R,17R,18R)-8,17-bis(6-amino-9H-purin-9-yl)-9,18-difluoro-3,12-dihydroxy-2,4,7,11,16-pentaoxa-3?.SUP.5.,12?.SUP.5.-diphosphatricyclo[13.3.0.0.SUP.6.,.SUP.10.]octadec-13-ene-3,12-dione (24)

    [0162] The synthesis of compound 24 from compounds 6 and 20 was accomplished according to the synthetic scheme depicted below, and detailed in the following description.

    ##STR00028## ##STR00029##

    [0163] A mixture of 6 (41 mg, 0.077 mmol) and pyridinium trifluoroacetate (22 mg, 0.12 mmol) was codistilled with dry ACN (3?3 mL), suspended in dry ACN (1 mL) and stirred overnight in a sealed vessel over activated molecular sieves. In a separate flask, 20 (95 mg, 0.10 mmol, CAS: 144089-97-4, Sigma-Aldrich) was codistilled with dry ACN (3?3 mL), dissolved in dry ACN (1 mL) and stirred overnight in a sealed vessel over activated molecular sieves. A solution of phosphoramidite was transferred via syringe to the flask with the suspension of 6 with py-TFA and the resulting solution was stirred for 1 hour at ambient temperature. TBHP (5.5M solution in decane, 42 ?L, 0.23 mmol) was added and the reaction mixture was stirred for further 30 minutes. Reaction mixture was quenched with NaHSO 3 (39% in water, 31?L, 0.27 mmol), and evaporated to afford crude linear dimer 21, which was used in the next reaction without further purification. To a solution of crude 21 in DCM (3 mL) was added water (14 4, 0.77 mmol) and a solution of DCA (57 4, 0.7 mmol) in DCM (3 mL) dropwise. After stirring the reaction mixture for 30 minutes, TES (1.2 mL) was added and the reaction mixture was stirred for further 90 minutes, after which it was quenched by the addition of pyridine (1.2 mL). All solids were removed by filtration and thoroughly washed with pyridine. Volatiles were evaporated and 22 (29 mg) was isolated on RP FCC (ACN in 0.05M NH.sub.4COOH, 0-50%) as a mixture of diastereomers.

    [0164] 22 was azeotroped with pyridine (2?2 mL), dissolved in pyridine (2 mL), DMOCP (50 mg, 0.27 mmol) was added and the reaction mixture was stirred at ambient temperature for 1 hour. Water (46 ?L, 2.54 mmol) followed by iodine (26 mg, 0.1 mmol) were added and the reaction mixture was stirred at ambient temperature for 10 minutes, after which it was quenched with NaHSO.sub.3 (39% in water, 31 ?L, 0.27 mmol) and evaporated to afford crude cyclic dimer 23, which was used in the next reaction without further purification.

    [0165] CH.sub.3NH.sub.2 (33% in ethanol, 1 mL) was added to the crude 23 and the reaction mixture was stirred at ambient temperature for 3 hours. Volatiles were evaporated and the product was purified on a preparative HPLC (ACN in 0.1M TEAB, 0-30%). Appropriate fractions were pooled, evaporated, codistilled with water (3?5 mL) and methanol (3?5 mL), dissolved in water (1 mL) and slowly passed through a 1 mL column of Dowex 50 (Na.sup.+ cycle). Freeze-drying the eluent afforded the sodium salt of 24 (9 mg).

    Synthesis of (1S,6R,8R,9R10R,15R,18R)-8,18-bis(6-amino-9H-purin-9-yl)-9-fluoro-3,12-dihydroxy-2,4,7,11,13,16-hexaoxa-3?.SUP.5.,12?.SUP.5.-diphosphatricyclo[13.3.0.0.SUP.6.,.SUP.10.]octadecane-3,12-dione (28)

    [0166] The synthesis of compound 28 from compounds 9 and 13 was accomplished according to the synthetic scheme depicted below, and detailed in the following description.

    ##STR00030## ##STR00031##

    [0167] A mixture of 9 (105 mg, 0.21 mmol) and pyridinium trifluoroacetate (61 mg, 0.32 mmol) was codistilled with dry ACN (3?5 mL), suspended in dry ACN (5 mL) and stirred overnight in a sealed vessel over activated molecular sieves. In a separate flask, 13 (225 mg, 0.26 mmol) was codistilled with dry ACN (3?5 mL), dissolved in dry ACN (5 mL) and stirred overnight in a sealed vessel over activated molecular sieves. A solution of phosphoramidite was transferred via syringe to the flask with the suspension of 9 with py-TFA and the resulting solution was stirred for 1 hour at ambient temperature. TBHP (5.5M solution in decane, 115 ?L, 0.63 mmol) was added and the reaction mixture was stirred for further 30 minutes. Reaction mixture was quenched with NaHSO.sub.3 (39% in water, 152 ?L, 0.57 mmol), and evaporated to afford crude linear dimer 25, which was used in the next reaction without further purification. To a solution of crude 25 in DCM (10 mL) was added water (28 ?L, 2.1 mmol) and a solution of DCA (156 ?L, 1.9 mmol) in DCM (10 mL) dropwise. After stirring the reaction mixture for 30 minutes, TES (1.2 mL) was added and the reaction mixture was stirred for further 90 minutes, after which it was quenched by the addition of pyridine (1.2 mL). All solids were removed by filtration and thoroughly washed with pyridine. Volatiles were evaporated and 26 (92 mg) was isolated on RP FCC (ACN in 0.05M NH.sub.4COOH, 0-50%) as a mixture of diastereomers.

    [0168] 26 was azeotroped with pyridine (2?5 mL), dissolved in pyridine (5 mL), DMOCP (136 mg, 0.74 mmol) was added and the reaction mixture was stirred at ambient temperature for 1 hour. Water (125 ?L, 7 mmol) followed by iodine (71 mg, 0.28 mmol) were added and the reaction mixture was stirred at ambient temperature for 10 minutes, after which it was quenched with NaHSO.sub.3 (39% in water, 112 ?L, 0.42 mmol) and evaporated to afford crude cyclic dimer 27, which was used in the next reaction without further purification.

    [0169] CH.sub.3NH.sub.2 (33% in ethanol, 1 mL) was added to the crude 27 and the reaction mixture was stirred at ambient temperature for 3 hours. Volatiles were evaporated and the product was purified on a preparative HPLC (ACN in 0.1M TEAB, 0-30%). Appropriate fractions were pooled, evaporated, codistilled with water (3?5 mL) and methanol (3?5 mL), dissolved in water (1 mL) and slowly passed through a 1 mL column of Dowex 50 (Na t cycle). Freeze-drying the eluent afforded the sodium salt of 28 (36 mg).

    Synthesis of (1R,6R,8R,9R10R,15R,18R)-8,18-bis(6-amino-9H-purin-9-yl)-9-fluoro-3,12-dihydroxy-2,4,7,11,13-pentaoxa-3?.SUP.5.,12?.SUP.5.-diphosphatricyclo[13.3.0.0.SUP.6.,.SUP.10.]octadecane-3,12-dione (34)

    [0170] The synthesis of compound 34 from compounds 29 and 19 was accomplished according to the synthetic scheme depicted below, and detailed in the following description.

    ##STR00032## ##STR00033##

    [0171] The following compounds were synthesized according to the protocols described above.

    (1R,6R,8R,9R,10R,15R,18R)-8,18-bis(6-amino-9H-purin-9-yl)-9-fluoro-3,12-dihydroxy-2,4,7,11,13-pentaoxa-3 ?.SUP.5.,12?.SUP.5.-diphosphatricyclo[13.3.0.0.SUP.6.,.SUP.10.]octadec-16-ene-3,12-dione (33)

    [0172] A mixture of 29 (45 mg, 0.08 mmol, CAS: 1834500-64-9, Carbosynth Ltd.) and pyridinium trifluoroacetate (24 mg, 0.13 mmol) was codistilled with dry ACN (3?5 mL), suspended in dry ACN (5 mL) and stirred overnight in a sealed vessel over activated molecular sieves. In a separate flask, 19 (89 mg, 0.10 mmol) was codistilled with dry ACN (3?5 mL), dissolved in dry ACN (5 mL) and stirred overnight in a sealed vessel over activated molecular sieves. A solution of phosphoramidite was transferred via syringe to the flask with the suspension of 29 with py-TFA and the resulting solution was stirred for 1 hour at ambient temperature. TBHP (5.5M solution in decane, 46 ?L, 0.25 mmol) was added and the reaction mixture was stirred for further 30 minutes. Reaction mixture was quenched with NaHSO.sub.3 (39% in water, 33 ?L, 0.17 mmol), and evaporated to afford crude linear dimer 30, which was used in the next reaction without further purification. To a solution of crude 30 in DCM (10 mL) was added water (15 ?L, 0.84 mmol) and a solution of DCA (62 ?L, 0.75 mmol) in DCM (5 mL) dropwise. After stirring the reaction mixture for 30 minutes, TES (1.3 mL) was added and the reaction mixture was stirred for further 90 minutes, after which it was quenched by the addition of pyridine (1.3 mL). All solids were removed by filtration and thoroughly washed with pyridine. Volatiles were evaporated and 31 was isolated on RP FCC (ACN in 0.05M NH.sub.4 COOH, 0-50%) as a mixture of diastereomers.

    [0173] 31 was azeotroped with pyridine (2?5 mL), dissolved in pyridine (5 mL), DMOCP (54 mg, 0.29 mmol) was added and the reaction mixture was stirred at ambient temperature for 1 hour. Water (50 ?L, 2.76 mmol) followed by iodine (28 mg, 0.11 mmol) were added and the reaction mixture was stirred at ambient temperature for 10 minutes, after which it was quenched with NaHSO.sub.3 (39% in water, 33 ?L, 0.17 mmol) and evaporated to afford crude cyclic dimer 32, which was used in the next reaction without further purification.

    [0174] CH.sub.3NH.sub.2 (33% in ethanol, 1 mL) was added to the crude 32 and the reaction mixture was stirred at ambient temperature for 3 hours. Volatiles were evaporated and the product was purified on a preparative HPLC (ACN in 0.1M TEAB, 0-30%). Appropriate fractions were pooled, evaporated, codistilled with water (3?5 mL) and methanol (3?5 mL), dissolved in water (1 mL) and slowly passed through a 1 mL column of Dowex 50 (Na.sup.+ cycle). Freeze-drying the eluent afforded the sodium salt of 33 (12 mg). HPLC retention time (HILIC, min): 4.10. .sup.1H NMR (501 MHz, D.sub.2O) ? 8.22 (s, 1H), 8.15 (s, 1H), 8.07 (s, 1H), 7.99 (s, 1H), 6.44 (dd, J=16.7 Hz, 1H), 6.03 (dtd, J=6.1, 2.2, 0.9 Hz, 1H), 5.75 (dt, J=6.1, 2.2 Hz, 1H), 5.71 (dq, J=5.8, 2.2, 1.8 Hz, 1H), 5.42 (dd, J=51.6, 4.1, 1H), 5.28 (dt, J=7.6, 6.1 Hz, 1H), 4.89 (dddd, J=23.5, 9.2, 8.2, 4.1 Hz, 1H), 4.47 (dm, J=9.2, 1H), 4.33 (ddd, J=12.2, 2.5, 1.2 Hz, 1H), 4.19 (ddd, J=10.4, 4.2, 1.8 1H), 4.14 (ddd, J=12.2, 3.7, 1.6 1H), 4.10 (dt, J=10.4, 3.4 Hz, 1H). .sup.13C NMR (101 MHz, D.sub.2O) ? 158.27, 158.00, 155.48, 154.52, 151.94, 150.56, 145.00, 141.51, 136.64, 131.69, 121.74, 121.54, 94.98 (d, J=189.6 Hz), 90.03 (d, J=34.2 Hz), 84.22 (d, J=6.1 Hz), 82.46 (t, J=5.3 Hz), 71.78 (dd, J=16.2, 5.3 Hz), 70.55 (d, J=2.4 Hz), 67.21 (d, J=4.5 Hz), 64.51 (d, J=4.8 Hz), 54.16 (t, J=6.5 Hz). .sup.31H NMR (202.4 MHz, H.sub.2O) ?-0.26, -0.98. .sup.19F NMR (470.4 MHz, H.sub.2O) ?-197.25. ESI MS m/z (%): 639.3 (100) [M-H].

    (1R,6R,8R,9R,10R,15R,18R)-8,18-bis(6-amino-9H-purin-9-yl)-9-fluoro-3,12-dihydroxy-2,4,7,11,13-pentaoxa-3?.SUP.5.,12?.SUP.5.-diphosphatricyclo[13.3.0.0.SUP.6.,.SUP.10.]octadecane-3,12-dione (34)

    [0175] To a solution of 33 (5 mg) in methanol (1 mL) was added Pd/C (10%, 3 mg) and reaction mixture was treated with hydrogen (steel bomb, 15 bar) for 48 hours. Catalyst was filtered off on a syringe filter and product was purified on HPLC (0-25% of CAN in 0.1 M aq TEAB). Appropriate fractions were pooled, evaporated, codistilled with water (3?5 mL) and methanol (3?5 mL), dissolved in water (1 mL) and slowly passed through a 1 mL column of Dowex 50 (Na.sup.+ cycle). Freeze-drying the eluent afforded the sodium salt of 34 (2 mg).

    TABLE-US-00002 TABLE 1 Exemplary compounds and characterization data Mass Compound Structure / Name [M ? H].sup.? 28 [00034]embedded image 643.4 (1S,6R,8R,9R,10R,15R,18R)-8,18-bis(6-amino-9H-purin-9-yl)-9- fluoro-3,12-dihydroxy-2,4,7,11,13,16-hexaoxa-3?.sup.5,12?.sup.5- diphosphatricyclo[13.3.0.0.sup.6,10]octadecane-3,12-dione 28: HPLC retention time (HILIC, min): 3.78. .sup.1H NMR (501 MHz, D.sub.2O) ? 8.16 (s, 1H), 8.10 (s, 1H), 8.10 (s, 1H), 8.05 (s, 1H), 6.34 (d, 1H, J = 16.5 Hz), 5.53 (dd, 1H, J = 51.4, 4.0 Hz), 5.39 (dt, 1H, J = 6.9, 3.8 Hz), 5.29 (td, 1H, J = 7.1, 3.7 Hz), 4.92 (dtd, 1H, J = 21.1, 9.6, 4.0 Hz), 4.51 (ddd, 1H, J = 9.4, 2.0, 1.4 Hz), 4.40 (dd, 1H, J = 12.1, 2.0 Hz), 4.37 (dd, 1H, J = 10.5, 6.9 Hz), 4.35 (dd, 1H, J = 11.7, 2.3 Hz), 4.23 (dq, 1H, J = 7.1, 2.3 Hz), 4.20 (ddd, 1H, J = 11.7, 5.2, 2.0 Hz), 4.10 (ddd, 1H, J = 12.1, 4.2, 1.4 Hz), 4.10 (dd, 1H, J = 10.5, 3.9 Hz). .sup.13C NMR (101 MHz, D.sub.2O) ? 157.97, 157.97, 155.36, 154.96, 151.48, 150.21, 143.55, 141.55, 121.36, 121.01, 94.78 (d, J = 189.2 Hz), 90.27 (d, J = 34.0 Hz), 85.05 (t, J = 10.2 Hz), 82.44 (t, J = 11.3 Hz), 80.39 (d, J = 5.5 Hz), 74.44, 72.03 (dd, J = 16.4, 5.5 Hz), 65.67 (d, J = 4.4 Hz), 64.58 (d, J = 4.7 Hz), 64.31. .sup.31P NMR (202.4 MHz, D.sub.2O) ? ?0.89, ?0.69. .sup.19F NMR (470.4 MHz, D.sub.2O) ? ?198.17. 24 [00035]embedded image 659.4 (1S,6R,8R,9R,10R,15R,18R)-8-(2-amino-6-oxo-6,9-dihydro-1H-purin- 9-yl)-18-(6-amino-9H-purin-9-yl)-9-fluoro-3,12-dihydroxy- 2,4,7,11,13,16-hexaoxa-3?.sup.5,12?.sup.5- diphosphatricyclo[13.3.0.0.sup.6,10]octadecane-3,12-dione 24: HPLC retention time (HILIC, min): 4.18. .sup.1H NMR (400 MHz, D.sub.2O) ? 8.19 (s, 1H), 8.10 (s, 1H), 7.71 (s, 1H), 6.12 (d, J = 18.1 Hz, 1H), 5.57 (dd, J = 51.6, 4.2 Hz, 1H), 5.39 (dt, J = 6.8, 3.4 Hz, 1H), 5.18 (td, J = 7.1, 3.5 Hz, 1H), 4.99 (m, 1H), 4.45 (dm, J = 9.0 Hz, 1H), 4.39 (dd, J = 10.5, 6.8 Hz, 1H), 4.36 (bdd, J = 12.0, 2.5 Hz, 1H), 4.35 (bdd, J = 12.0, 1.7 Hz, 1H), 4.22 (dq, J = 7.0, 2.3 Hz, 1H), 4.20 (ddd, J = 12.0, 5.1, 2.1 Hz, 1H), 4.17 (bdd, J = 10.5, 3.3 Hz, 1H), 4.07 (ddd, J = 12.0, 4.0, 1.5 Hz, 1H). .sup.13C NMR (101 MHz, D.sub.2O) ? 160.55, 157.81, 156.27, 154.61, 152.71, 151.37, 143.38, 139.09, 120.80, 119.04, 94.83 (d, J = 188.5 Hz), 90.60 (d, J = 34.7 Hz), 84.97 (t, J = 10.1 Hz), 82.57 (t, J = 10.8 Hz), 80.88, 74.56, 72.15 (dd, J = 16.1, 5.1 Hz), 65.57 (d, J = 4.8 Hz), 64.64 (d, J = 4.8 Hz), 64.08. .sup.31P NMR (162 MHz, D.sub.2O) ? ?0.56, ?0.65. .sup.19F NMR (376 MHz, D.sub.2O) ? ?197.54. 34 [00036]embedded image 641.4 (1R,6R,8R,9R,10R,15R,18R)-8,18-bis(6-amino-9H-purin-9-yl)-9- fluoro-3,12-dihydroxy-2,4,7,11,13-pentaoxa-3?.sup.5,12?.sup.5- diphosphatricyclo[13.3.0.0.sup.6,10]octadecane-3,12-dione 34: HPLC retention time (C18, min): 2.23. .sup.1H NMR (501 MHz, D.sub.2O) ? 8.22 (s, 1H), 8.22 (s, 1H), 8.22 (s, 1H), 8.09 (s, 1H), 6.40 (d, 1H, J = 17.0 Hz), 5.45 (dd, 1H, J = 51.9, 4.2 Hz), 5.02 - 4.91 (m, 3H), 4.48 (dq, 1H, J = 9.2, 2.2 Hz), 4.31 (dt, 1H, J = 12.0, 2.2 Hz), 4.14 (ddd, 1H, J = 12.1, 3.4, 1.7 Hz), 4.06 (dt, 1H, J = 10.2, 2.7 Hz), 4.02 (ddd, 1H, J = 10.2, 3.5, 2.0 Hz), 2.48 (m, 1H), 2.33 (ddt, 1H, J = 13.3, 8.8, 7.4 Hz), 2.17 (dtd, 1H, J = 13.4, 8.8, 7.1 Hz), 2.04 - 1.98 (m, 2H). .sup.13C NMR (101 MHz, D.sub.2O) ? 156.27, 156.11, 153.45, 152.66, 150.10, 148.66, 142.41, 139.92, 119.63, 119.51, 93.06 (d, J = 189.0 Hz), 87.68 (d, J = 34.1 Hz), 80.15 (t, J = 10.1 Hz), 79.85 (d, J = 6.6 Hz), 69.88 (dd, J = 16.0, 5.0 Hz), 64.90 (d, J = 5.4 Hz), 62.52, 62.42 (d, J = 4.8 Hz), 44.53 (dd, J = 11.0, 6.1 Hz), 27.87, 22.27. .sup.31P NMR (202.4 MHz, D.sub.2O) ? 2.05, 0.66. .sup.19F NMR (470.4 MHz, D.sub.2O) ? ?201.22 (ddd, J = 52.0, 23.6, 17.0 Hz). 50 [00037]embedded image 625.4 (1S,6R,8R,10S,15R,18R)-8,18-bis(6-amino-9H-purin-9-yl)-3,12- dihydroxy-2,4,7,11,13,16-hexaoxa-3?.sup.5,12?.sup.5- diphosphatricyclo[13.3.0.0.sup.6,10]octadecane-3,12-dione 50: HPLC retention time (HILIC, min): 4.20. .sup.1H NMR (400 MHz, D.sub.2O) ? 8.25 (s, 1H), 8.19 (s, 1H), 8.15 (s, 1H), 8.10 (s, 1H), 6.48 (dd, J = 7.1, 3.8 Hz, 1H), 5.37 (dt, J = 7.1, 4.1 Hz, 1H), 5.25 (td, J = 7.2, 4.1 Hz, 1H), 4.95 (p, J = 7.0 Hz, 1H), 4.40 (dd, J = 10.3, 7.1 Hz, 1H), 4.30 (ddd, J = 11.8, 2.6, 1.3 Hz, 1H), 4.27 (ddt, J = 6.6, 4.3, 2.2 Hz, 1H), 4.22 (dq, J = 7.0, 2.4 Hz, 1H), 4.39 (ddd, J = 11.7, 2.7, 2.0 Hz, 1H), 4.35 (dd, J = 10.4, 6.4 Hz, 1H), 4.25 (dq, J = 6.6, 2.3 Hz, 1H), 4.17 (dd, J = 10.3, 4.1 Hz, 1H), 4.15 (ddd, J = 11.8, 2.2, 1.7 Hz, 1H), 4.11 (ddd, J = 11.6, 4.3, 2.5 Hz, 1H), 4.04 (ddd, J = 11.6, 4.2, 2.4 Hz, 1H), 2.95 (ddd, J = 14.1, 7.3, 3.8 Hz, 1H), 2.78 (dt, J = 14.1, 7.2 Hz, 1H). .sup.13C NMR (101 MHz, D.sub.2O) ? 158.16, 158.11, 155.30, 155.11, 151.67, 150.80, 143.44, 142.18, 121.38, 121.15, 86.18, 85.34 (t, J = 10.3 Hz), 84.90 (t, J = 10.2, 8.6 Hz), 80.44 (d, J = 5.6 Hz), 74.16 (d, J = 5.1 Hz), 73.94, 65.37 (d, J = 4.9 Hz), 64.03 (d, J = 1.9 Hz), 64.01 (d, J = 5.0 Hz), 41.18. .sup.31P NMR (162 MHz, D.sub.2O) ? 0.08, ?0.51. 51 [00038]embedded image 659.4 (1S,6R,8R,9R,10R,15R,18R)-18-(2-amino-6-oxo-6,9-dihydro-1H- purin-9-yl)-8-(6-amino-9H-purin-9-yl)-9-fluoro-3,12-dihydroxy- 2,4,7,11,13,16-hexaoxa-3?.sup.5,12?.sup.5- diphosphatricyclo[13.3.0.0.sup.6,10]octadecane-3,12-dione 51: HPLC retention time (HILIC, min): 4.24. .sup.1H NMR (400 MHz, D.sub.2O) ? 8.25 (s, 1H), 8.16 (s, 1H), 7.72 (s, 1H), 6.42 (d, J = 14.3 Hz, 1H), 6.12 (dt, J = 7.2, 5.8 Hz, 1H), 5.46 (dd, J = 51.5, 3.5 Hz, 1H), 5.20 (dt, J = 8.5, 5.8 Hz, 1H), 4.94 - 4.83 (m, 1H), 4.54 (dm, J = 9.8 Hz, 1H), 4.46 (dd, J = 12.3, 2.3 Hz, 1H), 4.35 (dd, J = 9.9, 8.5 Hz, 1H), 4.29 (dd, J = 11.5, 2.6 Hz, 1H), 4.25 - 4.20 (m, 1H), 4.16 - 4.06 (m, 2H), 3.98 (dd, J = 9.8, 6.0 Hz, 1H). .sup.13C NMR (101 MHz, D.sub.2O) ? 159.65, 156.24, 153.49, 152.93, 151.87, 148.25, 141.69, 139.02, 119.28, 117.57, 92.91 (d, J = 190.1 Hz), 88.05 (d, J = 32.8 Hz), 82.76 (t, J = 10.8 Hz), 80.32 (t, J = 11.1 Hz), 74.62 (d, J = 5.8 Hz), 72.15, 69.71 (dd, J = 16.2, 5.1 Hz), 64.14, 63.93 (d, J = 5.6 Hz), 62.43 (d, J = 4.8 Hz). .sup.31P NMR (162 MHz, D.sub.2O) ? 1.04, 0.81. .sup.19F NMR (376 MHz, D.sub.2O) ? ?202.50 (ddd, J = 51.5, 23.9, 14.4 Hz). 52 [00039]embedded image 641.4 (1S,6R,9R,10S,15R,18R)-9-(2-amino-6-oxo-6,9-dihydro-1H-purin-9- yl)-18-(6-amino-9H-purin-9-yl)-3,12-dihydroxy-2,4,7,11,13,16- hexaoxa-3?.sup.5,12?.sup.5-diphosphatricyclo[13.3.0.0.sup.6,10]octadecane-3,12- dione 52: HPLC retention time (HILIC, min): 4.15. .sup.1H NMR (400 MHz, D.sub.2O) ? 8.24 (s, 1H), 8.06 (s, 1H), 7.71 (s, 1H), 5.78 (m, 1H), 5.38 (bd, J = 5.2 Hz, 1H), 5.20 - 5.13 (m, 2H), 4.40 - 4.32 (m, 3H), 4.26 (dd, J = 10.6, 5.1 Hz, 1H), 4.23 - 4.13 (m, 3H), 4.06 (ddd, J = 11.1, 4.0, 2.3 Hz, 1H), 3.93 (bd, J = 10.4 Hz, 1H), 3.89 (dd, J = 10.3, 5.3 Hz, 1H). .sup.13C NMR (101 MHz, D.sub.2O) ? 159.61, 156.19, 153.30, 153.02, 152.03, 149.50, 141.43, 140.54, 118.56, 117.08, 84.54 (t, J = 9.9 Hz), 83.34 (t, J = 11.4 Hz), 79.56 (d, J = 5.6 Hz), 76.34 (d, J = 5.3 Hz), 73.53, 72.34, 64.70, 63.53 (d, J = 5.1 Hz), 63.13 (d, J = 5.1 Hz), 61.98. .sup.31P NMR (162 MHz, D.sub.2O) ? 1.39, 1.14. 53 [00040]embedded image 641.4 (1S,6R,8R,10S,15R,18R)-18-(2-amino-6-oxo-6,9-dihydro-1H-purin-9- yl)-8-(6-amino-9H-purin-9-yl)-3,12-dihydroxy-2,4,7,11,13,16- hexaoxa-3?.sup.5,12?.sup.5-diphosphatricyclo[13.3.0.0.sup.6,10]octadecane-3,12- dione 53: HPLC retention time (HILIC, min): 4.21. .sup.1H NMR (400 MHz, D.sub.2O) ? 8.21 (s, 1H), 8.19 (s, 1H), 7.74 (s, 1H), 6.41 (d, 1H, J = 6.7 Hz), 6.09 (q, 1H, J = 6.7 Hz), 5.20 (dt, J = 8.3, 5.8 Hz, 1H), 4.98 (m, 1H), 4.41 - 4.19 (m, 5H), 4.13 - 3.99 (m, 3H), 2.91 (dd, J = 13.4, 6.8 Hz, 1H), 2.78 (ddd, J = 13.3, 10.0, 6.9 Hz, 1H). .sup.13C NMR (101 MHz, D.sub.2O) ? 159.72, 156.17, 153.12, 153.07, 152.00, 148.12, 141.57, 139.45, 119.29, 117.40, 85.13, 83.14 (d, J = 10.9 Hz), 82.93 (d, J = 9.7 Hz), 75.00 (d, J = 5.7 Hz), 72.02, 69.88 (d, J = 5.2 Hz), 63.99, 63.74 (d, J = 5.3 Hz), 62.54 (d, J = 5.1 Hz), 40.35). .sup.31P NMR (162 MHz, D.sub.2O) ? 1.77, 1.02. 54 [00041]embedded image 675.5 (1S,6R,8R,9R,10R,15R,18R)-8,18-bis(6-amino-9H-purin-9-yl)-9- fluoro-3,12-disulfanyl-2,4,7,11,13,16-hexaoxa-3?.sup.5,12?.sup.5- diphosphatricyclo[13.3.0.0.sup.6,10]octadecane-3,12-dione 54: HPLC retention time (C18, min): 2.52. .sup.1H NMR (400 MHz, D.sub.2O) ? 8.21 (s, 1H), 8.20 (s, 1H), 8.11 (s, 1H), 8.07 (s, 1H), 6.42 (d, J = 15.8 Hz, 1H), 5.78 (dd, J = 51.0, 3.8 Hz, 1H), 5.34 (dt, J = 6.2, 3.0 Hz, 1H), 5.32 (m, 1H), 4.90 (m, 1H), 4.56 (m, 1H), 4.50 (bd, J = 11.8 Hz, 1H), 4.37 (dd, J = 10.5, 6.2 Hz, 1H), 4.29 (m, 1H), 4.28 (m, 1H), 4.17 (m, 1H), 4.13 (bdd, J = 10.5, 3.0 Hz, 1H), 4.03 (bdd, J = 11.8, 4.2 Hz, 1H). .sup.13C NMR (101 MHz, D.sub.2O) ? 157.74, 154.96, 154.81, 151.60, 150.21, 143.06, 141.42, 121.30, 121.12, 94.56 (d, J = 189.7 Hz), 89.74 (d, J = 33.7 Hz), 84.98 (t, J = 10.7 Hz), 81.85 (dd, J = 11.6, 8.7 Hz), 80.94 (d, J = 8.3 Hz), 73.18 (dd, J = 26.0, 4.7 Hz), 74.42, 65.66 (d, J = 4.7 Hz), 65.44 (d, J = 6.6 Hz), 64.47. .sup.31P NMR (162 MHz, D.sub.2O) ? 56.24, 53.77. .sup.19F NMR (376 MHz, D.sub.2O) ? ?199.54. 55 [00042]embedded image 675.5 (1S,6R,8R,9R,10R,15R,18R)-8,18-bis(6-amino-9H-purin-9-yl)-9- fluoro-3,12-disulfanyl-2,4,7,11,13,16-hexaoxa-3?.sup.5,12?.sup.5- diphosphatricyclo[13.3.0.0.sup.6,10]octadecane-3,12-dione 55: HPLC retention time (C18, min): 2.59. .sup.1H NMR (400 MHz, D.sub.2O) ? 8.18 (s, 2H), 8.08 (s, 2H), 6.40 (d, J = 16.0 Hz, 1H), 5.48 (dd, J = 51.5, 3.9 Hz, 1H), 5.37 (dt, J = 6.4, 3.5 Hz, 1H), 5.35 (m, 1H), 4.96 (m, 1H), 4.52 (dm, J = 9.0 Hz, 1H), 4.48 (dm, J = 12.2 Hz, 1H), 4.39 (ddd, J = 11.7, 2.7, 2.0 Hz, 1H), 4.35 (dd, J = 10.4, 6.4 Hz, 1H), 4.25 (dq, J = 6.6, 2.3 Hz 1H), 4.15 (ddd, J = 11.7, 6.2, 2.2 Hz, 1H), 4.09 (bdd, J = 10.4, 3.5 Hz, 1H), 4.03 (ddd, J = 12.2, 4.8, 1.3 Hz, 1H). .sup.13C NMR (101 MHz, D.sub.2O) ? 157.80, 155.02, 154.66, 151.53, 150.22, 143.24, 141.50, 121.26, 121.07, 95.11 (d, J = 190.0 Hz), 89.97 (d, J = 33.9 Hz), 84.66 (dd, J = 11.3, 8.4 Hz), 82.06 (dd, J = 11.4, 9.8 Hz), 80.71 (d, J = 8.5 Hz), 74.39, 72.02 (dd, J = 16.4, 8.5 Hz), 66.82 (d, J = 4.7 Hz), 65.11 (d, J = 4.4 Hz), 64.45. .sup.31P NMR (162 MHz, D.sub.2O) ? 55.76, 53.81. .sup.19F NMR (376 MHz, D.sub.2O) ? ?197.80.

    Example 1. Biological Evaluation

    [0176] A cyclic dinucleotide was determined to be a STING agonist: (A) if it demonstrated binding to the AQ allelic form of human STING protein with thermal shift of >0.5? C. in the STING Differential Scanning Fluorimetry Assay (DSF), and (B) if it demonstrated STING activation through IRF-3 dependent expression of firefly luciferase reporter with EC.sub.50<100 ?mol.sup.?1.

    ISRE Reporter Plasmid (pGL64.27-4xISRE)

    [0177] Two complementary oligonucleotides of the sequence

    AAAGATCTTGGAAAGTGAAACCTTGGAAAACGAAACTGGACAAAGGGAAACTGCAGAA ACTGAAACAAAGCTTAA (SEQ ID NO:1) and

    [0178] TTAAGCTTTGTTTCAGTTTCTGCAGTTTCCCTTTGTCCAGTTTCGTTTTCCAAGGTTTCACT TTCCAAGATCTTT (SEQ ID NO:2) containing four interferon-sensitive response elements (ISRE) were synthesized by Sigma Aldrich (Czech Republic, Prague). The oligonucleotides were mixed in equal molar amounts, hybridized, and cleaved by restriction endonucleases HindIII (cat. #.R0104S, NEB, Ipswich, USA) and BglII (cat. #R0144S, NEB, Ipswich, USA). Ultimately, they were ligated into plasmid pGL4.27 (cat. #E6651, Promega, Madison, USA) linearized with the same enzymes. As result the sequence with four ISRE sites was placed upstream of the minimum promoter of firefly luciferase reporter gene.

    293T wtSTING-FL Reporter Cells

    [0179] 293T cells (cat. #CRL-3216, ATCC, Manassas, USA) were seeded a day before transfection at density 125,000 cells per cm.sup.2 onto poly-D-lysine (cat. #P6407, Sigma Aldrich, Czech Republic) coated six well plates in antibiotic free DMEM with high glucose (cat. #D5796, Sigma Aldrich, Czech Republic) supplemented with 10% heat inactivated FBS (cat. #S1520, Biowest, Riverside, USA). On the day of transfection, 2.5 ?g of the plasmid pUNO1-hSTING-WT (cat. #punol-hstingwt, InvivoGen, San Diego, USA,) encoding human wild type STING (WT STING) was diluted in 125 ?L OptiMEM medium (cat. #31985062, ThermoFisher, Waltham, USA) and mixed with 125 ?L of the same medium containing 12.5 ?L of Lipofectamine 2000 (cat. #11668019, ThermoFisher, Waltham, USA). After 5 minutes incubation at room temperature (RT), 250 ?L of the mixture was added dropwise to the cells in one well. Cells were incubated 36 hours at 37? C. with 5% CO.sub.2, and then detached with 0.05% Trypsin and 0.22 g/L EDTA (both cat. #L0941, Biowest, Riverside, USA).

    [0180] Transfected cells were seeded onto poly-D-lysine coated six well plates at density 50,000 cells per 1 cm.sup.2 in DMEM medium with high glucose containing 10% heat inactivated FBS, 30 ?g/mL blasticidin (cat. #ant-b1-05, InvivoGen, San Diego, USA), 0.06 mg/ml Penicillin G and 0.1 mg/ml Streptomycin Sulfate (both cat. #. L0018, Biowest, Riverside, USA). The medium was replenished every 3-4 days until visible colonies of cells resistant to blasticidin were formed.

    [0181] Blasticidin resistant cells stably expressing WT STING were further transfected with pGL64.27-4xISRE plasmid following the same procedure as described above. The transfected cells were selected for the resistance to 300 ?g/mL hygromycin (cat. #. 10687010, ThermoFisher, Waltham, USA) in DMEM with high glucose containing 10% heat inactivated FBS, 30?g/mL blasticidin, 0.06 mg/ml Penicillin G and 0.1 mg/ml Streptomycin Sulfate. Homogeneous culture of stably double transfected cells was prepared by limiting dilution of cells in 96 well plates and wells with cells were selected that originated from a single cell. These cells were expanded, and expression of WT STING was confirmed by western blot using monoclonal mouse anti STING antibodies (cat. #. MAB7169, 1:1000 dilution; 2? antibody cat. #. HAF007, 1:2000 dilution, both from R&D Systems, Minneapolis, USA), and by induction of firefly luciferase expression in the presence of 50 ?M STING agonist 23 cGAMP (cat. #tlrl-nacga23, InvivoGen, San Diego, USA). Genomic DNA from the transfected cells was amplified with primers pUNO1_Seq_F (TGCTTGCTCAACTCTACGTC) (SEQ ID NO:3) and pUNO1_Seq_R (GTGGTTTGTCCAAACTCATC) (SEQ ID NO:4) that were complementary to pUNO1 plasmid and the presence of WT STING gene in the transfected cells was confirmed by DNA sequencing.

    Digitonin Assay Using 293T wtSTING-FL Reporter Cells

    [0182] 293T wtSTING-FL cells were seeded at density of 250,000 cells per cm.sup.2 onto 96 well poly-D-lysine coated plates in 100 ?l DMEM with high glucose supplemented with 10% heat inactivated FBS. The medium was removed next day and three fold serial dilutions of compounds in Digitonin buffer containing 50 mmol.Math.l.sup.?1 HEPES (cat. #H3375, Sigma Aldrich, Czech Republic) pH 7.0, 100 mmol.Math.l.sup.?1 KCl, 3 mmol.Math.l.sup.?1 MgCl.sub.2, 0.1 mmol..Math.l.sup.?1 DTT (cat. #D0632, Sigma Aldrich, Czech Republic), 85 mmol.Math.l.sup.?1 Sucrose (cat. #S7903, Sigma Aldrich, Czech Republic), 0.2% BSA (cat. #A2153, Sigma Aldrich, Czech Republic), 1 mmol.Math.l.sup.?1 ATP (cat. #A1852, Sigma Aldrich, Czech Republic), 0.1 mmol.Math.l.sup.?1 GTP (cat. #G8877, Sigma Aldrich, Czech Republic), and 10 ?g/mL Digitonin A (cat. #D141, Sigma Aldrich, Czech Republic) were added to the cells. The buffer was removed after 30 minutes incubation at 37? C. with 5% CO.sub.2, the cells were washed once with 100 ?l of cultivation medium, and 100 ?l of medium was added to each well. The plates with cells were incubated for 5 hours at 37? C. with 5% CO.sub.2, 50 ?l of the medium was removed and 30 ?l of ONE-Glo? Luciferase Assay System reagent (cat. #E6120, Promega, Madison, USA) was added to each well. Luminescence was read on Synergy H1 (Biotek, Winooski, USA). GrafPad Prism (La Jolla, USA) was used to calculate the 50% effective concentration (EC.sub.50) from an 8-point dose-response curve. Control compounds 33-c-di-GMP (cat. #tlrl-nacdg), 33-c-di-AMP (cat. #tlrl-nacda), 33-cGAMP (cat. #tlrl-nacga), 23-cGAMP (cat. #tlrl-nacga23), and 22-cGAMP (cat. #tlrl-nacga22) were purchased from Invivogen (San Diego, USA).

    WT STING and AQ STING Proteins

    [0183] Both WT and AQ human STING (G230A-R293Q) cDNA were amplified by the use of PCR (Phusion? High-Fidelity DNA Polymerase, cat. #M0530S, NEB, Ipswich, USA) using oligonucleotides hSTING140-BamH-For (GTGGGATCCGCCCCAGCTGAGATCTCTGCAG) (SEQ ID NO:5) and hSTING379-Not-Rev3 (TATGCGGCCGCCTATTACACAGTAACCTCTTCCTTTTC) (SEQ ID NO:6) from pUNO1-hSTING-WT (cat. #puno1-hstingwt, InvivoGen, San Diego, USA) and pUNO1-hSTING-HAQ plasmids (punol-hsting-haq, InvivoGen, San Diego, USA). Purified PCR products were cleaved with restriction enzymes BamHI (cat. #R0136S, NEB, Ipswich, USA) and Notl (cat. #R0189S, NEB, Ipswich, USA) and cloned into the pSUMO vector linearized with the identical enzymes. Plasmid pSUMO was created by introducing 8-His-SUMO sequence between Ndel and BamHI sites of pHis-parallel2 plasmid (Clontech, Moutain View, USA). pSUMO-STING WT or pSUMO-STING AQ plasmids thus encoded truncated human WT STING or AQ STING (amino acid residues 140-343) with N-terminal 8xHis and SUMO tag.

    [0184] The recombinant WT STING and AQ STING proteins were overexpressed in Rosetta-gami B (DE3) competent cells (cat. #71136-3, Merck Millipore, Billerica, USA). Bacterial pellets were re-suspended in ice-cold lysis buffer containing 50 mmol.Math.l.sup.?1 TrisCl (cat. #T1503, Sigma Aldrich, Czech Republic) pH 8.0, 300 mmol.Math.l.sup.?1 NaCl, 3 mmol.Math.l.sup.?1 ?-mercaptoethanol (cat. #M6250, Sigma Aldrich, Czech Republic), 10% glycerol (cat. #G5516, Sigma Aldrich, Czech Republic) and 20 mmol.Math.l.sup.?1 imidazole (cat. #15513, Sigma Aldrich, Czech Republic) using Dounce homogenizer. DNase I (cat. #D5025, Sigma Aldrich, Czech Republic) and RNase A (cat. #R6513, Sigma Aldrich, Czech Republic) were added (final concentration 50 ?g/ml) together with MgCl.sub.2 (final concentration 5 mmol.Math.l.sup.?1) to the homogenate and bacteria were lysed using French Press G-M? High-Pressure Cell Press Homogenizer (1500 psi, 3 cycles). Lysate was spun 30,000 g for 20 minutes and supernatant was gently stirred with Ni-NTA resin (cat. #745400.25 Macherey-Nagel, Duren, Germany) for 30 minutes. The resin was poured into a chromatography column, washed with 50 ml buffer A (50 mmol.Math.l.sup.?1 TrisCl (pH 8.0), 800 mmol.Math.l.sup.?1 NaCl, 3 mmol.Math.l.sup.?1 (3-mercaptol; 10% glycerol; 20 mmol.Math.l.sup.?1 imidazole) and 8-His-SUMO tagged STING proteins were eluted with 15 ml buffer A containing 300 mmol.Math.l.sup.?1 imidazole. The eluted proteins were cleaved with recombinant SUMO protease (80 ?g/ml of protein solution, cat. #12588018, ThermoFisher, Waltham, USA). The proteins were further purified by size exclusion chromatography using HiLoad 16/60 Superdex 75 (cat. #28989333, GE Healthcare Bio-Sciences, Pittsburgh, USA) in 50 mmol.Math.l.sup.?1 Tris Cl buffer pH 7.4 containing 150 mmol.Math.l.sup.?1 NaCl, and 10% glycerol. Proteins were concentrated with Amicon? Ultra-15 10 K device (cat. #UFC901008, Merck Millipore, Billerica, USA) and flash frozen in liquid N.sub.2.

    TABLE-US-00003 DNAsequenceof8-His-SUMO (SEQIDNO:7) ATGTCGCATCACCATCATCATCACCACCATGGGATGTCGGACTCAGAAGT CAATCAAGAAGCTAAGCCAGAGGTCAAGCCAGAAGTCAAGCCTGAGACTC ACATCAATTTAAAGGTGTCCGATGGATCTTCAGAGATCTTCTTCAAGATC AAAAAGACCACTCCTTTAAGAAGGCTGATGGAAGCGTTCGCTAAAAGACA GGGTAAGGAAATGGACTCCTTAAGATTCTTGTACGACGGTATTAGAATTC AAGCTGATCAGACCCCTGAAGATTTGGACATGGAGGATAACGATATTATT GAGGCTCACCGCGAACAGATTGGTGGATCC. Aminoacidsequenceof8-His-SUMO (SEQIDNO:8) MSHHHHHHHHGMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKI KKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDII EAHREQIGGS. AminoacidsequenceoftruncatedWTSTING (SEQIDNO:9) APAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNL LRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRV YSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAK LFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKE EVTV. AminoacidsequenceoftruncatedAQSTING (SEQIDNO:10) APAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNL LRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTADRAGIKDRV YSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAK LFCQTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKE EVTV.

    Differential Scanning Fluorimetry With WT STING and AQ STING

    [0185] WT and AQ allelic forms of STING protein were diluted to the final concentration 0.1 mg/ml in 100 mmol.Math.l.sup.?1 TrisCl buffer pH 7.4 containing, 150 mmol.Math.l.sup.?1 NaCl, 1:500 SYPRO Orange (cat. #S6650, ThermoFisher, Waltham, USA) and 150 ?M CDN or water. 20 ?L solutions of the reaction mixtures were pipetted in triplicates into 96 well optical reaction plates and thermal denaturation of samples were performed on real time PCR cycler (LightCycler? 480 Instrument IIRoche, Basel, Switzerland). The first derivative of the thermal denaturation curves was performed to calculate denaturing temperatures of STINGCDN complexes and STING apoproteins. The thermal shift for each CDN was calculated by subtracting the average denaturing temperature of STING apoprotein from the average denaturing temperature of STING CDN complex.

    Mouse cGAS Enzyme

    [0186] A recombinant DNA encoding cDNA of murine cGAS (residues 147-507) was chemically synthesized by GenScript (Piscataway, NJ). This sequence was cloned into the vector pET-22b(+) in-frame between pelB leader and His-tag by homologous recombination using Gibson Assembly? Master Mix (New England Biolabs). The protein was overexpressed in E. coli BL21 (DE3) (ThermoFisher, Waltham, USA). Bacterial pellet was re-suspended in ice-cold lysis buffer containing 20 mM Phosphate Na buffer (pH 7.4), 500 mM NaCl, 10% glycerol, and 20 mM imidazole using Dounce homogenizer. DNase I and RNase A were added (final concentration 50 ?g/ml) together with MgCl.sub.2 (final concentration 5 mM) to the homogenate and bacteria were lysed using MSE Soniprep 150 (3 mm Tip Solid Titanium Exponential Probe, 2 min, 50% power, amplitude 12 microns). The lysate was spun 30,000?g for 20 minutes and supernatant was loaded onto 5 mL HisTrap column (GE Healthcare BioSciences, Pittsburgh, USA). The resin was washed with 50 ml lysis buffer and mcGAS was eluted with 15 ml 20 mM Phosphate-Na buffer (pH 7.4) buffer containing 500 mM NaCl; 10% glycerol, and 300 mM imidazole. The protein was further purified by size exclusion chromatography using HiLoad 16/60 Superdex 75 in buffer containing 150 mM NaCl; 50 mM Tris (pH 7.4), and 10% glycerol. The protein buffer was exchanged for 50% glycerol, 50 mM Tris (pH 7.6), 100 mM NaCl, 1 mM DTT, 1 mM EDTA with Amicon? Ultra-15 10 K Device (Merck Millipore Ltd.), and mcGAS was flash frozen in liquid N.sub.2.

    TABLE-US-00004 MurinecGASaminoacidsequenceincluding pelBleaderandHis-tag (SEQIDNO:11) MKYLLPTAAAGLLLLAAQPAMAMPDKLKKVLDKLRLKRKDISEAAETVNK VVERLLRRMQKRESEFKGVEQLNTGSYYEHVKISAPNEFDVMFKLEVPRI ELQEYYETGAFYLVKFKRIPRGNPLSHFLEGEVLSATKMLSKFRKIIKEE VKEIKDIDVSVEKEKPGSPAVTLLIRNPEEISVDIILALESKGSWPISTK EGLPIQGWLGTKVRTNLRREPFYLVPKNAKDGNSFQGETWRLSFSHTEKY ILNNHGIEKTCCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHV KTAIFHMWTQDPQDSQWDPRNLSSCFDKLLAFFLECLRTEKLDHYFIPKF NLFSQELIDRKSKEFLSKKIEYERNNGFPIFDKLLEHHHHHH.

    TABLE-US-00005 TABLE 2 Biological Data Digitonin assay DSF ?T.sub.m (? C.) EC.sub.50 (?mol .Math. l.sup.?1) Compound WT STING AQ STING WT STING 28 5.6 13.3 0.02 24 8.5 16.9 0.03 34 1.6 9.2 0.45 50 1.8 9.3 0.28 51 6.8 15.8 0.08 52 2.4 10.7 1.35 53 2.9 11.5 0.28 54 8.5 17.2 0.01 55 11.0 20.0 0.01

    [0187] Although the foregoing disclosure has been described in some detail by way of illustration and Example for purposes of clarity of understanding, one of skill in the art will appreciate that certain changes and modifications may be practiced within the scope of the appended claims. In addition, each reference provided herein is incorporated by reference in its entirety to the same extent as if each reference was individually incorporated by reference. Where a conflict exists between the instant application and a reference provided herein, the instant application shall dominate.

    Synthesis and Characterization of 33 Isonucleotidic CDN Prodrugs

    [0188] The synthesis of compound 36 from compound 27 was accomplished according to the synthetic scheme depicted below, and detailed in the following description.

    ##STR00043##

    [0189] Crude 27 (cyclization starting from 46 mg of 9) was treated with neat tBuNH.sub.2 (5 mL) at ambient temperature for 20 minutes. Volatiles were evaporated and 35 was purified on RP FCC (ACN in 50 mM NH.sub.4HCO.sub.3, 0-100%, elution 40%) to afford base-only protected cyclic dinucleotide (32 mg, TEA.sup.+ salt). TEA.sup.+ was exchanged for a tetrabutylammonium cation on a DOWEX 50 (TBA.sup.+ cycle)

    [0190] Nucleobase-protected CDN (2 lima tetrabutylammonium salt) was azeotroped with dry toluene (1?500 ?L) and dry ACN (2?500 ?L), dissolved in dry ACN (700 uL) and treated with pivaloyloxymethyl iodide (20 ?mol, 5.3 ?L, J. E. Coughlin et al.; Bioorg. Med. Chem. Lett. 20 (2010) 1783-1786) under argon atmosphere at ambient temperature for 1 hour. The reaction mixture was quenched with 1 ml of 50% H.sub.2O/ACN and further diluted with 3 ml of water and purified on HPLC column (HPLC method 1). Fractions containing products (all 4 diastereoisomers) were pooled, evaporated and azeotroped with dry ACN (3?2 mL). To a solution of this intermediate in dry ACN (1 mL) under argon atmosphere was added NIS (2.2 mg, 10 ?mol). The reaction mixture was stirred at ambient temperature for 1 hour, after which water (100 ?L) was added followed by acetic acid (10 ?L). After 30 minutes of further stirring the reaction was quenched with saturated aqueous solution of Na.sub.2S.sub.2O.sub.3 (until decolorization), mixture was diluted with water (2 mL) and purified on HPLC column (HPLC method 2) affording 4 separate diastereisomers (the chiral centres being the phosphorus atoms) in approximately equimolar ratio (ca 150 nmol each)

    HPLC Method 1

    [0191]

    TABLE-US-00006 Time Flow H.sub.2O 1:1 H.sub.2O/ACN ACN (min) (mL/min) (%) (%) (%) 0 2 100 2 3 100 10 3 100 30 3 100 50 3 100 70 3 100

    HPLC Method 2

    [0192]

    TABLE-US-00007 Time Flow H.sub.2O 1:1 H.sub.2O/ACN ACN (min) (mL/min) (%) (%) (%) 0 2 80 20 2 3 80 20 10 3 80 20 40 3 100 60 3 50 50 80 3 100

    [0193] Preparative HPLC purifications were performed on Ingos LCP5020 chromatography system with columns packed with C18 reversed phase resin (Phenomenex Luna? RP18 Column, 5 ?m, 10?150 mm). In all methods were used linear gradients.

    [0194] The C18 analytical HPLC method described above was used for standard analysis.

    [0195] The following compounds were synthesized using the aforementioned methods using the compounds described above.

    TABLE-US-00008 TABLE 3 Exemplary compounds and characterization data Mass Compound Structure / Data [M + H].sup.+ 36a-d [00044]embedded image 873.3 {[(1R,6R,9R,10S,15R,17R,18R)-9,17-bis(6-amino-9H-purin-9-yl)- 12-{[(2,2-dimethylpropanoyl)oxy]methoxy}-18-fluoro-3,12-dioxo- 2,4,7,11,13,16-hexaoxa-3?.sup.5,12?.sup.5- diphosphatricyclo[13.3.0.0.sup.6,10]octadecan-3-yl]oxy}methyl 2,2- dimethylpropanoate 36a: HPLC retention time (C18, min): 3.42. .sup.1H NMR (501 MHz, CD.sub.3CN) ? 8.29 (s, 1H), 7.81 (s, 1H), 7.97 (s, 1H), 7.87 (s, 1H), 6.26 (bs, 2H), 6.18 (m, 1H), 6.16 (bs, 2H), 5.60 - 5.76 (m, 4H), 5.52 (m, 1H), 5.28 (td, J = 6.9, 4.6 Hz, 1H), 4.82 - 4.91 (m, 2H), 4.27-4.45 (m, 8H), 1.15 (s, 9H), 0.95 (s, 9H). .sup.31P NMR (202.4 MHz, CD.sub.3CN) ? ?4.78 (s), ?5.18 (s). .sup.19F NMR (470.4 MHz, CD.sub.3CN) ? ?196.67 (dm, J = 52.5 Hz). 36b: HPLC retention time (C18, min): 3.61. .sup.1H NMR (501 MHz, CD.sub.3CN) ? 8.29 (s, 1H), 7.77 (s, 1H), 8.03 (s, 1H), 7.87 (s, 1H), 6.19 (dd, 1H, J = 21.7, 1.1 Hz), 6.18 (bs, 2H), 6.12 (bs, 2H), 5.63 - 5.82 (m, 4H), 5.32 - 5.39 (m, 2H), 5.15 (dd, J = 15.4, 5.2 Hz, 1H), 5.03 (dd, J = 12.6, 5.2 Hz, 1H), 4.27 - 4.44 (m, 8H), 1.23 (s, 9H), 0.93 (s, 9H). .sup.31P NMR (202.4 MHz, CD.sub.3CN) ? ?2.38 (s), ?4.98 (s). .sup.19F NMR (470.4 MHz, CD.sub.3CN) ? ?195.22 (dt, J = 52.5, 21.0 Hz). 36c: HPLC retention time (C18, min): 3.62. .sup.1H NMR (501 MHz, CD.sub.3CN) ? 8.21 (s, 1H), 8.01 (s, 1H), 7.97 (s, 1H), 7.93 (s, 1H), 6.23 (dd, 1H, J = 18.8, 1.5 Hz), 6.04 (bs, 4H), 5.47 - 5.73 (m, 7H), 5.31 (m, 1H), 4.27 - 4.49 (m, 8H), 1.16 (s, 9H), 1.14 (s, 9H). .sup.31P NMR (202.4 MHz, CD.sub.3CN) ? ?2.82 (s), ?4.78 (s). .sup.19F NMR (470.4 MHz, CD.sub.3CN) ? ?198.00 (dt, J = 51.8, 18.7 Hz). 36d: HPLC retention time (C18, min): 3.84. D: .sup.1H NMR (501 MHz, CD.sub.3CN) ? 8.22 (s, 1H), 8.02 (s, 2H), 7.92 (s, 1H), 6.23 (dd, J = 20.3, 1.2 Hz, 1H), 6.05 (bs, 2H), 6.04 (bs, 2H), 5.49 - 5.77 (m, 7H), 5.35 (m, 1H), 4.17-4.49 (m, 8H), 1.23 (s, 9H), 1.15 (s, 9H). .sup.31P NMR (202.4 MHz, CD.sub.3CN) ? ?2.15 (s), ?2.42 (s). .sup.19F NMR (470.4 MHz, CD.sub.3CN) ? ?195.73 (dt, J = 51.9, 19.9 Hz). 56a-d [00045]embedded image 953.3 {[(1S,6R,8R,9R,10R,15R,18R)-8,18-bis(6-amino-9H-purin-9-yl)-9- fluoro-12-[(1-methylcyclohexanecarbonyloxy)methoxy]-3,12- dioxo-2,4,7,11,13,16-hexaoxa-3?.sup.5,12?.sup.5- diphosphatricyclo[13.3.0.0.sup.6,10]octadecan-3-yl]oxy}methyl 1- methylcyclohexane-1-carboxylate 56a: HPLC retention time (C18, min): 3.88. 56b: HPLC retention time (C18, min): 4.14. 56c: HPLC retention time (C18, min): 4.14. 56d: HPLC retention time (C18, min): 4.41. .sup.1H NMR (501 MHz, CD.sub.3CN) ? 8.22 (s, 1H), 8.02 (s, 1H), 8.02 (s, 1H), 7.92 (s, 1H), 6.23 (dd, J = 20.2, 1.2 Hz, 1H), 6.09 (bs, 2H), 6.07 (bs, 2H), 5.51 - 5.78 (m, 7H), 5.35 (m, 1H), 4.17 - 4.50 (m, 8H), 1.98 - 2.05 (m, 4H), 1.19 - 1.62 (m, 16H), 1.19 (s, 3H), 1.11 (s, 3H). .sup.31P NMR (202.4 MHz, CD.sub.3CN) ? ?2.18, ?2.27. .sup.19F NMR (470.4 MHz, CD.sub.3CN) ? ?195.70 (dt, J = 52.0, 19.9 Hz). 57a-d [00046]embedded image 901.3 {[(1R,6R,9R,10S,15R,17R,18R)-9,17-bis(6-amino-9H-purin-9-yl)- 12-{[(2,2-dimethylbutanoyl)oxy]methoxy}-18-fluoro-3,12-dioxo- 2,4,7,11,13,16-hexaoxa-3?.sup.5,12?.sup.5- diphosphatricyclo[13.3.0.0.sup.6,10]octadecan-3-yl]oxy}methyl 2,2- dimethylbutanoate 57a: HPLC retention time (C18, min): 3.61. 57b: HPLC retention time (C18, min): 3.83. 57c: HPLC retention time (C18, min): 3.84. 57d: HPLC retention time (C18, min): 4.08. .sup.1H NMR (501 MHz, CD.sub.3CN) ? 8.22 (s, 1H), 8.02 (s, 1H), 8.02 (s, 1H), 7.92 (s, 1H), 6.24 (dd, J = 20.2, 1.2 Hz, IH), 6.05 (bs, 2H), 6.03 (bs, 2H), 5.49 - 5.77 (m, 7H), 5.35 (m, 1H), 4.17 - 4.49 (m, 8H), 1.61 (q, 2H, J = 7.5 Hz), 1.54 (q, 2H, J = 7.5 Hz), 1.18 (s, 6H), 1.12 (s, 3H), 1.11 (s, 3H), 0.86 (t, J = 7.5 Hz, 3H), 0.79 (t, J = 7.5 Hz, 3H). .sup.31P NMR (202.4 MHz, CD.sub.3CN) ? ?2.16, ?2.34. .sup.19F NMR (470.4 MHz, CD.sub.3CN) ? ?195.71 (dt, J = 52.0, 19.9 Hz). 58a-d [00047]embedded image 957.3 {[(1R,6R,9R,10S,15R,17R,18R)-9,17-bis(6-amino-9H-purin-9-yl)- 18-fluoro-12-[(octanoyloxy)methoxy]-3,12-dioxo-2,4,7,11,13,16- hexaoxa-3?.sup.5,12?.sup.5-diphosphatricyclo[13.3.0.0.sup.6,10]octadecan-3- yl]oxy}methyl octanoate 58a: HPLC retention time (C18, min): 4.38. 58b: HPLC retention time (C18, min): 4.55. 58c: HPLC retention time (C18, min): 4.57. 58d: HPLC retention time (C18, min): 4.81. .sup.1H NMR (501 MHz, CD.sub.3CN) ? 8.22 (s, 1H), 8.05 (s, 1H), 8.02 (s, 1H), 7.93 (s, 1H), 6.24 (dd, J = 20.1, 1.3 Hz, 1H), 6.03 (bs, 2H), 6.01 (bs, 2H), 5.48 - 5.75 (m, 7H), 5.34 (m, 1H), 4.17 - 4.48 (m, 8H), 2.41 (t, J = 7.5 Hz, 2H), 2.33 (m, 2H), 1.52 - 1.63 (m, 4H), 1.20 - 1.40 (m, 16H), 0.87 (t, 3H, J = 7.1 Hz), 0.86 (t, 3H, J = 7.1 Hz). .sup.31P NMR (202.4 MHz, CD.sub.3CN) ? ?2.15, ?2.37. .sup.19F NMR (470.4 MHz, CD.sub.3CN) ? ?195.95 (dt, J = 52.1, 19.9 Hz).

    293T WT STING Standard Reporter Assay

    [0196] 293T wtSTING-FL cells were seeded at density of 250,000 cells per cm.sup.2 onto 96 well poly-D-lysine coated white micro plates in 100 ill DMEM medium with high glucose supplemented with 10% heat inactivated FBS. The medium was removed next day and three-fold serial dilutions of compounds in 100 ?l medium were added to the cells. The plates with cells were incubated for 7 hours at 37? C. with 5% CO.sub.2. After 50 ?l of the medium was removed, 30 ?l of ONE-Glo? Luciferase Assay System reagent (cat. #E6120, Promega, Madison, USA) was added to each well and luminescence was read on Synergy H1 (Biotek, Winooski, USA). GraphPad Prism (La Jolla, USA) was used to calculate the 50% effective concentration (EC.sub.50) from an 8-point dose-response curve. Control compounds 33-cGAMP (cat. #tlrl-nacga), 23-cGAMP (cat. #tlrl-nacga23), and 22-cGAMP (cat. #tlrl-nacga22) were purchased from Invivogen (San Diego, USA).

    TABLE-US-00009 TABLE 4 293T WT STING standard reporter assay data Compound 293T WT STING EC.sub.50 (?M) 54 0.156 55 0.340 36a 0.088 36b 0.077 36c 0.052 36d 0.028 56a 0.285 56b 0.044 56c 0.021 56d 0.041 57a 0.032 57b 0.018 57c 0.013 57d 0.014 58a 0.005 58b 0.001 58c 0.002 58d 0.002 33-cGAMP 68.4 22-cGAMP 10.2 23-cGAMP 36.9

    Peripheral Blood Mononuclear Cell Assay

    [0197] Selected compounds were tested in an in vitro peripheral blood mononuclear cell (PBMC) assay. Freshly isolated PBMCs were seeded into U-shaped shaped 96-well plates at desity 500,000 cells per well in 50 ?l of RPMI 1640 medium supplemented with 10% heat inactivated FBS. Serially dilluted tested compounds were added to wells in 50 ?l of cultivation medium and cell were incubated with compounds for 1 h at 37? C. with 5% CO.sub.2. Plates with cells were then spun 500 g for 5 minutes and medium was removed. Cells were washed twice with the cell culture medium by the use of centrifugation and gently resuspended in 100 ?l medium without compounds. After 15 hour incubation at 37? C. with 5% CO.sub.2, the cell culture medium was collected and the levels of interferon-alpha (INF-?), interferon-gamma (INF-?) and tumor necrosis factor-alpha (TNF-?) were determined with ProcartaPlex Assays (ThermoFisher, Waltham, USA) and MAGPIX System (Merck KGaA, Darmstadt, Germany). GraphPad Prism (San Diego, CA, USA) was used to calculate the 50% effective concentration (EC.sub.50) from a 6-point dose-response curve. Values reported are an average of runs from at least two donors.

    TABLE-US-00010 TABLE 5 Peripheral blood mononuclear cell data PBMC EC.sub.50 (?M) Compound IFN-? TNF-? IFN-? 36d 0.115 0.326 0.184 56d 0.048 0.159 0.325 57d 0.080 0.206 0.258 58d 0.016 0.037 0.038