ANTI-GDF-15 ANTIBODIES

20240166734 ยท 2024-05-23

    Inventors

    Cpc classification

    International classification

    Abstract

    Monoclonal antibodies that bind and inhibit the activity of human GDF15 are disclosed. The antibodies can be used to treat body weight loss, including cachexia, associated with the over-expression of human GDF15.

    Claims

    1-61. (canceled)

    62. A method of treating cachexia in a mammal comprising administering an effective amount of an anti-GDF15 antibody or antigen-binding fragment thereof that specifically binds to the same epitope on GDF15 as an antibody comprising an immunoglobulin heavy chain variable region and an immunoglobulin light chain variable region selected from the group consisting of: (a) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO:38 and SEQ ID NO:136 (Hu01G06 IGHV1-18 F2), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:237, SEQ ID NO:241 and SEQ ID NO:243 (Hu01G06 IGHV1-18 F2), and a CDR H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:15 and SEQ ID NO:154 (Hu01G06 IGHV1-18 F2); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21 and SEQ ID NO:160 (Hu01G06 IGKV1-39 F2), a CDR L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:26 and DAK (Hu01G06 IGKV1-39 F2), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:244 (Hu01G06 IGKV1-39 F2); (b) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO:234 and SEQ ID NO:235 (Hu01G06 IGHV1-69 F1), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:238, SEQ ID NO:241 and SEQ ID NO:243 (Hu01G06 IGHV1-69 F1), and a CDR H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:15 and SEQ ID NO:154 (Hu01G06 IGHV1-69 F1); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21 and SEQ ID NO:160 (Hu01G06 IGKV1-39 F1), a CDR L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:26 and DAK (Hu01G06 IGKV1-39 F1), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (Hu01G06 IGKV1-39 F1); (c) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:38 and SEQ ID NO:136 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:7, SEQ ID NO:143 and SEQ ID NO:148 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L), and a CDR H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:15 and SEQ ID NO:154 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21 and SEQ ID NO:160 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I), a CDR L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:26 and DAK (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I); (d) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:2 (03G05), a CDR H2 comprising the amino acid sequence of SEQ ID NO:8 (03G05), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:16 (03G05); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:22 (03G05), a CDR L2 comprising the amino acid sequence of SEQ ID NO:27 (03G05), and a CDR L3 comprising the amino acid sequence of SEQ ID NO: 33 (03G05); (e) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:3 (04F08), a CDR H2 comprising the amino acid sequence of SEQ ID NO:9 (04F08), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:17 (04F08); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:23 (04F08), a CDR L2 comprising the amino acid sequence of SEQ ID NO:28 (04F08), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:34 (04F08); (f) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:4 (06C11, Ch06C11 Chimeric, Hu06C11 IGHV2-5), a CDR H2 comprising the amino acid sequence of SEQ ID NO:9 (06C11, Ch06C11 Chimeric, Hu06C11 IGHV2-5), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:18 (06C11, Ch06C11 Chimeric, Hu06C11 IGHV2-5); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:23 (06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16), a CDR L2 comprising the amino acid sequence of SEQ ID NO:28 (06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:35 (06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16); (g) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:1 (08G01), a CDR H2 comprising the amino acid sequence of SEQ ID NO:10 (08G01), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (08G01); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:24 (08G01), a CDR L2 comprising the amino acid sequence of SEQ ID NO:29 (08G01), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (08G01); (h) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:5 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), a CDR H2 comprising the amino acid sequence of SEQ ID NO:11 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:19 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:23 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), a CDR L2 comprising the amino acid sequence of SEQ ID NO:30 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:36 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16); (i) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:6 (17B11), a CDR H2 comprising the amino acid sequence of SEQ ID NO:12 (17B11), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:20 (17B11); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:25 (17B11), a CDR L2 comprising the amino acid sequence of SEQ ID NO:31 (17B11), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:37 (17B11); (j) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:38 and SEQ ID NO:136 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:13, SEQ ID NO:143 and SEQ ID NO:148 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q), and a CDR H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:15 and SEQ ID NO:154 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21 and SEQ ID NO:160 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I), a CDR L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:26 and DAK (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I); (k) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO:38 and SEQ ID NO:136 (Hu01G06 IGHV1-18 F1), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:236, SEQ ID NO:240 and SEQ ID NO:242 (Hu01G06 IGHV1-18 F1), and a CDR H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:15 and SEQ ID NO:154 (Hu01G06 IGHV1-18 F1); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21 and SEQ ID NO:160 (Hu01G06 IGKV1-39 F1), a CDR L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:26 and DAK (Hu01G06 IGKV1-39 F1), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (Hu01G06 IGKV1-39 F1); (l) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO:234, and SEQ ID NO:235 (Hu01G06 IGHV1-69 F2), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:239, SEQ ID NO:240 and SEQ ID NO:242 (Hu01G06 IGHV1-69 F2), and a CDR H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:15 and SEQ ID NO:154 (Hu01G06 IGHV1-69 F2); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21 and SEQ ID NO:160 (Hu01G06 IGKV1-39 F1), a CDR L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:26 and DAK (Hu01G06 IGKV1-39 F1), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (Hu01G06 IGKV1-39 F1); (m) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO:234 and SEQ ID NO:235 (Hu01G06 IGHV1-69 F2), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:239, SEQ ID NO:240 and SEQ ID NO:242 (Hu01G06 IGHV1-69 F2), and a CDR H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:15 and SEQ ID NO:154 (Hu01G06 IGHV1-69 F2); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21 and SEQ ID NO:160 (Hu01G06 IGKV1-39 F2), a CDR L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:26 and DAK (Hu01G06 IGKV1-39 F2), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:244 (Hu01G06 IGKV1-39 F2); (n) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:4 (HE LM 06C11 IGHV2-70), a CDR H2 comprising the amino acid sequence of SEQ ID NO:14 (HE LM 06C11 IGHV2-70), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:18 (HE LM 06C11 IGHV2-70); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:23 (Ch06C11 Chimeric, Sh06C11 IGKV1-16), a CDR L2 comprising the amino acid sequence of SEQ ID NO:28 (Ch06C11 Chimeric, Sh06C11 IGKV1-16), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:35 (Ch06C11 Chimeric, Sh06C11 IGKV1-16); (o) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:4 (Ch06C11 Chimeric), a CDR H2 comprising the amino acid sequence of SEQ ID NO:9 (Ch06C11 Chimeric), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:18 (Ch06C11 Chimeric); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:23 (Ch14F11 Chimeric), a CDR L2 comprising the amino acid sequence of SEQ ID NO:30 (Ch14F11 Chimeric), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:36 (Ch14F11 Chimeric); (p) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:5 (Ch14F11 Chimeric), a CDR H2 comprising the amino acid sequence of SEQ ID NO:11 (Ch14F11 Chimeric), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:19 (Ch14F11 Chimeric); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:23 (Ch06C11 Chimeric), a CDR L2 comprising the amino acid sequence of SEQ ID NO:28 (Ch06C11 Chimeric), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:35 (Ch06C11 Chimeric); (q) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:234 and SEQ ID NO:235 (Sh01G06 IGHV1-69 T30S I69L), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:7, SEQ ID NO:143 and SEQ ID NO:148 (Sh01G06 IGHV1-69 T30S I69L), and a CDR H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:15 and SEQ ID NO:154 (Sh01G06 IGHV1-69 T30S I69L); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21 and SEQ ID NO:160 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I), a CDR L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:26 and DAK (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I); (r) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:234 and SEQ ID NO:235 (Sh01G06 IGHV1-69 T30S K64Q I69L), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:13, SEQ ID NO:143 and SEQ ID NO:148 (Sh01G06 IGHV1-69 T30S K64Q I69L), and a CDR H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:15 and SEQ ID NO:154 (Sh01G06 IGHV1-69 T30S K64Q I69L); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21 and SEQ ID NO:160 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I), a CDR L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:26 and DAK (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I); (s) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:38 and SEQ ID NO:136 (Hu01G06 IGHV1-18 F2), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:237, SEQ ID NO:241 and SEQ ID NO:243 (Hu01G06 IGHV1-18 F2), and a CDR H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:15 and SEQ ID NO:154 (Hu01G06 IGHV1-18 F2); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21 and SEQ ID NO:160 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I), a CDR L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:26 and DAK (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I); (t) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:38 and SEQ ID NO:136 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:7, SEQ ID NO:143 and SEQ ID NO:148 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L), and a CDR H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:15 and SEQ ID NO:154 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21 and SEQ ID NO:160 (Hu01G06 IGKV1-39 F2), a CDR L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:26 and DAK (Hu01G06 IGKV1-39 F2), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:244 (Hu01G06 IGKV1-39 F2); (u) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:38 and SEQ ID NO:136 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:13, SEQ ID NO:143 and SEQ ID NO:148 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q), and a CDR H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:15 and SEQ ID NO:154 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21 and SEQ ID NO:160 (Hu01G06 IGKV1-39 F2), a CDR L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:26 and DAK (Hu01G06 IGKV1-39 F2), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:244 (Hu01G06 IGKV1-39 F2); (v) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:234 and SEQ ID NO:235 (Sh01G06 IGHV1-69 T30S I69L), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:7, SEQ ID NO:143 and SEQ ID NO:148 (Sh01G06 IGHV1-69 T30S I69L), and a CDR H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:15 and SEQ ID NO:154 (Sh01G06 IGHV1-69 T30S I69L); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21 and SEQ ID NO:160 (Hu01G06 IGKV1-39 F2), a CDR L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:26 and DAK (Hu01G06 IGKV1-39 F2); and a CDR L3 comprising the amino acid sequence of SEQ ID NO:244 (Hu01G06 IGKV1-39 F2); (w) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:234 and SEQ ID NO:235 (Sh01G06 IGHV1-69 T30S K64Q I69L), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:13, SEQ ID NO:143 and SEQ ID NO:148 (Sh01G06 IGHV1-69 T30S K64Q I69L), and a CDR H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:15 and SEQ ID NO:154 (Sh01G06 IGHV1-69 T30S K64Q 169L); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21 and SEQ ID NO:160 (Hu01G06 IGKV1-39 F2), a CDR L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:26 and DAK (Hu01G06 IGKV1-39 F2), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:244 (Hu01G06 IGKV1-39 F2); (x) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:38 and SEQ ID NO:136 (Hu01G06 IGHV1-18 F1), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:236, SEQ ID NO:240 and SEQ ID NO:242 (Hu01G06 IGHV1-18 F1), and a CDR H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:15 and SEQ ID NO:154 (Hu01G06 IGHV1-18 F1); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21 and SEQ ID NO:160 (Hu01G06 IGKV1-39 F2), a CDR L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:26 and DAK (Hu01G06 IGKV1-39 F2), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:244 (Hu01G06 IGKV1-39 F2); and (y) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:234 and SEQ ID NO:235 (Hu01G06 IGHV1-69 F1), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:238, SEQ ID NO:241 and SEQ ID NO:243 (Hu01G06 IGHV1-69 F1), and a CDR H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:15 and SEQ ID NO:154 (Hu01G06 IGHV1-69 F1); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21 and SEQ ID NO:160 (Hu01G06 IGKV1-39 F2), a CDR L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:26 and DAK (Hu01G06 IGKV1-39 F2), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:244 (Hu01G06 IGKV1-39 F2) to a mammal in need thereof.

    63. The method of claim 62, wherein loss of muscle mass associated with cachexia is inhibited.

    64. The method of claim 63, wherein the cachexia is associated with an underlying disease selected from the group consisting of cancer, chronic heart failure, chronic kidney disease, COPD, AIDS, multiple sclerosis, rheumatoid arthritis, sepsis, and tuberculosis.

    65. The method of claim 63, wherein the loss of muscle mass is accompanied by a loss of fat mass.

    66. The method of claim 62, wherein involuntary weight loss associated with cachexia is inhibited or reduced.

    67. The method of claim 62, wherein loss of organ mass associated with cachexia is inhibited.

    68. The method of claim 67, wherein the cachexia is associated with an underlying disease selected from the group consisting of cancer, chronic heart failure, chronic kidney disease, COPD, AIDS, multiple sclerosis, rheumatoid arthritis, sepsis, and tuberculosis.

    69. The method of claim 67, wherein the organ is kidney, liver, heart or spleen.

    70. The method of claim 67, wherein the loss of organ mass is accompanied by a loss of muscle mass, a loss of fat mass or involuntary weight loss.

    71. The method of claim 62 further comprising administering a second agent to the mammal in need thereof, wherein the second agent is selected from the group consisting of an inhibitor of Activin-A, an inhibitor of ActRIIB, an inhibitor of IL-6, an inhibitor of IL-6R, a melanocortin peptide inhibitor, a melanocortin receptor inhibitor, a ghrelin, a ghrelin mimetic, a GHS-R1a agonist, a SARM, a TNF? inhibitor, an IL-1? inhibitor, a myostatin inhibitor, a beta-blocker and an anti-cancer agent.

    72. The method of claim 62, wherein sarcopenia associated with cachexia is treated.

    73. The method of claim 62, wherein the incidence and/or severity of cachexia is decreased.

    74. The method of claim 71, wherein the antibody or antigen-binding fragment thereof is administered in combination with the anti-cancer agent.

    75. The method of claim 62, wherein the anti-GDF15 antibody or antigen-binding fragment thereof specifically binds to the same epitope on GDF15 as an antibody comprising an immunoglobulin heavy chain variable region and an immunoglobulin light chain variable region selected from the group consisting of: (a) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:248 (Hu01G06 IGHV1-18 F2), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:254 (Hu01G06 IGKV1-39 F2); (b) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:250 (Hu01G06 IGHV1-69 F1), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 F1); (c) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (01G06, Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (01G06, Ch01G06 Chimeric); (d) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:42 (03G05), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:78 (03G05); (e) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:44 (04F08), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:80 (04F08); (f) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:46 (06C11), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:82 (06C11); (g) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:48 (08G01), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:84 (08G01); (h) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:50 (14F11), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:86 (14F11); (i) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:52 (17B11), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:88 (17B11); (j) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric); (k) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric); (l) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric); (m) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric); (n) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric); (o) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric); (p) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric); (q) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39); (r) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39); (s) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39); (t) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39); (u) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39); (v) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39); (w) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39); (x) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39); (y) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I); (z) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I); (aa) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I); (bb) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I); (cc) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I); (dd) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I); (ee) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I); (ff) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I); (gg) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I); (hh) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I); (ii) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I); (jj) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I); (kk) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I); (ll) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I); (mm) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I); (nn) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I); (oo) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:246 (Hu01G06 IGHV1-18 F1), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 F1); (pp) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:252 (Hu01G06 IGHV1-69 F2), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 F1); (qq) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:252 (Hu01G06 IGHV1-69 F2), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:254 (Hu01G06 IGKV1-39 F2); (rr) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:68 (HE LM 06C11 IGHV2-70), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:82 (Ch06C11 Chimeric); (ss) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:70 (Hu06C11 IGHV2-5), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:82 (Ch06C11 Chimeric); (tt) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:46 (Ch06C11 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:96 (Sh06C11 IGKV1-16); (uu) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:68 (HE LM 06C11 IGHV2-70), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:96 (Sh06C11 IGKV1-16); (vv) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:70 (Hu06C11 IGHV2-5), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:96 (Sh06C11 IGKV1-16); (ww) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:72 (Sh14F11 IGHV2-5), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:86 (Ch14F11 Chimeric); (xx) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:74 (Sh14F11 IGHV2-70), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:86 (Ch14F11 Chimeric); (yy) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:50 (Ch14F11 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:98 (Hu14F11 IGKV1-16); (zz) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:72 (Sh14F11 IGHV2-5), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:98 (Hu14F11 IGKV1-16); (aaa) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:74 (Sh14F11 IGHV2-70), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:98 (Hu14F11 IGKV1-16); (bbb) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:248 (Hu01G06 IGHV1-18 F2), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 F1); (ccc) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (01G06, Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:254 (Hu01G06 IGKV1-39 F2); (ddd) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO: 254 (Hu01G06 IGKV1-39 F2); (eee) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO: 254 (Hu01G06 IGKV1-39 F2); (fff) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO: 254 (Hu01G06 IGKV1-39 F2); (ggg) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO: 254 (Hu01G06 IGKV1-39 F2); (hhh) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO: 254 (Hu01G06 IGKV1-39 F2); (iii) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO: 254 (Hu01G06 IGKV1-39 F2); (jjj) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO: 254 (Hu01G06 IGKV1-39 F2); (kkk) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:246 (Hu01G06 IGHV1-18 F1), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO: 254 (Hu01G06 IGKV1-39 F2); and (lll) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:250 (Hu01G06 IGHV1-69 F1), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO: 254 (Hu01G06 IGKV1-39 F2).

    76. The method of claim 62, wherein the anti-GDF15 antibody or antigen-binding fragment thereof specifically binds to the same epitope on GDF15 as an antibody comprising an immunoglobulin heavy chain and an immunoglobulin light chain selected from the group consisting of: (a) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:258 (Hu01G06 IGHV1-18 F2), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:264 (Hu01G06 IGKV1-39 F2); (b) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:260 (Hu01G06 IGHV1-69 F1), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 F1); (c) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:176 (Ch01G06 Chimeric), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:204 (Ch01G06 Chimeric); (d) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:192 (Ch06C11 Chimeric), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:212 (Ch06C11 Chimeric); (e) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:198 (Ch14F11 Chimeric), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:216 (Ch14F11 Chimeric); (f) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:178 (Hu01G06 IGHV1-18), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:206 (Hu01G06 IGKV1-39); (g) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:180 (Hu01G06 IGHV1-69), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:206 (Hu01G06 IGKV1-39); (h) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:184 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:210 (Hu01G06 IGKV1-39 V48I); (i) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:188 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:210 (Hu01G06 IGKV1-39 V48I); (j) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:184 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 S43A V48I); (k) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:188 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 S43A V48I); (l) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:256 (Hu01G06 IGHV1-18 F1), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 F1); (m) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:262 (Hu01G06 IGHV1-69 F2), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 F1); (n) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:262 (Hu01G06 IGHV1-69 F2), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:264 (Hu01G06 IGKV1-39 F2); (o) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:194 (HE LM 06C11 IGHV2-70), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:214 (Sh06C11 IGKV1-16); (p) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:196 (Hu06C11 IGHV2-5), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:214 (Sh06C11 IGKV1-16); (q) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:200 (Sh14F11 IGHV2-5), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:218 (Hu14F11 IGKV1-16); (r) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:202 (Sh14F11 IGHV2-70), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:218 (Hu14F11 IGKV1-16); (s) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:182 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:206 (Hu01G06 IGKV1-39); (t) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:186 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:206 (Hu01G06 IGKV1-39); (u) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO: 184 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:206 (Hu01G06 IGKV1-39); (v) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:188 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:206 (Hu01G06 IGKV1-39); (w) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:190 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:206 (Hu01G06 IGKV1-39); (x) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:182 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:210 (Hu01G06 IGKV1-39 V48I); (y) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:186 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:210 (Hu01G06 IGKV1-39 V48I); (z) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:190 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:210 (Hu01G06 IGKV1-39 V48I); (aa) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:182 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 S43A V48I); (bb) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:186 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 S43A V48I); (cc) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:190 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 S43A V48I); (dd) an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO: 204 and an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:178, 180, 182, 184, 186, 188, or 190; (ee) an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO: 208 and an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO: 176, 178, 180, or 258; (ff) an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO: 210 and an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO: 176, 178, or 180; (gg) an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO: 264 and an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO: 176, 178, 180, 182, 184, 186, 188, 190, 256, or 260; and (hh) an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO: 206 and an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO: 176.

    77. The method of claim 62, wherein the cachexia is associated with an underlying disease selected from the group consisting of cancer, chronic heart failure, chronic kidney disease, COPD, AIDS, multiple sclerosis, rheumatoid arthritis, sepsis, and tuberculosis.

    78. The method of claim 62, wherein the anti-GDF15 antibody or antigen-binding fragment thereof specifically binds to the same epitope on GDF15 as an antibody comprising (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:234, and SEQ ID NO:235 (Hu01G06 IGHV1-69 F1), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:238, SEQ ID NO:241, and SEQ ID NO:243, (Hu01G06 IGHV1-69 F1), and a CDR H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:15 and SEQ ID NO:154 (Hu01G06 IGHV1-69 F1); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21 and SEQ ID NO:160 (Hu01G06 IGKV1-39 F1), CDR L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:26 and DAK (Hu01G06 IGKV1-39 F1), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (Hu01G06 IGKV1-39 F1).

    79. The method of claim 78, further comprising administering a second agent to the mammal in need thereof, wherein the second agent is selected from the group consisting of an inhibitor of Activin-A, an inhibitor of ActRIIB, an inhibitor of IL-6, an inhibitor of IL-6R, a melanocortin peptide inhibitor, a melanocortin receptor inhibitor, a ghrelin, a ghrelin mimetic, a GHS-R1a agonist, a SARM, a TNF? inhibitor, an IL-1? inhibitor, a myostatin inhibitor, a beta-blocker and an anti-cancer agent.

    80. The method of claim 78, wherein the cachexia is associated with an underlying disease selected from the group consisting of cancer, chronic heart failure, chronic kidney disease, COPD, AIDS, multiple sclerosis, rheumatoid arthritis, sepsis, and tuberculosis.

    81. The method of claim 62, wherein appetite in a mammal suffering from cachexia is increased.

    Description

    DESCRIPTION OF THE DRAWINGS

    [0016] The invention can be more completely understood with reference to the following drawings.

    [0017] FIG. 1 (prior art) is a schematic representation of atypical naturally-occurring antibody.

    [0018] FIG. 2 is a graph representing results from an experiment to measure hGDF15 serum levels in na?ve mice or mice bearing human xenograft tumors (Chago, RPMI7951, PC3, TOV21G, HT-1080, K-562, LS1034), as determined by ELISA.

    [0019] FIG. 3 is a plot representing results from an experiment to determine the plasma pharmacokinetics (PK) of cleaved rhGDF15 administered by subcutaneous injection (1 ?g/g) in na?ve ICR-SCID mice, as determined by ELISA.

    [0020] FIG. 4 is a graph summarizing results from an experiment to measure cachectic activity of cleaved rhGDF15 protein (?) and negative control (PBS ()) to induce body weight loss in immune-incompetent mice, ICR-SCID. Arrows indicate subcutaneous doses of 1 ?g/g of rhGDF15.

    [0021] FIGS. 5A and 5B are graphs summarizing results from an experiment to measure cachectic activity of mFc-rhGDF15 (a mouse Fc fused to the amino terminus of a mature recombinant human GDF15; ?), rFc-rmGDF15 (a rabbit Fc fused to the amino terminus of a mature recombinant mouse GDF15; ?), and negative control (PBS; ) to induce body weight loss in immune-competent Balb/C mice (FIG. 5A) and immune-incompetent CB17-SCID mice (FIG. 5B). Arrows indicate subcutaneous doses of 1 ?g/g of recombinant protein.

    [0022] FIGS. 6A-6E are graphs summarizing results from an experiment to demonstrate cachectic activity of mFc-rhGDF15 (?) and negative control (PBS; ) to induce body weight loss in immune-incompetent ICR-SCID mice (FIG. 6A; arrows indicate subcutaneous doses of 1 ?g/g of mFc-rhGDF15); to induce loss of adipose tissue or gonadal fat mass (FIG. 6B); to induce loss of muscle mass of gastrocnemius muscle (FIG. 6C; Gastroc Mass); and to increase mRNA expression of muscle degradation molecular markers (mMuRF1 (FIG. 6D) and mAtrogin (FIG. 6E)).

    [0023] FIG. 7 is a graph summarizing results from an experiment to measure cachectic activity of mFc-rhGDF15 (?) and negative control (PBS; ) to induce body weight loss in immune-incompetent Balb/C nude mice. Arrows indicate subcutaneous doses of 1.33 ?g/g of mFc-rhGDF15.

    [0024] FIG. 8 is a graph summarizing results from an experiment to measure serum levels of mFc-rhGDF15 in mice dosed with the recombinant protein. The presence of mFc-rhGDF15 was determined by Western Blot. Two positive bands corresponding to mFc-rhGDF15 and rhGDF15 (according to the appropriate molecular size) were quantified by Licor. The percentage of released-rhGDF15 versus mFc-rhGDF15 was calculated.

    [0025] FIG. 9A is a graph summarizing results from an experiment to measure cachectic activity of mFc-rhGDF15 (0.1 ?g/g (?), 0.01 ?g/g (?)) and negative control (mIgG 0.1 ?g/g ()) to induce body weight loss in immune-incompetent ICR-SCID mice. Arrows indicate the intraperitoneal dose of the recombinant protein. FIG. 9B is a graph representing the total level of rhGDF15 in the plasma of mice dosed with mFc-rhGDF15 (0.1 ?g/g (?), 0.01 ?g/g (?)) five days post dose, as determined by ELISA.

    [0026] FIG. 10 is a sequence alignment showing the amino acid sequence of the complete immunoglobulin heavy chain variable region of antibodies 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, and 17B11. The amino acid sequences for each antibody are aligned against one another, and CDR.sub.1, CDR.sub.2, and CDR.sub.3, are identified in boxes. The unboxed sequences represent framework (FR) sequences. Alignment positioning (gaps) is based on Kabat numbering, rather than an alignment algorithm such as Clustal. Numbering above the sequences represents Kabat numbering.

    [0027] FIG. 11 is a sequence alignment showing the CDR.sub.1, CDR.sub.2, and CDR.sub.3 sequences for each of the immunoglobulin heavy chain variable region sequences in FIG. 10.

    [0028] FIG. 12 is a sequence alignment showing the amino acid sequence of the complete immunoglobulin light chain variable region of antibodies 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, and 17B11. The amino acid sequences for each antibody are aligned against one another, and CDR.sub.1, CDR.sub.2, and CDR.sub.3, are identified in boxes. The unboxed sequences represent framework (FR) sequences. Alignment positioning (gaps) is based on Kabat numbering, rather than an alignment algorithm such as Clustal. Numbering above the sequences represents Kabat numbering.

    [0029] FIG. 13 is a sequence alignment showing the CDR.sub.1, CDR.sub.2, and CDR.sub.3 sequences for each of the immunoglobulin light chain variable region sequences in FIG. 12.

    [0030] FIG. 14 is a graph summarizing results from an experiment to measure cachectic inhibitory activity of anti-GDF15 antibodies 01G06 (?), 03G05 (?), 04F08 (.Math.), 06C11 (?), 14F11 (custom-character), and 17B11 (?), and a murine IgG control (; mIgG) dosed at 10 mg/kg in an mFc-rhGDF15 cachectic model in ICR-SCID mice. The arrow indicates intra-peritoneal injection of antibody.

    [0031] FIG. 15 is a graph summarizing results from an experiment to measure cachectic inhibitory activity of anti-GDF15 antibodies 01G06 (?), 03G05 (?), 04F08 (?), 06C11 (?), 08G01 (?), 14F11 (?), and 17B11 (custom-character), and a murine IgG control (; mIgG), dosed at 10 custom-charactermg/kg in an HT-1080 fibrosarcoma tumor xenograft model in ICR-SCID mice. The arrows indicate intra-peritoneal injection of antibody every three days.

    [0032] FIGS. 16A-16E are graphs summarizing results from an experiment to demonstrate anti-cachectic activity of anti-GDF15 antibody 01G06 (?), dosed at 10 mg/kg, in immune-incompetent mice (ICR-SCID) bearing an HT-1080 fibrosarcoma tumor xenograft model. Treatment with antibody 01G06 reversed body weight loss (FIG. 16A); induced a significant increase in food consumption for up to three days post dose (FIG. 16B); induced a gain of gonadal fat mass (FIG. 16C); induced a gain of muscle mass of gastrocnemius muscle (FIG. 16D); and decreased mRNA expression of muscle degradation molecular markers (mMuRF1 and mAtrogin (FIG. 16E)) compared to negative control (murine IgG ()). In FIG. 16A, the arrow indicates intra-peritoneal injection of antibody.

    [0033] FIGS. 17A-17B are graphs summarizing results from an experiment to demonstrate anti-cachectic activity of anti-GDF15 antibody 01G06 (?), dosed at 2 mg/kg, in immune-incompetent mice (ICR-SCID) bearing an HT-1080 fibrosarcoma tumor xenograft model. Treatment with antibody 01G06 reversed body weight loss compared to murine IgG () (FIG. 17A); and induced a gain of organ mass (liver, heart, spleen, kidney) and induced a gain of tissue mass (gonadal and gastrocnemius) (FIG. 17B) compared to negative control (murine IgG) and baseline (day 1). The arrows in FIG. 17A indicate intra-peritoneal injection of antibody.

    [0034] FIG. 18 is a graph summarizing results from an experiment to measure cachectic inhibitory activity of anti-GDF15 antibodies 01G06 (?), 03G05 (?), 04F08 (?), 06C11 (?), 08G01 (?), 14F11 (?), and 17B11 (?), and a murine IgG control () dosed at 10 mg/kg in a K-562 leukemia tumor xenograft model in immune-incompetent (CB17SCRFMF) mice. The arrows indicate intra-peritoneal injection of antibody.

    [0035] FIG. 19 is a sequence alignment showing the amino acid sequence of the complete immunoglobulin heavy chain variable region of chimeric 01G06 variable region denoted as Ch01G06 Chimeric; humanized 01G06 heavy chain variable regions denoted as Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L, Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S I69L, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, and Hu01G06 IGHV1-69 F2; chimeric 06C11 denoted as Ch06C11 Chimeric; humanized 06C11 heavy chain variable regions denoted as HE LM 06C11 IGHV2-70, and Hu06C11 IGHV2-5; chimeric 14F11 denoted as Ch14F11 Chimeric; and humanized 14F11 heavy chain variable regions denoted as Sh14F11 IGHV2-5 and Sh14F11 IGHV2-70. The amino acid sequences for each antibody are aligned against one another, and CDR.sub.1, CDR.sub.2, and CDR.sub.3, are identified in boxes. The unboxed sequences represent framework (FR) sequences. Alignment positioning (gaps) is based on Kabat numbering, rather than an alignment algorithm such as Clustal. Numbering above the sequences represents Kabat numbering.

    [0036] FIG. 20 is a sequence alignment showing the CDR.sub.1, CDR.sub.2, and CDR.sub.3 sequences for each of the immunoglobulin heavy chain variable region sequences in FIG. 19.

    [0037] FIG. 21 is a sequence alignment showing the amino acid sequence of the complete immunoglobulin light chain variable region of chimeric 01G06 denoted as Ch01G06 Chimeric; humanized 01G06 light chain variable regions denoted as Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, Hu01G06 IGKV1-39 F1, and Hu01G06 IGKV1-39 F2; chimeric 06C11 denoted as Ch06C11 Chimeric; humanized 06C11 light chain variable region denoted as Sh06C11 IGKV1-16; chimeric 14F11 denoted as Ch14F11 Chimeric; and humanized 14F11 light chain variable region denoted as Hu14F11 IGKV1-16. The amino acid sequences for each antibody are aligned against one another, and CDR.sub.1, CDR.sub.2, and CDR.sub.3, are identified in boxes. The unboxed sequences represent framework (FR) sequences. Alignment positioning (gaps) is based on Kabat numbering, rather than an alignment algorithm such as Clustal. Numbering above the sequences represents Kabat numbering.

    [0038] FIG. 22 is a sequence alignment showing the CDR.sub.1, CDR.sub.2, and CDR.sub.3 sequences for each of the immunoglobulin light chain variable region sequences in FIG. 21.

    [0039] FIG. 23 is a graph summarizing results from an experiment to measure cachectic inhibitory activity of anti-GDF15 antibodies 01G06 (?), Hu01G06-46 (?), and Hu01G06-52 (*), and a murine IgG control () dosed at 2 mg/kg in an HT-1080 fibrosarcoma tumor xenograft model in ICR-SCID mice. The arrow indicates intra-peritoneal injection of antibody.

    [0040] FIG. 24 is a graph summarizing results from an experiment to measure cachectic inhibitory activity of anti-GDF15 antibodies 06C11 (?), Hu06C11-27 (?), and Hu06C11-30 (?), and a murine IgG control () dosed at 2 mg/kg in an HT-1080 fibrosarcoma tumor xenograft model in ICR-SCID mice. The arrow indicates intra-peritoneal injection of antibody.

    [0041] FIG. 25 is a graph summarizing results from an experiment to measure cachectic inhibitory activity of anti-GDF15 antibodies 14F11 (?), Hu14F11-39 (?), and Hu14F11-47 (?), and a murine IgG control () dosed at 2 mg/kg in an HT-1080 fibrosarcoma tumor xenograft model in ICR-SCID mice. The arrow indicates intra-peritoneal injection of antibody.

    [0042] FIG. 26 is a graph summarizing results from an experiment to measure cachectic inhibitory activity of anti-GDF15 antibodies Hu01G06-122 (.Math.), Hu01G06-127 (?), Hu01G06-135 (?), Hu01G06-138 (?), and Hu01G06-146 (*), and a human IgG control () dosed at 2 mg/kg in an HT-1080 fibrosarcoma tumor xenograft model in ICR-SCID mice. The arrow indicates intra-peritoneal injection of antibody.

    [0043] FIG. 27 is a graph summarizing results from an experiment to measure cachectic inhibitory activity of anti-GDF15 antibodies Hu01G06-122 (.Math.), Hu01G06-127 (?), Hu01G06-135 (?), Hu01G06-138 (?), and Hu01G06-146 (*), and a human IgG control () dosed at 2 mg/kg in an mFc-rhGDF15 cachectic model in ICR-SCID mice. The arrow indicates intra-peritoneal injection of antibody.

    [0044] FIG. 28 is a graph summarizing results from an experiment to measure cachectic dose response inhibitory activity of anti-GDF15 antibodies Hu01G06-127 dosed at 20 mg/kg (?), 2 mg/kg (?), and 0.2 mg/kg (?); Hu01G06-135 at 20 mg/kg (?), 2 mg/kg (?), and 0.2 mg/kg (.Math.), and a human IgG control at 20 mg/kg () in an HT-1080 fibrosarcoma tumor xenograft model in ICR-SCID mice. The arrow indicates intravenous injection of antibody.

    [0045] FIGS. 29A-29C are graphs summarizing results from an experiment to demonstrate anti-cachectic activity of anti-GDF15 antibodies Hu01G06-127 (?), dosed at 10 mg/kg, in immune-incompetent mice (ICR-SCID) bearing an HT-1080 fibrosarcoma tumor xenograft model. Treatment with antibody Hu01G06-127 reversed body weight loss (FIG. 29A); induced a gain of gonadal fat mass (FIG. 29B); and induced a gain of muscle mass of gastrocnemius muscle (FIG. 29 C) compared to negative control (hIgG (); FIG. 29A) similar to levels found in non tumor bearing mice (SHAM (?); FIG. 29A). The arrows in FIG. 29A indicate intra-peritoneal injection of antibody.

    DETAILED DESCRIPTION

    [0046] The anti-GDF15 antibodies disclosed herein are based on the antigen binding sites of certain monoclonal antibodies that have been selected on the basis of binding and neutralization of human GDF15 (hGDF15). The antibodies contain immunoglobulin variable region CDR sequences that define a binding site for hGDF15.

    [0047] By virtue of the neutralizing activity of these antibodies, they are useful for treating cachexia and/or sarcopenia. For use as therapeutic agents, the antibodies can be engineered to minimize or eliminate an immune response when administered to a human patient. Various features and aspects of the invention are discussed in more detail below.

    [0048] As used herein, cachexia means a metabolic syndrome associated with underlying disease and characterized by involuntary loss of muscle mass. Cachexia is often accompanied by involuntary weight loss, loss of fat mass, anorexia, inflammation, insulin resistance, fatigue, weakness, significant loss of appetite, and/or increased muscle protein breakdown. Cachexia is distinct from starvation, age-related loss of muscle mass, malabsorption, and hyperthyroidism. Underlying diseases associated with cachexia include cancer, chronic heart failure, chronic kidney disease, COPD, AIDS, multiple sclerosis, rheumatoid arthritis, sepsis, and tuberculosis.

    [0049] As used herein, sarcopenia is understood to be a condition characterized primarily by loss of skeletal muscle mass and muscle strength. Sarcopenia is frequently associated with aging. See, Ruegg and Glass (2011) ANNUAL REV. PHARMACOL. TOXICOL. 51:373-395. In one approach, sarcopenia can be identified in a subject if a value of the appendicular skeletal muscle mass of a subject divided by the height of the subject in meters is more than two standard deviations below the young normal mean. (Thomas (2007) supra; see also Baumgartner et al. (1999) MECH. AGEING DEV. 147:755-763).

    [0050] As used herein, unless otherwise indicated, antibody means an intact antibody (e.g., an intact monoclonal antibody) or antigen-binding fragment of an antibody, including an intact antibody or antigen-binding fragment that has been modified or engineered, or that is a human antibody. Examples of antibodies that have been modified or engineered are chimeric antibodies, humanized antibodies, and multispecific antibodies (e.g., bispecific antibodies). Examples of antigen-binding fragments include Fab, Fab, F(ab).sub.2, Fv, single chain antibodies (e.g., scFv), minibodies and diabodies.

    I. Antibodies that Bind GDF15

    [0051] The antibodies disclosed herein comprise: (a) an immunoglobulin heavy chain variable region comprising the structure CDR.sub.H1-CDR.sub.H2-CDR.sub.H3 and (b) an immunoglobulin light chain variable region comprising the structure CDR.sub.L1-CDR.sub.L2-CDR.sub.L3, wherein the heavy chain variable region and the light chain variable region together define a single binding site for binding hGDF15 protein.

    [0052] In some embodiments, the antibody comprises: (a) an immunoglobulin heavy chain variable region comprising the structure CDR.sub.H1-CDR.sub.H2-CDR.sub.H3 and (b) an immunoglobulin light chain variable region, wherein the heavy chain variable region and the light chain variable region together define a single binding site for binding hGDF15. A CDR.sub.H1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:1 (01G06, 08G01, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L, Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S I69L, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2), SEQ ID NO:2 (03G05), SEQ ID NO:3 (04F08), SEQ ID NO:4 (06C11, Ch06C11 Chimeric, HE LM 06C11 IGHV2-70, Hu06C11 IGHV2-5), SEQ ID NO:5 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), and SEQ ID NO:6 (17B11); a CDR.sub.H2 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:7 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L, Sh01G06 IGHV1-69 T30S I69L), SEQ ID NO:8 (03G05), SEQ ID NO:9 (04F08, 06C11, Ch06C11 Chimeric, Hu06C11 IGHV2-5), SEQ ID NO: 10 (08G01), SEQ ID NO: 11 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), SEQ ID NO: 12 (17B11), SEQ ID NO: 13 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L), SEQ ID NO:236 (Hu01G06 IGHV1-18 F1), SEQ ID NO:237 (Hu01G06 IGHV1-18 F2), SEQ ID NO:238 (Hu01G06 IGHV1-69 F1), SEQ ID NO:239 (Hu01G06 IGHV1-69 F2), and SEQ ID NO: 14 (HE LM 06C11 IGHV2-70); and a CDR.sub.H3 comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 15 (01G06, 08G01, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L, Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S I69L, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2), SEQ ID NO:16 (03G05), SEQ ID NO:17 (04F08), SEQ ID NO: 18 (06C11, Ch06C11 Chimeric, HE LM 06C11 IGHV2-70, Hu06C11 IGHV2-5), SEQ ID NO: 19 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), and SEQ ID NO:20 (17B11). Throughout this specification, a particular SEQ ID NO. is followed in parentheses by the antibody that was the origin of that sequence. For example, SEQ ID NO:2 (03G05) means that SEQ ID NO:2 comes from antibody 03G05.

    [0053] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR.sub.H1 comprising the amino acid sequence of SEQ ID NO:1 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-69 T30S I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2), a CDR.sub.H2 comprising the amino acid sequence of SEQ ID NO:7 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-69 T30S I69L), and a CDR.sub.H3 comprising the amino acid sequence of SEQ ID NO:15 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-69 T30S I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2).

    [0054] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR.sub.H1 comprising the amino acid sequence of SEQ ID NO:2 (03G05), a CDR.sub.H2 comprising the amino acid sequence of SEQ ID NO:8 (03G05), and a CDR.sub.H3 comprising the amino acid sequence of SEQ ID NO:16 (03G05).

    [0055] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR.sub.H1 comprising the amino acid sequence of SEQ ID NO:3 (04F08), a CDR.sub.H2 comprising the amino acid sequence of SEQ ID NO:9 (04F08), and a CDR.sub.H3 comprising the amino acid sequence of SEQ ID NO:17 (04F08).

    [0056] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR.sub.H1 comprising the amino acid sequence of SEQ ID NO:4 (06C11, Ch06C11 Chimeric, Hu06C11 IGHV2-5), a CDR.sub.H2 comprising the amino acid sequence of SEQ ID NO:9 (06C11, Ch06C11 Chimeric, Hu06C11 IGHV2-5), and a CDR.sub.H3 comprising the amino acid sequence of SEQ ID NO:18 (06C11, Ch06C11 Chimeric, Hu06C11 IGHV2-5).

    [0057] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR.sub.H1 comprising the amino acid sequence of SEQ ID NO:1 (08G01), a CDR.sub.H2 comprising the amino acid sequence of SEQ ID NO: 10 (08G01), and a CDR.sub.H3 comprising the amino acid sequence of SEQ ID NO:15 (08G01).

    [0058] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR.sub.H1 comprising the amino acid sequence of SEQ ID NO:5 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), a CDR.sub.H2 comprising the amino acid sequence of SEQ ID NO: 11 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), and a CDR.sub.H3 comprising the amino acid sequence of SEQ ID NO: 19 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70).

    [0059] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR.sub.H1 comprising the amino acid sequence of SEQ ID NO:6 (17B11), a CDR.sub.H2 comprising the amino acid sequence of SEQ ID NO: 12 (17B11), and a CDR.sub.H3 comprising the amino acid sequence of SEQ ID NO:20 (17B11).

    [0060] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR.sub.H1 comprising the amino acid sequence of SEQ ID NO:1 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2), a CDR.sub.H2 comprising the amino acid sequence of SEQ ID NO: 13 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L), and a CDR.sub.H3 comprising the amino acid sequence of SEQ ID NO: 15 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2).

    [0061] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR.sub.H1 comprising the amino acid sequence of SEQ ID NO:1 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2), a CDR.sub.H2 comprising the amino acid sequence of SEQ ID NO:236 (Hu01G06 IGHV1-18 F1), and a CDR.sub.H3 comprising the amino acid sequence of SEQ ID NO: 15 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2).

    [0062] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR.sub.H1 comprising the amino acid sequence of SEQ ID NO:1 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2), a CDR.sub.H2 comprising the amino acid sequence of SEQ ID NO:237 (Hu01G06 IGHV1-18 F2), and a CDR.sub.H3 comprising the amino acid sequence of SEQ ID NO: 15 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2).

    [0063] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR.sub.H1 comprising the amino acid sequence of SEQ ID NO:1 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2), a CDR.sub.H2 comprising the amino acid sequence of SEQ ID NO:238 (Hu01G06 IGHV1-69 F1), and a CDR.sub.H3 comprising the amino acid sequence of SEQ ID NO: 15 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2).

    [0064] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR.sub.H1 comprising the amino acid sequence of SEQ ID NO:1 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2), a CDR.sub.H2 comprising the amino acid sequence of SEQ ID NO:239 (Hu01G06 IGHV1-69 F2), and a CDR.sub.H3 comprising the amino acid sequence of SEQ ID NO: 15 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2).

    [0065] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR.sub.H1 comprising the amino acid sequence of SEQ ID NO:4 (HE LM 06C11 IGHV2-70), a CDR.sub.H2 comprising the amino acid sequence of SEQ ID NO: 14 (HE LM 06C11 IGHV2-70), and a CDR.sub.H3 comprising the amino acid sequence of SEQ ID NO:18 (HE LM 06C11 IGHV2-70).

    [0066] Preferably, the CDR.sub.H1, CDR.sub.H2, and CDR.sub.H3 sequences are interposed between fully human or humanized immunoglobulin FR sequences.

    [0067] In some embodiments, the antibody comprises (a) an immunoglobulin light chain variable region comprising the structure CDR.sub.L1-CDR.sub.L2-CDR.sub.L3, and (b) an immunoglobulin heavy chain variable region, wherein the immunoglobulin light chain variable region and the immunoglobulin heavy chain variable region together define a single binding site for binding hGDF15. A CDR.sub.L1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:21 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, Hu01G06 IGKV1-39 F1, Hu01G06 IGKV1-39 F2), SEQ ID NO:22 (03G05), SEQ ID NO:23 (04F08, 06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16, 14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), SEQ ID NO:24 (08G01), and SEQ ID NO:25 (17B11); a CDR.sub.L2 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:26 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, Hu01G06 IGKV1-39 F1, Hu01G06 IGKV1-39 F2), SEQ ID NO:27 (03G05), SEQ ID NO:28 (04F08, 06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16), SEQ ID NO:29 (08G01), SEQ ID NO:30 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), and SEQ ID NO:31 (17B11); and a CDR.sub.L3 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:32 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, 08G01, Hu01G06 IGKV1-39 F1), SEQ ID NO:244 (Hu01G06 IGKV1-39 F2), SEQ ID NO:33 (03G05), SEQ ID NO:34 (04F08), SEQ ID NO:35 (06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16), SEQ ID NO:36 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), and SEQ ID NO:37 (17B11).

    [0068] In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR.sub.L1 comprising the amino acid sequence of SEQ ID NO:21 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, Hu01G06 IGKV1-39 F1, Hu01G06 IGKV1-39 F2), a CDR.sub.L2 comprising the amino acid sequence of SEQ ID NO:26 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, Hu01G06 IGKV1-39 F1, Hu01G06 IGKV1-39 F2), and a CDR.sub.L3 comprising the amino acid sequence of SEQ ID NO:32 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, Hu01G06 IGKV1-39 F1).

    [0069] In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR.sub.L1 comprising the amino acid sequence of SEQ ID NO:21 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, Hu01G06 IGKV1-39 F1, Hu01G06 IGKV1-39 F2), a CDR.sub.L2 comprising the amino acid sequence of SEQ ID NO:26 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, Hu01G06 IGKV1-39 F1, Hu01G06 IGKV1-39 F2), and a CDR.sub.L3 comprising the amino acid sequence of SEQ ID NO:244 (Hu01G06 IGKV1-39 F2).

    [0070] In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR.sub.L1 comprising the amino acid sequence of SEQ ID NO:22 (03G05), a CDR.sub.L2 comprising the amino acid sequence of SEQ ID NO:27 (03G05), and a CDR.sub.L3 comprising the amino acid sequence of SEQ ID NO:33 (03G05).

    [0071] In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR.sub.L1 comprising the amino acid sequence of SEQ ID NO:23 (04F08), a CDR.sub.L2 comprising the amino acid sequence of SEQ ID NO:28 (04F08), and a CDR.sub.L3 comprising the amino acid sequence of SEQ ID NO:34 (04F08).

    [0072] In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR.sub.L1 comprising the amino acid sequence of SEQ ID NO:23 (06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16), a CDR.sub.L2 comprising the amino acid sequence of SEQ ID NO:28 (06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16), and a CDR.sub.L3 comprising the amino acid sequence of SEQ ID NO:35 (06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16).

    [0073] In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR.sub.L1 comprising the amino acid sequence of SEQ ID NO:24 (08G01), a CDR.sub.L2 comprising the amino acid sequence of SEQ ID NO:29 (08G01), and a CDR.sub.L3 comprising the amino acid sequence of SEQ ID NO:32 (08G01).

    [0074] In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR.sub.L1 comprising the amino acid sequence of SEQ ID NO:23 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), a CDR.sub.L2 comprising the amino acid sequence of SEQ ID NO:30 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), and a CDR.sub.L3 comprising the amino acid sequence of SEQ ID NO:36 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16).

    [0075] In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR.sub.L1 comprising the amino acid sequence of SEQ ID NO:25 (17B11), a CDR.sub.L2 comprising the amino acid sequence of SEQ ID NO:31 (17B11), and a CDR.sub.L3 comprising the amino acid sequence of SEQ ID NO:37 (17B11).

    [0076] Preferably, the CDR.sub.L1, CDR.sub.L2, and CDR.sub.L3 sequences are interposed between fully human or humanized immunoglobulin FR sequences.

    [0077] In some embodiments, the antibody comprises: (a) an immunoglobulin heavy chain variable region comprising the structure CDR.sub.H1-CDR.sub.H2-CDR.sub.H3 and (b) an immunoglobulin light chain variable region comprising the structure CDR.sub.L1-CDR.sub.L2-CDR.sub.L3, wherein the heavy chain variable region and the light chain variable region together define a single binding site for binding hGDF15. The CDR.sub.H1 is an amino acid sequence selected from the group consisting of SEQ ID NO:1 (01G06, 08G01, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L, Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S I69L, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2), SEQ ID NO:2 (03G05), SEQ ID NO:3 (04F08), SEQ ID NO:4 (06C11, Ch06C11 Chimeric, HE LM 06C11 IGHV2-70, Hu06C11 IGHV2-5), SEQ ID NO:5 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), and SEQ ID NO:6 (17B11); the CDR.sub.H2 is an amino acid sequence selected from the group consisting of SEQ ID NO:7 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L, Sh01G06 IGHV1-69 T30S I69L), SEQ ID NO:8 (03G05), SEQ ID NO:9 (04F08, 06C11, Ch06C11 Chimeric, Hu06C11 IGHV2-5), SEQ ID NO:10 (08G01), SEQ ID NO:11 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), SEQ ID NO: 12 (17B11), SEQ ID NO: 13 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q 169L), SEQ ID NO:236 (Hu01G06 IGHV1-18 F1), SEQ ID NO:237 (Hu01G06 IGHV1-18 F2), SEQ ID NO:238 (Hu01G06 IGHV1-69 F1), SEQ ID NO:239 (Hu01G06 IGHV1-69 F2), and SEQ ID NO: 14 (HE LM 06C11 IGHV2-70); and the CDR.sub.H3 is an amino acid sequence selected from the group consisting of SEQ ID NO: 15 (01G06, 08G01, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L, Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S I69L, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2), SEQ ID NO:16 (03G05), SEQ ID NO:17 (04F08), SEQ ID NO: 18 (06C11, Ch06C11 Chimeric, HE LM 06C11 IGHV2-70, Hu06C11 IGHV2-5), SEQ ID NO: 19 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), and SEQ ID NO:20 (17B11). The CDR.sub.L1 is an amino acid sequence selected from the group consisting of SEQ ID NO:21 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, Hu01G06 IGKV1-39 F1, Hu01G06 IGKV1-39 F2), SEQ ID NO:22 (03G05), SEQ ID NO:23 (04F08, 06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16, 14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), SEQ ID NO:24 (08G01), and SEQ ID NO:25 (17B11); the CDR.sub.L2 is an amino acid sequence selected from the group consisting of SEQ ID NO:26 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, Hu01G06 IGKV1-39 F1, Hu01G06 IGKV1-39 F2), SEQ ID NO:27 (03G05), SEQ ID NO:28 (04F08, 06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16), SEQ ID NO:29 (08G01), SEQ ID NO:30 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), and SEQ ID NO:31 (17B11); and the CDR.sub.L3 is an amino acid sequence selected from the group consisting of SEQ ID NO:32 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, 08G01, Hu01G06 IGKV1-39 F1), SEQ ID NO:244 (Hu01G06 IGKV1-39 F2), SEQ ID NO:33 (03G05), SEQ ID NO:34 (04F08), SEQ ID NO:35 (06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16), SEQ ID NO:36 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), and SEQ ID NO:37 (17B11).

    [0078] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR.sub.H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:38 (Hu01G06 IGHV1-18 F1), a CDR.sub.H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:236 and SEQ ID NO:240 (Hu01G06 IGHV1-18 F1), and a CDR.sub.H3 comprising the amino acid sequence of SEQ ID NO:15 (Hu01G06 IGHV1-18 F1); and an immunoglobulin light chain variable region comprising a CDR.sub.L1 comprising the amino acid sequence of SEQ ID NO:21 (Hu01G06 IGKV1-39 F1), a CDR.sub.L2 comprising the amino acid sequence of SEQ ID NO:26 (Hu01G06 IGKV1-39 F1), and a CDR.sub.L3 comprising the amino acid sequence of SEQ ID NO:32 (Hu01G06 IGKV1-39 F1).

    [0079] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR.sub.H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:38 (Hu01G06 IGHV1-18 F2), a CDR.sub.H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:237 and SEQ ID NO:241 (Hu01G06 IGHV1-18 F2), and a CDR.sub.H3 comprising the amino acid sequence of SEQ ID NO:15 (Hu01G06 IGHV1-18 F2); and an immunoglobulin light chain variable region comprising a CDR.sub.L1 comprising the amino acid sequence of SEQ ID NO:21 (Hu01G06 IGKV1-39 F2), a CDR.sub.L2 comprising the amino acid sequence of SEQ ID NO:26 (Hu01G06 IGKV1-39 F2), and a CDR.sub.L3 comprising the amino acid sequence of SEQ ID NO:244 (Hu01G06 IGKV1-39 F2).

    [0080] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR.sub.H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:234 (Hu01G06 IGHV1-69 F1), a CDR.sub.H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:238 and SEQ ID NO:241 (Hu01G06 IGHV1-69 F1), and a CDR.sub.H3 comprising the amino acid sequence of SEQ ID NO:15 (Hu01G06 IGHV1-69 F1); and an immunoglobulin light chain variable region comprising a CDR.sub.L1 comprising the amino acid sequence of SEQ ID NO:21 (Hu01G06 IGKV1-39 F1), a CDR.sub.L2 comprising the amino acid sequence of SEQ ID NO:26 (Hu01G06 IGKV1-39 F1), and a CDR.sub.L3 comprising the amino acid sequence of SEQ ID NO:32 (Hu01G06 IGKV1-39 F1).

    [0081] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR.sub.H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:234 (Hu01G06 IGHV1-69 F2), a CDR.sub.H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:239 and SEQ ID NO:240 (Hu01G06 IGHV1-69 F2), and a CDR.sub.H3 comprising the amino acid sequence of SEQ ID NO:15 (Hu01G06 IGHV1-69 F2); and an immunoglobulin light chain variable region comprising a CDR.sub.L1 comprising the amino acid sequence of SEQ ID NO:21 (Hu01G06 IGKV1-39 F1), a CDR.sub.L2 comprising the amino acid sequence of SEQ ID NO:26 (Hu01G06 IGKV1-39 F1), and a CDR.sub.L3 comprising the amino acid sequence of SEQ ID NO:32 (Hu01G06 IGKV1-39 F1).

    [0082] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR.sub.H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:234 (Hu01G06 IGHV1-69 F2), a CDR.sub.H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:239 and SEQ ID NO:240 (Hu01G06 IGHV1-69 F2), and a CDR.sub.H3 comprising the amino acid sequence of SEQ ID NO:15 (Hu01G06 IGHV1-69 F2); and an immunoglobulin light chain variable region comprising a CDR.sub.L1 comprising the amino acid sequence of SEQ ID NO:21 (Hu01G06 IGKV1-39 F2), a CDR.sub.L2 comprising the amino acid sequence of SEQ ID NO:26 (Hu01G06 IGKV1-39 F2), and a CDR.sub.L3 comprising the amino acid sequence of SEQ ID NO:244 (Hu01G06 IGKV1-39 F2).

    [0083] The antibodies disclosed herein comprise an immunoglobulin heavy chain variable region and an immunoglobulin light chain variable region. In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region selected from the group consisting of SEQ ID NO:40 (01G06, Ch01G06 Chimeric), SEQ ID NO:42 (03G05), SEQ ID NO:44 (04F08), SEQ ID NO:46 (06C11, Ch06C11 Chimeric), SEQ ID NO:48 (08G01), SEQ ID NO:50 (14F11, Ch14F11 Chimeric), SEQ ID NO:52 (17B11), SEQ ID NO:54 (Hu01G06 IGHV1-18), SEQ ID NO:56 (Hu01G06 IGHV1-69), SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), SEQ ID NO:246 (Hu01G06 IGHV1-18 F1), SEQ ID NO:248 (Hu01G06 IGHV1-18 F2), SEQ ID NO:250 (Hu01G06 IGHV1-69 F1), SEQ ID NO:252 (Hu01G06 IGHV1-69 F2), SEQ ID NO:68 (HE LM 06C11 IGHV2-70), SEQ ID NO:70 (Hu06C11 IGHV2-5), SEQ ID NO:72 (Sh14F11 IGHV2-5), and SEQ ID NO:74 (Sh14F11 IGHV2-70); and an immunoglobulin light chain variable region.

    [0084] In other embodiments, the antibody comprises an immunoglobulin light chain variable region selected from the group consisting of SEQ ID NO:76 (01G06, Ch01G06 Chimeric), SEQ ID NO:78 (03G05), SEQ ID NO:80 (04F08), SEQ ID NO:82 (06C11, Ch06C11 Chimeric), SEQ ID NO:84 (08G01), SEQ ID NO:86 (14F11, Ch14F11 Chimeric), SEQ ID NO:88 (17B11), SEQ ID NO:90 (Hu01G06 IGKV1-39), SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I or Hu01G06 IGKV1-39 F1), SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I), SEQ ID NO:96 (Sh06C11 IGKV1-16), SEQ ID NO:254 (Hu01G06 IGKV1-39 F2), and SEQ ID NO:98 (Hu14F11 IGKV1-16), and an immunoglobulin heavy chain variable region.

    [0085] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region selected from the group consisting of SEQ ID NO:40 (01G06, Ch01G06 Chimeric), SEQ ID NO:42 (03G05), SEQ ID NO:44 (04F08), SEQ ID NO:46 (06C11, Ch06C11 Chimeric), SEQ ID NO:48 (08G01), SEQ ID NO:50 (14F11, Ch14F11 Chimeric), SEQ ID NO:52 (17B11), SEQ ID NO:54 (Hu01G06 IGHV1-18), SEQ ID NO:56 (Hu01G06 IGHV1-69), SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), SEQ ID NO:246 (Hu01G06 IGHV1-18 F1), SEQ ID NO:248 (Hu01G06 IGHV1-18 F2), SEQ ID NO:250 (Hu01G06 IGHV1-69 F1), SEQ ID NO:252 (Hu01G06 IGHV1-69 F2), SEQ ID NO:68 (HE LM 06C11 IGHV2-70), SEQ ID NO:70 (Hu06C11 IGHV2-5), SEQ ID NO:72 (Sh14F11 IGHV2-5), and SEQ ID NO:74 (Sh14F11 IGHV2-70), and an immunoglobulin light chain variable region selected from the group consisting of SEQ ID NO:76 (01G06, Ch01G06 Chimeric), SEQ ID NO:78 (03G05), SEQ ID NO:80 (04F08), SEQ ID NO:82 (06C11, Ch06C11 Chimeric), SEQ ID NO:84 (08G01), SEQ ID NO:86 (14F11, Ch14F11 Chimeric), SEQ ID NO:88 (17B11), SEQ ID NO:90 (Hu01G06 IGKV1-39), SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I or Hu01G06 IGKV1-39 F1), SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I), SEQ ID NO:96 (Sh06C11 IGKV1-16), SEQ ID NO:254 (Hu01G06 IGKV1-39 F2), and SEQ ID NO:98 (Hu14F11 IGKV1-16).

    [0086] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (01G06, Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (01G06, Ch01G06 Chimeric).

    [0087] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:42 (03G05), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:78 (03G05).

    [0088] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:44 (04F08), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:80 (04F08).

    [0089] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:46 (06C11), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:82 (06C11).

    [0090] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:48 (08G01), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:84 (08G01).

    [0091] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:50 (14F11), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:86 (14F11).

    [0092] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:52 (17B11), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:88 (17B11).

    [0093] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric).

    [0094] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric).

    [0095] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric).

    [0096] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric).

    [0097] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric).

    [0098] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric).

    [0099] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric).

    [0100] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39).

    [0101] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39).

    [0102] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39).

    [0103] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39).

    [0104] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39).

    [0105] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39).

    [0106] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39).

    [0107] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39).

    [0108] In some embodiments, the antibody comprises an immuoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I).

    [0109] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I).

    [0110] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I).

    [0111] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I).

    [0112] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I).

    [0113] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I).

    [0114] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I).

    [0115] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I).

    [0116] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I).

    [0117] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I).

    [0118] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I).

    [0119] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I).

    [0120] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I).

    [0121] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I).

    [0122] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I).

    [0123] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q 169L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I).

    [0124] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:246 (Hu01G06 IGHV1-18 F1), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 F1).

    [0125] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:248 (Hu01G06 IGHV1-18 F2), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:254 (Hu01G06 IGKV1-39 F2).

    [0126] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:250 (Hu01G06 IGHV1-69 F1), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 F1).

    [0127] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:252 (Hu01G06 IGHV1-69 F2), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 F1).

    [0128] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:252 (Hu01G06 IGHV1-69 F2), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:254 (Hu01G06 IGKV1-39 F2).

    [0129] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:68 (HE LM 06C11 IGHV2-70), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:82 (Ch06C11 Chimeric).

    [0130] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:70 (Hu06C11 IGHV2-5), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:82 (Ch06C11 Chimeric).

    [0131] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:46 (Ch06C11 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:96 (Sh06C11 IGKV1-16).

    [0132] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:68 (HE LM 06C11 IGHV2-70), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:96 (Sh06C11 IGKV1-16).

    [0133] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:70 (Hu06C11 IGHV2-5), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:96 (Sh06C11 IGKV1-16).

    [0134] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:72 (Sh14F11 IGHV2-5), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:86 (Ch14F11 Chimeric).

    [0135] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:74 (Sh14F11 IGHV2-70), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:86 (Ch14F11 Chimeric).

    [0136] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:50 (Ch14F11 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:98 (Hu14F11 IGKV1-16).

    [0137] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:72 (Sh14F11 IGHV2-5), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:98 (Hu14F11 IGKV1-16).

    [0138] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:74 (Sh14F11 IGHV2-70), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:98 (Hu14F11 IGKV1-16).

    [0139] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:46 (Ch06C11 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:80 (04F08).

    [0140] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:50 (Ch14F11 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:80 (04F08).

    [0141] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:44 (04F08), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:82 (Ch06C11 Chimeric).

    [0142] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:50 (Ch14F11 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:82 (Ch06C11 Chimeric).

    [0143] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:44 (04F08), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:86 (Ch14F11 Chimeric).

    [0144] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:46 (Ch06C11 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:86 (Ch14F11 Chimeric).

    [0145] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:48 (08G01), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric).

    [0146] In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:84 (08G01).

    [0147] In certain embodiments, the antibodies disclosed herein comprise an immunoglobulin heavy chain and an immunoglobulin light chain. In some embodiments, the antibody comprises an immunoglobulin heavy chain selected from the group consisting of SEQ ID NO:100 (01G06), SEQ ID NO:104 (03G05), SEQ ID NO:108 (04F08), SEQ ID NO:112 (06C11), SEQ ID NO:116 (08G01), SEQ ID NO:120 (14F11), SEQ ID NO:124 (17B11), SEQ ID NO:176 (Ch01G06 Chimeric), SEQ ID NO:178 (Hu01G06 IGHV1-18), SEQ ID NO:180 (Hu01G06 IGHV1-69), SEQ ID NO:182 (Sh01G06 IGHV1-18 M69L), SEQ ID NO:184 (Sh01G06 IGHV1-18 M69L K64Q G44S), SEQ ID NO:186 (Sh01G06 IGHV1-18 M69L K64Q), SEQ ID NO:188 (Sh01G06 IGHV1-69 T30S I69L), SEQ ID NO:190 (Sh01G06 IGHV1-69 T30S K64Q I69L), SEQ ID NO:256 (Hu01G06 IGHV1-18 F1), SEQ ID NO:258 (Hu01G06 IGHV1-18 F2), SEQ ID NO:260 (Hu01G06 IGHV1-69 F1), SEQ ID NO:262 (Hu01G06 IGHV1-69 F2), SEQ ID NO:192 (Ch06C11 Chimeric), SEQ ID NO:194 (HE LM 06C11 IGHV2-70), SEQ ID NO:196 (Hu06C11 IGHV2-5), SEQ ID NO:198 (Ch14F11 Chimeric), SEQ ID NO:200 (Sh14F11 IGHV2-5), and SEQ ID NO:202 (Sh14F11 IGHV2-70); and an immunoglobulin light chain.

    [0148] In other embodiments, the antibody comprises an immunoglobulin light chain selected from the group consisting of SEQ ID NO: 102 (01G06), SEQ ID NO:106 (03G05), SEQ ID NO:110 (04F08), SEQ ID NO:114 (06C11), SEQ ID NO:118 (08G01), SEQ ID NO:122 (14F11), SEQ ID NO:126 (17B11), SEQ ID NO:204 (Ch01G06 Chimeric), SEQ ID NO:206 (Hu01G06 IGKV1-39), SEQ ID NO:208 (Hu01G06 IGKV1-39 S43A V48I or Hu01G06 IGKV1-39 F1), SEQ ID NO:210 (Hu01G06 IGKV1-39 V48I), SEQ ID NO:264 (Hu01G06 IGKV1-39 F2), SEQ ID NO:212 (Ch06C11 Chimeric), SEQ ID NO:214 (Sh06C11 IGKV1-16), SEQ ID NO:216 (Ch14F11 Chimeric), and SEQ ID NO:218 (Hu14F11 IGKV1-16), and an immunoglobulin heavy chain.

    [0149] In some embodiments, the antibody comprises (i) an immunoglobulin heavy chain selected from the group consisting of SEQ ID NO: 100 (01G06), SEQ ID NO: 104 (03G05), SEQ ID NO: 108 (04F08), SEQ ID NO: 112 (06C11), SEQ ID NO: 116 (08G01), SEQ ID NO: 120 (14F11), SEQ ID NO: 124 (17B11), SEQ ID NO: 176 (Ch01G06 Chimeric), SEQ ID NO:178 (Hu01G06 IGHV1-18), SEQ ID NO:180 (Hu01G06 IGHV1-69), SEQ ID NO:182 (Sh01G06 IGHV1-18 M69L), SEQ ID NO: 184 (Sh01G06 IGHV1-18 M69L K64Q G44S), SEQ ID NO: 186 (Sh01G06 IGHV1-18 M69L K64Q), SEQ ID NO: 188 (Sh01G06 IGHV1-69 T30S I69L), SEQ ID NO: 190 (Sh01G06 IGHV1-69 T30S K64Q I69L), SEQ ID NO:256 (Hu01G06 IGHV1-18 F1), SEQ ID NO:258 (Hu01G06 IGHV1-18 F2), SEQ ID NO:260 (Hu01G06 IGHV1-69 F1), SEQ ID NO:262 (Hu01G06 IGHV1-69 F2), SEQ ID NO: 192 (Ch06C11 Chimeric), SEQ ID NO: 194 (HE LM 06C11 IGHV2-70), SEQ ID NO: 196 (Hu06C11 IGHV2-5), SEQ ID NO:198 (Ch14F11 Chimeric), SEQ ID NO:200 (Sh14F11 IGHV2-5), and SEQ ID NO:202 (Sh14F11 IGHV2-70), and (ii) an immunoglobulin light chain selected from the group consisting of SEQ ID NO: 102 (01G06), SEQ ID NO: 106 (03G05), SEQ ID NO:110 (04F08), SEQ ID NO:114 (06C11), SEQ ID NO:118 (08G01), SEQ ID NO: 122 (14F11), SEQ ID NO: 126 (17B11), SEQ ID NO:204 (Ch01G06 Chimeric), SEQ ID NO:206 (Hu01G06 IGKV1-39), SEQ ID NO:208 (Hu01G06 IGKV1-39 S43A V48I or Hu01G06 IGKV1-39 F1), SEQ ID NO:210 (Hu01G06 IGKV1-39 V48I), SEQ ID NO:264 (Hu01G06 IGKV1-39 F2), SEQ ID NO:212 (Ch06C11 Chimeric), SEQ ID NO:214 (Sh06C11 IGKV1-16), SEQ ID NO:216 (Ch14F11 Chimeric), and SEQ ID NO:218 (Hu14F11 IGKV1-16).

    [0150] In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO: 176 (Ch01G06 Chimeric), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:204 (Ch01G06 Chimeric).

    [0151] In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO: 192 (Ch06C11 Chimeric), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:212 (Ch06C11 Chimeric).

    [0152] In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:198 (Ch14F11 Chimeric), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:216 (Ch14F11 Chimeric).

    [0153] In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:178 (Hu01G06 IGHV1-18), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:206 (Hu01G06 IGKV1-39).

    [0154] In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:180 (Hu01G06 IGHV1-69), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:206 (Hu01G06 IGKV1-39).

    [0155] In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:184 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:210 (Hu01G06 IGKV1-39 V48I).

    [0156] In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:188 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:210 (Hu01G06 IGKV1-39 V48I).

    [0157] In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:184 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 S43A V48I).

    [0158] In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:188 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 S43A V48I).

    [0159] In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:256 (Hu01G06 IGHV1-18 F1), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 F1).

    [0160] In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:258 (Hu01G06 IGHV1-18 F2), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:264 (Hu01G06 IGKV1-39 F2).

    [0161] In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:260 (Hu01G06 IGHV1-69 F1), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 F1).

    [0162] In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:262 (Hu01G06 IGHV1-69 F2), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 F1).

    [0163] In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:262 (Hu01G06 IGHV1-69 F2), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:264 (Hu01G06 IGKV1-39 F2).

    [0164] In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:194 (HE LM 06C11 IGHV2-70), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:214 (Sh06C11 IGKV1-16).

    [0165] In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:196 (Hu06C11 IGHV2-5), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:214 (Sh06C11 IGKV1-16).

    [0166] In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:200 (Sh14F11 IGHV2-5), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:218 (Hu14F11 IGKV1-16)

    [0167] In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:202 (Sh14F11 IGHV2-70), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:218 (Hu14F11 IGKV1-16).

    [0168] In certain embodiments, an isolated antibody that binds hGDF15 comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the entire variable region or the FR sequence of SEQ ID NO:40 (01G06, Ch01G06 Chimeric), SEQ ID NO:42 (03G05), SEQ ID NO:44 (04F08), SEQ ID NO:46 (06C11, Ch06C11 Chimeric), SEQ ID NO:48 (08G01), SEQ ID NO:50 (14F11, Ch14F11 Chimeric), SEQ ID NO:52 (17B11), SEQ ID NO:54 (Hu01G06 IGHV1-18), SEQ ID NO:56 (Hu01G06 IGHV1-69), SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), SEQ ID NO:246 (Hu01G06 IGHV1-18 F1), SEQ ID NO:248 (Hu01G06 IGHV1-18 F2), SEQ ID NO:250 (Hu01G06 IGHV1-69 F1), SEQ ID NO:252 (Hu01G06 IGHV1-69 F2), SEQ ID NO:68 (HE LM 06C11 IGHV2-70), SEQ ID NO:70 (Hu06C11 IGHV2-5), SEQ ID NO:72 (Sh14F11 IGHV2-5), and SEQ ID NO:74 (Sh14F11 IGHV2-70).

    [0169] In certain embodiments, an isolated antibody that binds hGDF15 comprises an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the entire variable region or the FR sequence of SEQ ID NO:76 (01G06, Ch01G06 Chimeric), SEQ ID NO:78 (03G05), SEQ ID NO:80 (04F08), SEQ ID NO:82 (06C11, Ch06C11 Chimeric), SEQ ID NO:84 (08G01), SEQ ID NO:86 (14F11, Ch14F11 Chimeric), SEQ ID NO:88 (17B11), SEQ ID NO:90 (Hu01G06 IGKV1-39), SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I or Hu01G06 IGKV1-39 F1), SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I), SEQ ID NO:254 (Hu01G06 IGKV1-39 F2), SEQ ID NO:96 (Sh06C11 IGKV1-16), and SEQ ID NO:98 (Hu14F11 IGKV1-16).

    [0170] Sequence identity may be determined in various ways that are within the skill of a person skilled in the art, e.g., using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. BLAST (Basic Local Alignment Search Tool) analysis using the algorithm employed by the programs blastp, blastn, blastx, tblastn and tblastx (Karlin et al., (1990) PROC. NATL. ACAD. SCI. USA 87:2264-2268; Altschul, (1993) J. MOL. EVOL. 36:290-300; Altschul et al., (1997) NUCLEIC ACIDS RES. 25:3389-3402, incorporated by reference herein) are tailored for sequence similarity searching. For a discussion of basic issues in searching sequence databases see Altschul et al., (1994) NATURE GENETICS 6:119-129, which is fully incorporated by reference herein. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. The search parameters for histogram, descriptions, alignments, expect (i.e., the statistical significance threshold for reporting matches against database sequences), cutoff, matrix and filter are at the default settings. The default scoring matrix used by blastp, blastx, tblastn, and tblastx is the BLOSUM62 matrix (Henikoff et al., (1992) PROC. NATL. ACAD. SCI. USA 89:10915-10919, fully incorporated by reference herein). Four blastn parameters may be adjusted as follows: Q=10 (gap creation penalty); R=10 (gap extension penalty); wink=1 (generates word hits at every wink.sup.th position along the query); and gapw=16 (sets the window width within which gapped alignments are generated). The equivalent Blastp parameter settings may be Q=9; R=2; wink=1; and gapw=32. Searches may also be conducted using the NCBI (National Center for Biotechnology Information) BLAST Advanced Option parameter (e.g.: -G, Cost to open gap [Integer]: default=5 for nucleotides/11 for proteins; -E, Cost to extend gap [Integer]: default=2 for nucleotides/1 for proteins; -q, Penalty for nucleotide mismatch [Integer]: default=?3; -r, reward for nucleotide match [Integer]: default=1; -e, expect value [Real]: default=10; W, wordsize [Integer]: default=11 for nucleotides/28 for megablast/3 for proteins; -y, Dropoff (X) for blast extensions in bits: default=20 for blastn/7 for others; -X, X dropoff value for gapped alignment (in bits): default=15 for all programs, not applicable to blastn; and Z, final X dropoff value for gapped alignment (in bits): 50 for blastn, 25 for others). ClustalW for pairwise protein alignments may also be used (default parameters may include, e.g., Blosum62 matrix and Gap Opening Penalty=10 and Gap Extension Penalty=0.1). A Bestfit comparison between sequences, available in the GCG package version 10.0, uses DNA parameters GAP=50 (gap creation penalty) and LEN=3 (gap extension penalty). The equivalent settings in Bestfit protein comparisons are GAP=8 and LEN=2.

    [0171] In each of the foregoing embodiments, it is contemplated herein that immunoglobulin heavy chain variable region sequences and/or light chain variable region sequences that together bind human GDF15 may contain amino acid alterations (e.g., at least 1, 2, 3, 4, 5, or 10 amino acid substitutions, deletions, or additions) in the framework regions of the heavy and/or light chain variable regions.

    [0172] In some embodiments, the antibody binds hGDF15 with a K.sub.D of about 300 pM, 250 pM, 200 pM, 190 pM, 180 pM, 170 pM, 160 pM, 150 pM, 140 pM, 130 pM, 120 pM, 110 pM, 100 pM, 90 pM, 80 pM, 70 pM, 60 pM, 50 pM, 40 pM, 30 pM, 20 pM, or 10 pM, or lower. Unless otherwise specified, K.sub.D values are determined by surface plasmon resonance methods or biolayer interferometry under the conditions described in Examples 8, 14, and 15.

    [0173] In some embodiments, a monoclonal antibody binds to the same epitope on hGDF15 (e.g., mature hGDF15 or cleaved rhGDF15) bound by one or more of the antibodies disclosed herein (e.g., antibodies 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11). In some embodiments, a monoclonal antibody competes for binding to hGDF15 with one or more of the antibodies disclosed herein (e.g., antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11).

    [0174] Competition assays for determining whether an antibody binds to the same epitope as, or competes for binding with, an anti-GDF15 antibody disclosed herein are known in the art. Exemplary competition assays include immunoassays (e.g., ELISA assays, RIA assays), surface plasmon resonance analysis (e.g., using a BIAcore? instrument), biolayer interferometry and flow cytometry.

    [0175] Typically, a competition assay involves the use of an antigen (e.g., a hGDF15 protein or fragment thereof) bound to a solid surface or expressed on a cell surface, a test anti-GDF15-binding antibody and a reference antibody (e.g., antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11). The reference antibody is labeled and the test antibody is unlabeled. Competitive inhibition is measured by determining the amount of labeled reference antibody bound to the solid surface or cells in the presence of the test antibody. Usually the test antibody is present in excess (e.g., 1?, 5?, 10?, 20? or 100?). Antibodies identified by competition assay (i.e., competing antibodies) include antibodies binding to the same epitope, or similar (e.g., overlapping) epitopes, as the reference antibody, and antibodies binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference antibody for steric hindrance to occur.

    [0176] In an exemplary competition assay, a reference anti-GDF15 antibody (e.g., antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11) is biotinylated using commercially available reagents. The biotinylated reference antibody is mixed with serial dilutions of the test antibody or unlabeled reference antibody (self-competition control) resulting in a mixture of various molar ratios (e.g., 1?, 5?, 10?, 20? or 100?) of test antibody (or unlabeled reference antibody) to labeled reference antibody. The antibody mixture is added to a hGDF15 polypeptide coated-ELISA plate. The plate is then washed, and horseradish peroxidase (HRP)-strepavidin is added to the plate as the detection reagent. The amount of labeled reference antibody bound to the target antigen is detected following addition of a chromogenic substrate (e.g., TMB (3,3,5,5-tetramethylbenzidine) or ABTS (2,2-azino-di-(3-ethylbenzthiazoline-6-sulfonate)), which are known in the art. Optical density readings (OD units) are measured using a SpectraMax? M2 spectrometer (Molecular Devices). OD units corresponding to zero percent inhibition are determined from wells without any competing antibody. OD units corresponding to 100% inhibition, i.e., the assay background are determined from wells without any labeled reference antibody or test antibody. Percent inhibition of labeled reference antibody to GDF15 by the test antibody (or the unlabeled reference antibody) at each concentration is calculated as follows: % inhibition=(1?(OD units?100% inhibition)/(0% inhibition?100% inhibition))*100. Persons skilled in the art will appreciate that the competition assay can be performed using various detection systems known in the art.

    [0177] A competition assay may be conducted in both directions to ensure that the presence of the label does not interfere or otherwise inhibit binding. For example, in the first direction the reference antibody is labeled and the test antibody is unlabeled, and in the second direction, the test antibody is labeled and the reference antibody is unlabeled.

    [0178] A test antibody competes with the reference antibody for specific binding to the antigen if an excess of one antibody (e.g., 1?, 5?, 10?, 20? or 100?) inhibits binding of the other antibody, e.g., by at least 50%, 75%, 90%, 95% or 99%, as measured in a competitive binding assay.

    [0179] Two antibodies bind to the same epitope if essentially all amino acid mutations in the antigen that reduce or eliminate binding of one antibody reduce or eliminate binding of the other. Two antibodies bind to overlapping epitopes if only a subset of the amino acid mutations that reduce or eliminate binding of one antibody reduce or eliminate binding of the other.

    II. Production of Antibodies

    [0180] Methods for producing antibodies, such as those disclosed herein, are known in the art. For example, DNA molecules encoding light chain variable regions and/or heavy chain variable regions can be chemically synthesized using the sequence information provided herein. Synthetic DNA molecules can be ligated to other appropriate nucleotide sequences, including, e.g., constant region coding sequences, and expression control sequences, to produce conventional gene expression constructs encoding the desired antibodies. Production of defined gene constructs is within routine skill in the art. Alternatively, the sequences provided herein can be cloned out of hybridomas by conventional hybridization techniques or polymerase chain reaction (PCR) techniques, using synthetic nucleic acid probes whose sequences are based on sequence information provided herein, or prior art sequence information regarding genes encoding the heavy and light chains of murine antibodies in hybridoma cells.

    [0181] Nucleic acids encoding desired antibodies can be incorporated (ligated) into expression vectors, which can be introduced into host cells through conventional transfection or transformation techniques. Exemplary host cells are E. coli cells, Chinese hamster ovary (CHO) cells, human embryonic kidney 293 (HEK 293) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), and myeloma cells that do not otherwise produce IgG protein. Transformed host cells can be grown under conditions that permit the host cells to express the genes that encode the immunoglobulin light and/or heavy chain variable regions.

    [0182] Specific expression and purification conditions will vary depending upon the expression system employed. For example, if a gene is to be expressed in E. coli, it is first cloned into an expression vector by positioning the engineered gene downstream from a suitable bacterial promoter, e.g., Trp or Tac, and a prokaryotic signal sequence. The expressed secreted protein accumulates in refractile or inclusion bodies, and can be harvested after disruption of the cells by French press or sonication. The refractile bodies then are solubilized, and the proteins refolded and cleaved by methods known in the art.

    [0183] If the engineered gene is to be expressed in eukayotic host cells, e.g., CHO cells, it is first inserted into an expression vector containing a suitable eukaryotic promoter, a secretion signal, a poly A sequence, and a stop codon. Optionally, the vector or gene construct may contain enhancers and introns. This expression vector optionally contains sequences encoding all or part of a constant region, enabling an entire, or a part of, a heavy or light chain to be expressed. The gene construct can be introduced into eukaryotic host cells using conventional techniques. The host cells express V.sub.L or V.sub.H fragments, V.sub.L-V.sub.H heterodimers, V.sub.H-V.sub.L or V.sub.L-V.sub.H single chain polypeptides, complete heavy or light immunoglobulin chains, or portions thereof, each of which may be attached to a moiety having another function (e.g., cytotoxicity). In some embodiments, a host cell is transfected with a single vector expressing a polypeptide expressing an entire, or part of, a heavy chain (e.g., a heavy chain variable region) or a light chain (e.g., a light chain variable region). In some embodiments, a host cell is transfected with a single vector encoding (a) a polypeptide comprising a heavy chain variable region and a polypeptide comprising a light chain variable region, or (b) an entire immunoglobulin heavy chain and an entire immunoglobulin light chain. In some embodiments, a host cell is co-transfected with more than one expression vector (e.g., one expression vector expressing a polypeptide comprising an entire, or part of, a heavy chain or heavy chain variable region, and another expression vector expressing a polypeptide comprising an entire, or part of, a light chain or light chain variable region).

    [0184] A polypeptide comprising an immunoglobulin heavy chain variable region or light chain variable region can be produced by growing (culturing) a host cell transfected with an expression vector encoding such a variable region, under conditions that permit expression of the polypeptide. Following expression, the polypeptide can be harvested and purified or isolated using techniques known in the art, e.g., affinity tags such as glutathione-S-transferase (GST) or histidine tags.

    [0185] A monoclonal antibody that binds hGDF15, or an antigen-binding fragment of the antibody, can be produced by growing (culturing) a host cell transfected with: (a) an expression vector that encodes a complete or partial immunoglobulin heavy chain, and a separate expression vector that encodes a complete or partial immunoglobulin light chain; or (b) a single expression vector that encodes both chains (e.g., complete or partial heavy and light chains), under conditions that permit expression of both chains. The intact antibody (or antigen-binding fragment) can be harvested and purified or isolated using techniques known in the art, e.g., Protein A, Protein G, affinity tags such as glutathione-S-transferase (GST) or histidine tags. It is within ordinary skill in the art to express the heavy chain and the light chain from a single expression vector or from two separate expression vectors.

    III. Antibody Modifications

    [0186] Methods for reducing or eliminating the antigenicity of antibodies and antibody fragments are known in the art. When the antibodies are to be administered to a human, the antibodies preferably are humanized to reduce or eliminate antigenicity in humans. Preferably, each humanized antibody has the same or substantially the same affinity for the antigen as the non-humanized mouse antibody from which it was derived.

    [0187] In one humanization approach, chimeric proteins are created in which mouse immunoglobulin constant regions are replaced with human immunoglobulin constant regions. See, e.g., Morrison et al., 1984, PROC. NAT. ACAD. SCI. 81:6851-6855, Neuberger et al., 1984, NATURE 312:604-608; U.S. Pat. No. 6,893,625 (Robinson); U.S. Pat. No. 5,500,362 (Robinson); and 4,816,567 (Cabilly).

    [0188] In an approach known as CDR grafting, the CDRs of the light and heavy chain variable regions are grafted into frameworks from another species. For example, murine CDRs can be grafted into human FRs. In some embodiments, the CDRs of the light and heavy chain variable regions of an anti-GDF15 antibody are grafted into human FRs or consensus human FRs. To create consensus human FRs, FRs from several human heavy chain or light chain amino acid sequences are aligned to identify a consensus amino acid sequence. CDR grafting is described in U.S. Pat. No. 7,022,500 (Queen); U.S. Pat. No. 6,982,321 (Winter); U.S. Pat. No. 6,180,370 (Queen); U.S. Pat. No. 6,054,297 (Carter); U.S. Pat. No. 5,693,762 (Queen); U.S. Pat. No. 5,859,205 (Adair); U.S. Pat. No. 5,693,761 (Queen); U.S. Pat. No. 5,565,332 (Hoogenboom); U.S. Pat. No. 5,585,089 (Queen); U.S. Pat. No. 5,530,101 (Queen); Jones et al. (1986) NATURE 321: 522-525; Riechmann et al. (1988) NATURE 332: 323-327; Verhoeyen et al. (1988) SCIENCE 239: 1534-1536; and Winter (1998) FEBS LETT 430: 92-94.

    [0189] In an approach called SUPERHUMANIZATION?, human CDR sequences are chosen from human germline genes, based on the structural similarity of the human CDRs to those of the mouse antibody to be humanized. See, e.g., U.S. Pat. No. 6,881,557 (Foote); and Tan et al., 2002, J. IMMUNOL. 169:1119-1125.

    [0190] Other methods to reduce immunogenicity include reshaping, hyperchimerization, and veneering/resurfacing. See, e.g., Vaswami et al., 1998, ANNALS OF ALLERGY, ASTHMA, & IMMUNOL. 81:105; Roguska et al., 1996, PROT. ENGINEER 9:895-904; and U.S. Pat. No. 6,072,035 (Hardman). In the veneering/resurfacing approach, the surface accessible amino acid residues in the murine antibody are replaced by amino acid residues more frequently found at the same positions in a human antibody. This type of antibody resurfacing is described, e.g., in U.S. Pat. No. 5,639,641 (Pedersen).

    [0191] Another approach for converting a mouse antibody into a form suitable for medical use in humans is known as ACTIVMAB? technology (Vaccinex, Inc., Rochester, NY), which involves a vaccinia virus-based vector to express antibodies in mammalian cells. High levels of combinatorial diversity of IgG heavy and light chains are said to be produced. See, e.g., U.S. Pat. No. 6,706,477 (Zauderer); U.S. Pat. No. 6,800,442 (Zauderer); and 6,872,518 (Zauderer).

    [0192] Another approach for converting a mouse antibody into a form suitable for use in humans is technology practiced commercially by KaloBios Pharmaceuticals, Inc. (Palo Alto, CA). This technology involves the use of a proprietary human acceptor library to produce an epitope focused library for antibody selection.

    [0193] Another approach for modifying a mouse antibody into a form suitable for medical use in humans is HUMAN ENGINEERING? technology, which is practiced commercially by XOMA (US) LLC. See, e.g., PCT Publication No. WO 93/11794 and U.S. Pat. No. 5,766,886 (Studnicka); U.S. Pat. No. 5,770,196 (Studnicka); U.S. Pat. No. 5,821,123 (Studnicka); and 5,869,619 (Studnicka).

    [0194] Any suitable approach, including any of the above approaches, can be used to reduce or eliminate human immunogenicity of an antibody.

    [0195] In addition, it is possible to create fully human antibodies in mice. Fully human mAbs lacking any non-human sequences can be prepared from human immunoglobulin transgenic mice by techniques referenced in, e.g., Lonberg et al., NATURE 368:856-859, 1994; Fishwild et al., NATURE BIOTECHNOLOGY 14:845-851, 1996; and Mendez et al., NATURE GENETICS 15:146-156, 1997. Fully human mAbs can also be prepared and optimized from phage display libraries by techniques referenced in, e.g., Knappik et al., J. MOL. BIOL. 296:57-86, 2000; and Krebs et al., J. Immunol. Meth. 254:67-84 2001).

    IV. Therapeutic Uses

    [0196] The antibodies disclosed herein can be used to treat a variety of disorders, for example, cachexia and/or sarcopenia. In some embodiments, the antibodies disclosed herein (e.g., 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11) are used to inhibit the loss of muscle mass, for example, the loss of muscle mass associated with an underlying disease. Underlying diseases associated with cachexia include, but are not limited to, cancer, chronic heart failure, chronic kidney disease, COPD, AIDS, multiple sclerosis, rheumatoid arthritis, sepsis, and tuberculosis. In some embodiments, the disclosed antibodies inhibit loss of muscle mass by at least 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100%.

    [0197] In some embodiments, a loss of muscle mass is accompanied by a loss of fat mass. The antibodies disclosed herein (e.g., 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11) may inhibit loss of fat mass by at least 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100%.

    [0198] In other embodiments, the antibodies disclosed herein (e.g., 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11) are used to treat one or more features accompanying cachexia and/or sarcopenia, e.g., involuntary body weight loss. In some embodiments, the antibodies revert involuntary body weight loss by at least 2%, 5%, 10%, 15%, 20%, 25%, 30% or 35%.

    [0199] In another embodiment, the antibodies disclosed herein (e.g., 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11) are used to inhibit loss of organ mass, for example, loss of organ mass associated with an underlying disease. Underlying diseases associated with cachexia include, but are not limited to, cancer, chronic heart failure, chronic kidney disease, COPD, AIDS, multiple sclerosis, rheumatoid arthritis, sepsis, and tuberculosis. In some embodiments, the disclosed antibodies inhibit loss of organ mass by at least 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100%. In some embodiments, loss of organ mass is observed in heart, liver, kidney, and/or spleen. In some embodiments, the loss of organ mass in accompanied by a loss of muscle mass, a loss of fat mass and/or involuntary weight loss.

    [0200] Antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11 can be used in therapy. For example, antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11 can be used to treat cachexia and/or sarcopenia. Use of antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11 to treat cachexia and/or sarcopenia in a mammal comprises administering to the mammal a therapeutically effective amount of the antibody.

    [0201] Sarcopenia, muscle wasting disorders and significant muscle weight loss may occur in the absence of cachexia, decreased appetite or body weight loss. In certain embodiments, therefore, one or more of the anti-GDF antibodies of the invention (for example, antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11) can be used to treat a subject suffering from, or who has been diagnosed with, sarcopenia, a muscle wasting disorder and/or significant muscle weight loss, whether or not the subject has, or has been diagnosed with, cachexia or decreased appetite. Such a method comprises administering a therapeutically effective amount of one or more antibodies of the invention to the subject in need thereof.

    [0202] The Fc-rhGDF15 fusion proteins disclosed herein can be used to treat obesity. In some embodiments, the hFc-rhGDF15 fusion proteins disclosed herein are used to inhibit weight gain or to reduce body weight by at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45% or 50%. Use of an hFc-hGDF15 fusion protein to treat obesity in a mammal comprises administering to the mammal a therapeutically effective amount of the fusion protein.

    [0203] As used herein, treat, treating and treatment mean the treatment of a disease in a mammal, e.g., in a human. This includes: (a) inhibiting the disease, i.e., arresting its development; and (b) relieving the disease, i.e., causing regression of the disease state.

    [0204] Generally, a therapeutically effective amount of an active component (e.g., an antibody or a fusion protein) is in the range of 0.1 mg/kg to 100 mg/kg, e.g., 1 mg/kg to 100 mg/kg, e.g., 1 mg/kg to 10 mg/kg, e.g., 2.0 mg/kg to 10 mg/kg. The amount administered will depend on variables such as the type and extent of disease or indication to be treated, the overall health of the patient, the in vivo potency of the antibody or fusion protein, the pharmaceutical formulation, the serum half-life of the antibody or fusion protein, and the route of administration. The initial dosage can be increased beyond the upper level in order to rapidly achieve the desired blood-level or tissue level. Alternatively, the initial dosage can be smaller than the optimum, and the dosage may be progressively increased during the course of treatment. Human dosage can be optimized, e.g., in a conventional Phase I dose escalation study designed to run from 0.5 mg/kg to 20 mg/kg. Dosing frequency can vary, depending on factors such as route of administration, dosage amount, serum half-life of the antibody or fusion protein, and the disease being treated. Exemplary dosing frequencies are once per day, once per week and once every two weeks. In some embodiments, dosing is once every two weeks. A preferred route of administration is parenteral, e.g., intravenous infusion. Formulation of monoclonal antibody-based drugs and fusion protein-based drugs are within ordinary skill in the art. In some embodiments, the antibody or fusion protein is lyophilized, and then reconstituted in buffered saline, at the time of administration. The effective amount of a second active agent, for example, an anti-cancer agent or the other agents discussed below, will also follow the principles discussed hereinabove and will be chosen so as to elicit the required therapeutic benefit in the patient.

    [0205] For therapeutic use, an antibody preferably is combined with a pharmaceutically acceptable carrier. As used herein, pharmaceutically acceptable carrier means buffers, carriers, and excipients suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio. The carrier(s) should be acceptable in the sense of being compatible with the other ingredients of the formulations and not deleterious to the recipient. Pharmaceutically acceptable carriers include buffers, solvents, dispersion media, coatings, isotonic and absorption delaying agents, and the like, that are compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is known in the art.

    [0206] Pharmaceutical compositions containing antibodies or fusion proteins, such as those disclosed herein, can be presented in a dosage unit form and can be prepared by any suitable method. A pharmaceutical composition should be formulated to be compatible with its intended route of administration. Examples of routes of administration are intravenous (IV), intradermal, inhalation, transdermal, topical, transmucosal, and rectal administration. A preferred route of administration for monoclonal antibodies is IV infusion. Useful formulations can be prepared by methods known in the pharmaceutical art. For example, see Remington's Pharmaceutical Sciences, 18th ed. (Mack Publishing Company, 1990). Formulation components suitable for parenteral administration include a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl paraben; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as EDTA; buffers such as acetates, citrates or phosphates; and agents for the adjustment of tonicity such as sodium chloride or dextrose.

    [0207] For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor EL? (BASF, Parsippany, NJ) or phosphate buffered saline (PBS). The carrier should be stable under the conditions of manufacture and storage, and should be preserved against microorganisms. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyetheylene glycol), and suitable mixtures thereof.

    [0208] Pharmaceutical formulations preferably are sterile. Sterilization can be accomplished, for example, by filtration through sterile filtration membranes. Where the composition is lyophilized, filter sterilization can be conducted prior to or following lyophilization and reconstitution.

    [0209] In addition to the GDF15 (i.e., MIC-1/PLAB/PDF/NAG-1) pathway, other cytokines implicated in cachexia include Activin A and IL-6. Increased activin levels have been associated with cancer-associated cachexia and gonadal tumors. See, e.g., Marino et al. (2013) CYTOKINE & GROWTH FACTOR REV. 24:477-484. Activin A is a member of the TGF-beta family, and is a ligand of the activin type 2 receptor, ActRIIB. See, e.g., Zhou et al. (2010) CELL 142:531-543. Circulating levels of IL-6 have been shown to correlate with weight loss in cancer patients, as well as with reduced survival. See, e.g., Fearon et al. (2012) CELL METABOLISM 16:153-166.

    [0210] Accordingly, in certain embodiments of the present invention, one or more inhibitors of Activin-A or the Activin-A receptor, ActRIIB, IL-6 or the IL-6 receptor (IL-6R), may be administered in combination with (for example, administered at the same time as, administered before, or administered after) an antibody of the present invention that inhibits GDF-15 activity. Exemplary inhibitors of Activin A or ActRIIB, include, for example, an anti-Activin-A antibody or an antigen binding fragment thereof, an anti-ActRIIB antibody or an antigen binding fragment thereof, a small molecule inhibitor of Activin-A, a small molecule inhibitor of ActRIIB, and a decoy receptor of ActRIIB, such as a soluble ActRIIB receptor and a fusion of the soluble ActRIIB receptor with an Fc molecule (ActRIIB-Fc). See, for example, Zhou et al. (2010), supra. Suitable inhibitors of IL-6 or IL-6R, include an anti-IL-6 antibody or an antigen binding fragment thereof, an anti-IL-6R antibody or an antigen binding fragment thereof, a small molecule inhibitor of IL-6, a small molecule inhibitor of IL-6R, and a decoy receptor of IL-6R, such as a soluble IL-6 receptor and a fusion of the soluble IL-6 receptor with an Fc molecule (IL6R-Fc). See, e.g., Enomoto et al. (2004) BIOCHEM. AND BIOPHYS. RES. COMM. 323:1096-1102; Argiles et al. (2011) EUR. J. PHARMACOL. 668:S81-S86; Tuca et al. (2013) ONCOLOGY/HEMATOLOGY 88:625-636. Suitable inhibitors of IL-6 or IL-6R may include, for example, Tocilizumab (Actemra?, Hoffmann-LaRoche), a humanized anti-IL-6R monoclonal antibody approved for treatment of rheumatoid arthritis, and Sarilumab/REGN88 (Regeneron), a humanized anti-IL6R antibody in clinical development for treatment of rheumatoid arthritis; and Selumetinib/AZD6244 (AstraZeneca), an allosteric inhibitor of MEK, which has been shown to inhibit IL-6 production. Prado et al. (2012) BRITISH J. CANCER 106:1583-1586.

    [0211] TNF? and IL-1 are cytokines known to be involved in mediation of the proinflammatory response, which are also implicated in muscle depletion, anorexia and cachexia. Increased circulating levels of TNF? appear to inhibit myogenesis. TNF?, also known as cachectin, stimulates interleukin-1 secretion and is implicated in the induction of cachexia. IL-1 is a potent trigger of the acute-phase inflammatory response, and it has been shown that infusion of IL-1 can lead to marked weight loss and appetite loss. IL-1 has been shown to contribute to the initiation of cancer cachexia in mice bearing a murine colon-26 adenocarcinoma (Strassmann et al. (1993) J. IMMUNOL. 150:2341). See also, Mathys and Billiau (1997) NUTRITION 13:763-770; Fong et al. (1989) AM. J. PHYSIOL.REGULATORY, INTEGRATIVE AND COMPARATIVE PHYSIOL., 256:R659-R665. Thus, TNF? inhibitors and IL-1 inhibitors that are used in the treatment of rheumatoid arthritis may also be useful in the treatment of cachexia.

    [0212] Accordingly, in certain embodiments of the present invention, one or more inhibitors of TNF? or IL-1 may be administered in combination with (for example, administered at the same time as, administered before, or administered after) an antibody of the present invention that inhibits GDF-15 activity. Suitable inhibitors of TNF? or IL-1 include an anti-TNF? antibody or an antigen binding fragment thereof, an anti-IL-1 antibody or an antigen binding fragment thereof, a small molecule inhibitor of TNF? or IL-1, and a decoy receptor of TNF? or IL-1, such as a soluble TNF? or IL-1 receptor and a fusion of the soluble form of TNF? or IL-1 with an Fc molecule. Suitable inhibitors of TNF? include for example, etanercept (Enbrel?, Pfizer/Amgen), infliximab (Remicade?, Janssen Biotech), adalimumab (Humira?, Abbvie), golimumab (Simponi?, Johnson and Johnson/Merck), and certolizumab pegol (Cimzia?, UCB). Suitable IL-1 inhibitors include, for example, Xilonix? antibody that targets IL-1? (XBiotech), anikinra (Kinaret?, Amgen), canakinumab (Ilaris?, Novartis), and rilonacept (Arcalyst?, Regeneron). In certain embodiments, the TNF? inhibitor or IL-1 inhibitor, which is typically administered systemically for the treatment of rheumatoid arthritis may be administered locally and directly to the tumor site.

    [0213] Myostatin, also known as GDF-8, is a member of the TGF-0 family of peptides that is a negative regulator of muscle mass, as shown by increased muscle mass in myostatin deficient mammals. Myostatin is a ligand of the activin type 2 receptor, ActRIIB. Accordingly, in certain embodiments of the present invention, one or more inhibitors of myostatin or its receptor may be administered in combination with (for example, administered at the same time as, administered before, or administered after) an antibody of the invention that inhibits GDF-15 activity. Suitable inhibitors of myostatin or ActRIIB, include an anti-myostatin antibody or an antigen binding fragment thereof, an anti-ActRIIB antibody or an antigen binding fragment thereof, a small molecule inhibitor of myostatin, a small molecule inhibitor of ActRIIB, and a decoy receptor of GDF-8, such as a soluble ActRIIB and a fusion of the soluble form of ActRIIB with an Fc molecule. See, e.g., Lokireddy et al. (2012) BIOCHEM. J. 446(1):23-26. Myostatin inhibitors that may be suitable for the present invention include REGN1033 (Regeneron); see Bauerlein et al. (2013) J. CACHEXIA SARCOPENIA MUSCLE: Abstracts of the 7.sup.th Cachexia Conference, Kobe/Osaka, Japan, Dec. 9-11, 2013, Abstract 4-06; LY2495655 (Lilly), a humanized anti-myostatin antibody in clinical development by Eli Lilly; see also A PHASE 2 STUDY OF LY2495655 IN PARTICIPANTS WITH PANCREATIC CANCER, available on the world wide web at clinicaltrials.gov/ct2/NCT01505530; NML identifier: NCT01505530; ACE-031 (Acceleron Pharma); and stamulumab (Pfizer).

    [0214] Agents such as Ghrelin or ghrelin mimetics, or other growth hormone secretagogues (GHS) which are able to activate the GHS receptor (GHS-R1a), also known as the ghrelin receptor, may be useful for increasing food intake and body weight in humans. See Guillory et al. (2013) in VITAMINS AND HORMONES vol. 92, chap.3; and Steinman and DeBoer (2013) VITAMINS AND HORMONES vol. 92, chap. 8. Suitable ghrelin mimetics include anamorelin (Helsinn, Lugano, CH); See Temel et al. (2013) J. CACHEXIA SARCOPENIA MUSCLE: Abstracts of the 7.sup.th Cachexia Conference, Kobe/Osaka, Japan, Dec. 9-11, 2013, Abstract 5-01. Other suitable GHS molecules can be identified, for example, using the growth hormone secretagogue receptor Ghrelin competition assay described in PCT Publication Nos. WO2011/117254 and WO2012/113103.

    [0215] Agonists of the androgen receptor, including small molecules and other selective androgen receptor modulators (SARMs) may be useful in treating cachexia and/or sarcopenia. See, e.g., Mohler et al. (2009) J. MED. CHEM. 52:3597-3617; Nagata et al. (2011) BIOORGANIC AND MED. CHEM. LETTERS 21:1744-1747; and Chen et al. (2005) MOL. INTERV. 5:173-188. Ideally, SARMs should act as full agonists, like testosterone, in anabolic target tissues, such as muscle and bone, but should demonstrate only partial or pure androgen receptor antagonistic activities on prostate tissue. See, e.g., Bovee et al. (2010) J. STEROID BIOCHEM. & MOL. BIOL. 118:85-92. Suitable SARMs can be identified, for example, by use of the methods and assays described in Zhang et al. (2006) BIOORG. MED. CHEM. LETT. 16:5763-5766; and Zhang et al. (2007) BIOORG. MED. CHEM. LETT. 17:439-443. Suitable SARMs include, for example, GTx-024 (enobosarm, Ostarine?, GTx, Inc.), a SARM in phase II clinical development by GTx, Inc. See also, Dalton et al. (2011) J. CACHEXIA SARCOPENIA MUSCLE 2:153-161. Other suitable SARMs include 2-(2,2,2)-trifluoroethyl-benzimidazoles (Ng et al. (2007) BIOORG. MED. CHEM. LETT. 17:1784-1787) and JNJ-26146900 (Allan et al. (2007) J. STEROID BIOCHEM. & MOL. BIOL. 103:76-83).

    [0216] ?-adrenergic receptor blockers, or beta-blockers, have been studied for their effect on body weight in cachexic subjects, and have been associated with partial reversal of cachexia in patients with congestive heart failure. See, e.g., Hryniewicz et al. (2003) J. CARDIAC FAILURE 9:464-468. Beta-blocker MT-102 (PsiOxus Therapeutics, Ltd.) has been evaluated in a phase 2 clinical trial for subjects with cancer cachexia. See Coats et al. (2011) J. CACHEXIA SARCOPENIA MUSCLE 2:201-207.

    [0217] Melanocortin receptor-knockout mice with a genetic defect in melanocortin signaling exhibit a phenotype opposite that of cachexia: increased appetite, increased lean body mass, and decreased metabolism. Thus, melanocortin antagonism has emerged as a potential treatment for cachexia associated with chronic disease (DeBoer and Marks (2006) TRENDS IN ENDOCRINOLOGY AND METABOLISM 17:199-204). Accordingly, in certain embodiments of the present invention, one or more inhibitors of a melanocortin peptide or a melanocortin receptor may be administered in combination (for example, administered at the same time as, administered before, or administered after) with an antibody of the invention that inhibits GDF-15 activity. Suitable inhibitors of melanocortins or melanocortin receptors include an anti-melanocortin peptide antibody or an antigen binding fragment thereof, an anti-melanocortin receptor antibody or an antigen binding fragment thereof, a small molecule inhibitor of a melanocortin peptide, a small molecule inhibitor of a melanocortin receptor, and a decoy receptor of a melanocortin receptor, such as soluble melanocortin receptor and a fusion of a soluble melanocortin receptor with an Fc molecule. Suitable melacortin receptor inhibitors include, for example, the melanocortin receptor antagonist agouri-related peptide (AgRP(83-132)), which has been demonstrated to prevent cachexia-related symptoms in a mouse model of cancer-related cachexia (Joppa et al. (2007) PEPTIDES 28:636-642).

    [0218] Anti-cancer agents, especially those that can cause cachexia and elevate GDF-15 levels, such as cisplatin, may be used in methods of the present invention in combination with (for example, administered at the same time as, administered before, or administered after) an anti-GDF-15 antibody of the invention. Many cancer patients are weakened by harsh courses of radio- and/or chemotherapy, which can limit the ability of the patient to tolerate such therapies, and hence restrict the dosage regimen. Certain cancer agents themselves, such as fluorouracil, Adriamycin, methotrexate and cisplatin, may contribute to cachexia, for example by inducing severe gastrointestinal complications. See, e.g., Inui (2002) CANCER J. FOR CLINICIANS 52:72-91. By the methods of the present invention, in which an anti-cancer agent is administered in combination with an anti-GDF-15 antibody of the invention, it is possible to decrease the incidence and/or severity of cachexia, and ultimately increase the maximum tolerated dose of such an anti-cancer agent. Accordingly, efficacy of treatment with anti-cancer agents that may cause cachexia can be improved by reducing the incidence of cachexia as a dose-limiting adverse effect, and by allowing administration of higher doses of a given anti-cancer agent.

    [0219] Thus, the present invention includes pharmaceutical compositions comprising an anti-GDF-15 antibody of the present invention in combination with an agent selected from the group consisting of an inhibitor of Activin-A, an inhibitor of ActRIIB, an inhibitor of IL-6 or an inhibitor of IL-6R, a ghrelin, a ghrelin mimetic or a GHS-R1a agonist, a SARM, a TNF? inhibitor, an IL-1? inhibitor, a myostatin inhibitor, a beta-blocker, a melanocortin peptide inhibitor, a melanocortin receptor inhibitor, and an anti-cancer agent. The present invention also includes methods of treating, preventing or minimizing cachexia and/or sarcopenia in a mammal comprising administering to a mammal in need thereof a pharmaceutical composition or compositions comprising an effective amount of an anti-GDF-15 antibody of the invention in combination with an effective amount of an inhibitor of Activin-A, an inhibitor of ActRIIB, an inhibitor of IL-6 or an inhibitor of IL-6R, a ghrelin, a ghrelin mimetic or a GHS-R1a agonist, a SARM, a TNF? inhibitor, an IL-1? inhibitor, a myostatin inhibitor, a beta-blocker, a melanocortin peptide inhibitor, or a melanocortin receptor inhibitor.

    [0220] In another embodiment, the invention comprises a method of inhibiting loss of muscle mass associated with an underlying disease comprising administering to a mammal in need thereof a pharmaceutical composition or compositions comprising an effective amount of an anti-GDF-15 antibody of the invention in combination with an effective amount of an inhibitor of Activin-A, an inhibitor of ActRIIB, an inhibitor of IL-6 or an inhibitor of IL-6R, a ghrelin, a ghrelin mimetic or a GHS-R1a agonist, a SARM, a TNF? inhibitor, an IL-1? inhibitor, a myostatin inhibitor, a beta-blocker, a melanocortin peptide inhibitor, or a melanocortin receptor inhibitor to prevent or reduce loss of muscle mass. The underlying disease may be selected from the group consisting of cancer, chronic heart failure, chronic kidney disease, COPD, AIDS, multiple sclerosis, rheumatoid arthritis, sepsis, and tuberculosis. Additionally, in certain embodiments, the loss of muscle mass is accompanied by a loss of fat mass.

    [0221] In yet further embodiments, the present invention comprises a method of inhibiting or reducing involuntary weight loss in a mammal comprising administering to a mammal in need thereof a pharmaceutical composition or pharmaceutical compositions comprising an effective amount of an anti-GDF-15 antibody of the invention in combination with an effective amount of an inhibitor of Activin-A, an inhibitor of ActRIIB, an inhibitor of IL-6 or an inhibitor of IL-6R, a ghrelin, a ghrelin mimetic or a GHS-R1a agonist, a SARM, a TNF? inhibitor, a IL-1? inhibitor, a myostatin inhibitor, a beta-blocker, a melanocortin peptide inhibitor, or a melanocortin receptor inhibitor.

    [0222] Certain anti-cancer agents, such as cisplatin, have one or more undesirable adverse effects that involve causing or increasing one or more syndromes such as cachexia, sarcopenia, muscle wasting, bone wasting or involuntary body weight loss. Accordingly, in certain embodiments, the present invention comprises a method of treating cancer, while preventing, minimizing or reducing the occurrence, frequency or severity of cachexia, sarcopenia, or muscle wasting, bone wasting or involuntary loss of body weight in a mammal, comprising administering to a mammal in need thereof a pharmaceutical composition comprising an effective amount of an anti-GDF-15 antibody of the present invention in combination with with one or more anti-cancer agents. In particular embodiments, the invention comprises a method of treating cancer, while preventing, minimizing or reducing the occurrence, frequency or severity of cachexia, sarcopenia or muscle wasting, bone wasting or involuntary loss of body weight in a mammal, comprising administering to a mammal in need thereof a pharmaceutical composition comprising an effective amount of an anti-GDF-15 antibody of the invention in combination with one or more anti-cancer agents known to cause or increase the occurrence, frequency or severity of cachexia, sarcopenia, or muscle wasting, bone wasting or involuntary loss of body weight in a mammal.

    EXAMPLES

    [0223] The following Examples are merely illustrative and are not intended to limit the scope or content of the invention in any way.

    Example 1: Human GDF15 Serum Levels in Mouse Xenograft Tumor Models

    [0224] In this example, the amount of hGDF15 in the serum of mice bearing various xenograft tumors was measured. Serum was collected from three mice for each of the following tumor xenograft models: Chago, RPMI7951, PC3, TOV21G, HT-1080, K-562, and LS1034. Serum was also collected from three na?ve mice as a control. Human GDF15 serum levels were determined by ELISA (R&D Systems, Cat. No. DY957E). Mice bearing human xenograft tumors that induce cachexia had serum levels of hGDF15 above 2 ng/mL, while mice bearing human xenograft tumors that do not induce cachexia had serum levels of hGDF15 below 1 ng/mL (FIG. 2). Na?ve mice had no detectable hGDF15 (control). These results indicate that a serum level of approximately 2 ng/mL GDF15 is a threshold for inducing cachexia in this mouse model. Similar levels of hGDF15 were also observed in plasma when determined by ELISA.

    Example 2: Non-Tumor Bearing Mouse Model of Cachexia

    [0225] An existing non-tumor bearing mouse model of cachexia is based on the injection of mature rhGDF15 into a mouse (Johnen et al. (1997) NAT. MED. 13:1333-1340). Mature rhGDF15 corresponds to amino acids 197 to 308 of hGDF15 protein. Mature rhGDF15 can be produced in the yeast Pichia pastoris as described in Fairlie et al. (2000) GENE 254:67-76). Cleaved-rhGDF15 corresponds to amino acids 197 to 308 of hGDF15 protein released from an Fc-rhGDF15 fusion protein. In FIGS. 3-4 described below, cleaved-rhGDF15 was produced by enzymatic digestion of mFc-rhGDF15 fusion protein with Factor Xa, and subsequent purification, prior to injection in mice.

    [0226] To investigate the half-life of cleaved-rhGDF15, plasma was collected from a group of three mice after single dose of cleaved-rhGDF15 (1 ?g/g) at different time points (2, 5, 8, 11, and 23 hours). Human GDF15 plasma levels were determined by ELISA (R&D Systems, Cat. No. DY957E). As shown in FIG. 3, cleaved-rhGDF15 was rapidly cleared from the plasma following injection. Eleven hours post-injection, the amount of cleaved-rhGDF15 in the plasma was below 10 ng/mL, and, within 23-hours, cleaved-rhGDF15 was almost completely cleared from the plasma.

    [0227] The rapid clearance of cleaved-rhGDF15 in non-tumor bearing mice was further investigated. Eight-week old female ICR-SCID mice were randomized into two groups of ten mice each. Mice were dosed subcutaneously into the flank every eight hours for three days (a total of nine doses) with one of the following treatments: PBS (control) or cleaved-rhGDF15 at 1 ?g/g. Body weight was measured daily. Statistical analyses were performed using a two-way ANOVA.

    [0228] As shown in FIG. 4, cleaved-rhGDF15 induced body weight loss. After nine doses over a three day period, percent body weight dropped to 88% at day 4 (p<0.001), but approximately 24 hours after the last dose the mice began to gain weight. On day 6, the last day of the experiment, percent body weight increased to 94.8 percent (p<0.001). These results indicate that weight loss induced by cleaved-rhGDF15 is not sustained over long periods of time. The activity observed with cleaved-rhGDF15 described herein was similar to that observed with mature rhGDF15 in the existing mouse model (Johnen et al., supra).

    [0229] The existing non-tumor bearing mouse model for cachexia relies on the injection of large amounts of mature rhGDF15 delivered in multiple doses per day to induce muscle loss and body weight loss (Johnen et al., supra). It appears that if mature rhGDF15 or cleaved-rhGDF15 is used, the mice do not sustain muscle weight loss or body weight loss for long periods of time without continuous dosing. This limits the usefulness of such models. Moreover, repeated dosing requires frequent handling of these mice which introduces stress that can compromise the reliability of body weight loss measurements. For example, as shown in FIG. 4, mice treated with multiple doses of PBS demonstrated a body weight drop due to the stress of repeated dosing and handling.

    Example 3: GDF15 Fusion Proteins

    [0230] In view of the large amounts of mature rhGDF15 (or cleaved-rhGDF15) and the labor intensity required to induce non-tumor bearing cachexia mouse models (as well as the resulting limitations of these models), we investigated alternate forms of rhGDF15 to induce a cachetic phenotype in mice. This Example describes the construction and production of two fusion proteins consisting of GDF15 and an immunoglobulin Fc fragment, designated mFc-rhGDF15 (mouse IgG1 Fc fused to the amino terminus of mature human GDF15) and rFc-rmGDF15 (rabbit IgG1 Fc fused to the amino terminus of mature mouse GDF15). The GDF15 fusion proteins were designed using methods known in the art. The mFc-rhGDF15 DNA sequences were constructed from fragments using overlap extension PCR to include (in the following order): 5 HindIII restriction site, Kozak consensus sequence, amino terminal signal sequence, mouse IgG1 Fc, Factor Xa cleavage site, a polypeptide linker (GGGGS) (SEQ ID NO: 139), mature hGDF15, stop codon, and a 3 EcoRI restriction site. The rFc-rmGDF15 amino acid sequences were converted to codon-optimized DNA sequences and synthesized to include (in the following order): 5 HindIII restriction site, Kozak consensus sequence, amino terminal signal sequence, rabbit IgG1 Fc, a polypeptide linker (GGGG) (SEQ ID NO: 265), mature mouse GDF15, stop codon, and a 3 EcoRI restriction site.

    [0231] The GDF15 fusion proteins were subcloned into the mammalian expression vector pEE14.4 (Lonza, Basel, Switzerland) via HindIII and EcoRI sites using In-Fusion? PCR cloning (Clontech, Mountain View, CA). GDF15 fusion proteins were stably expressed in CHOK1SV cells using the GS System? (Lonza Biologics) in order to produce large quantities of purified protein. Each expression vector was linearized and transfected into CHOK1SV cells. Stable clones were selected in the presence of methionine sulfoximine. Secreted proteins produced by CHOK1SV stably transfected cell lines were purified by Protein A and size exclusion chromatography.

    [0232] The nucleic acid sequence and the encoded protein sequence defining the mouse IgG1 Fc-mature human GDF15 fusion protein (mFc-rhGDF15) are shown below. mFc-rhGDF15 contains mouse IgG1 Fc from amino acids 1-222, Factor Xa cleavage site from amino acids 223-228, an artificial linker sequence from amino acids 229-233, and mature hGDF15 from amino acids 234-345.

    [0233] Nucleic Acid Sequence Encoding the Mouse IgG1 FcMature Human GDF15 Fusion Protein (mFc-rhGDF15) (SEQ ID NO:219)

    TABLE-US-00001 1 gggtgtaaaccctgcatctgcacggtgccggaggtgtcct ccgtctttatcttccctccc 61 aaacccaaggatgtgctgacaatcactttgactccaaaag tcacatgcgtagtcgtggac 121 atctcgaaagacgacccggaagtgcagttctcgtggtttg ttgatgatgtagaagtgcat 181 accgctcaaacccagccgagggaagaacagtttaacagca cgtttaggagtgtgtcggaa 241 ctgcccattatgcaccaggattggcttaatgggaaggagt tcaaatgtcgcgtgaatagt 301 gcggcgttcccagcccctattgaaaagactatttccaaaa cgaagggtcggcccaaagct 361 ccccaagtatacacaatccctccgccgaaagaacaaatgg caaaagacaaagtgagtttg 421 acgtgcatgatcacggactttttcccggaggatatcaccg tcgaatggcaatggaatggg 481 caacctgccgaaaactacaagaatacacaacccattatgg ataccgatggatcgtatttc 541 gtctactcaaagttgaacgtacagaagtcaaattgggagg cagggaatacgttcacttgc 601 agtgttttgcacgaaggcctccataaccaccatacggaaa agtcactgtcgcactccccg 661 ggaaaaatcgagggcagaatggatggtggaggagggtcgg cgcgcaacggggaccactgt 721 ccgctcgggcccgggcgttgctgccgtctgcacacggtcc gcgcgtcgctggaagacctg 781 ggctgggccgattgggtgctgtcgccacgggaggtgcaag tgaccatgtgcatcggcgcg 841 tgcccgagccagttccgggcggcaaacatgcacgcgcaga tcaagacgagcctgcaccgc 901 ctgaagcccgacacggtgccagcgccctgctgcgtgcccg ccagctacaatcccatggtg 961 ctcattcaaaagaccgacaccggggtgtcgctccagacct atgatgacttgttagccaaa 1021 gactgccactgcata

    [0234] Protein Sequence Defining the Mouse IgG1 FcMature Human GDF15 Fusion Protein (mFc-rhGDF15) (SEQ ID NO:220)

    TABLE-US-00002 1 gckpcictvpevssvfifppkpkdvltitltpkvtcvvvdiskddpevqfswfvddvevh 61 taqtqpreeqfnstfrsvselpimhqdwlngkefkcrvnsaafpapiektisktkgrpka 121 pqvytipppkeqmakdkvsltcmitdffpeditvewqwngqpaenykntqpimdtdgsyf 181 vysklnvqksnweagntftcsvlheglhnhhtekslshspgkiegrmdggggsarngdhc 241 plgpgrccrlhtvrasledlgwadwvlsprevqvtmcigacpsqfraanmhaqiktslhr 301 lkpdtvpapccvpasynpmvliqktdtgvslqtyddllakdchci

    [0235] The nucleic acid sequence and the encoded protein sequence defining the rabbit IgG1 Fc-mature mouse GDF15 fusion protein (rFc-rmGDF15) are shown below. rFc-BUSINESS 30261614.1 rmGDF15 contains rabbit IgG1 Fc from amino acids 1-223, an artificial linker sequence from amino acids 224-227, and mature mouse GDF15 from amino acids 228-342.

    [0236] Nucleic Acid Sequence Encoding the Rabbit IgG1 FcMature Mouse GDF15 Fusion Protein (rFc-rmGDF15) (SEQ ID NO:221)

    TABLE-US-00003 1 tcgaaacccacttgccctcctccggagctgttgggcggac cctccgtgtttatctttccc 61 ccgaagccgaaagatacccttatgatctcacggacgccgg aggtcacttgcgtagtagtg 121 gatgtgtcggaggatgaccccgaagtccagttcacctggt atatcaataacgagcaagtg 181 aggacagcgaggcccccacttagggagcagcagttcaact ccacaattcgggtcgtcagc 241 actttgcccatcgctcatgaggactggctccgcggaaaag agttcaagtgtaaggtgcat 301 aacaaggcattgccagcgcctattgaaaagacaatctcga aggcgcgagggcagccgctc 361 gagcccaaagtgtatacgatgggacccccgagggaagaat tgtcgtcgcgctcagtaagc 421 cttacgtgcatgattaacggtttctaccctagcgacatca gcgtagagtgggaaaagaat 481 ggaaaggcggaggataactacaagacgactcccgcggtgc tggattcggatgggtcgtac 541 tttctgtatagcaaattgtcagtcccgacctcagaatggc agaggggtgacgtgttcacg 601 tgctccgtgatgcacgaagcacttcacaatcactacaccc agaaatcaatctcgcggtcc 661 ccaggcaaaggtggaggagggtcggctcacgcccaccctc gcgattcgtgtccgctgggg 721 cctggtagatgctgtcatctcgagacagtccaggccacgc tggaggacctcgggtggtca 781 gactgggtcctgtccccacgacaactgcagctttcgatgt gcgtgggggaatgtccgcac 841 ttgtacagatcggcgaatacccacgctcagattaaggcac gactccatggtttgcagcca 901 gataaagtccccgcaccttgctgtgtccccagctcatata ctcctgtcgtactcatgcat 961 cggacagacagcggcgtgtcgcttcaaacgtatgacgacc tcgtagcgagaggatgtcat 1021 tgcgcc

    [0237] Protein Sequence Defining the Rabbit IgG1 FcMature Mouse GDF15 Fusion Protein (rFc-rmGDF15) (SEQ ID NO:222)

    TABLE-US-00004 1 skptcpppellggpsvfifppkpkdtlmisrtpevtcvvvdvseddpevqftwyinneqv 61 rtarpplreqqfnstirvvstlpiahedwlrgkefkckvhnkalpapiektiskargqpl 121 epkvytmgppreelssrsvsltcmingfypsdisvewekngkaednykttpavldsdgsy 181 flysklsvptsewqrgdvftcsvmhealhnhytqksisrspgkggggsahahprdscplg 241 pgrcchletvqatledlgwsdwvlsprqlqlsmcvgecphlyrsanthaqikarlhglqp 301 dkvpapccvpssytpvvlmhrtdsgvslqtyddlvargchca

    [0238] The following sequences represent exemplary protein sequences for human IgG1 Fc-mature human GDF15 fusion proteins (hFc-rhGDF15). hFc-rhGDF15 Xa consists of human IgG1 Fc from amino acids 1-227, Factor Xa cleavage site from amino acids 228-233, an artificial linker sequence from amino acids 234-238, and mature hGDF15 from amino acides 239-350. hFc-rhGDF15 consists of human IgG1 Fc from amino acids 1-227, an artificial linker sequence from amino acids 228-232, and mature hGDF15 from amino acids 233-344.

    [0239] Protein Sequence Defining the Human IgG1 FcMature Human GDF15 Fusion Protein with Xa Cleavage Site (hFc-hGDF15 Xa) (SEQ ID NO:223)

    TABLE-US-00005 1 dkthtcppcpapellggpsvflfppkpkdtlmisrtpevt cvvvdvshedpevkfnwyvd 61 gvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeyk ckvsnkalpapiektiskak 121 gqprepqvytlppsreemtknqvsltclvkgfypsdiave wesngqpennykttppvlds 181 dgsfflyskltvdksrwqqgnvfscsvmhealhnhytqks lslspgkiegrmdggggsar 241 ngdhcplgpgrccrlhtvrasledlgwadwvlsprevqvt mcigacpsqfraanmhaqik 301 tslhrlkpdtvpapccvpasynpmvliqktdtgvslqtyd dllakdchci

    [0240] Protein Sequence Defining the Human IgG1 FeMature Human GDF15 Fusion Protein with (hFc-hGDF15) (SEQ ID NO:224)

    TABLE-US-00006 1 dkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvd 61 gvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskak 121 gqprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvlds 181 dgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgkggggsarngdhcp 241 lgpgrccrlhtvrasledlgwadwvlsprevqvtmcigacpsqfraanmhaqiktslhrl 301 kpdtvpapccvpasynpmvliqktdtgvslqtyddllakdchci

    Example 4: Fc-rhGDF15 Induced Cachexia Model

    [0241] This Example describes the generation of an Fc-GDF15-induced cachexia model in mice. Immune-competent (Balb/C) and immune-incompetent (CB17-Scid) mice were randomized into three groups of ten mice each. Each group received one of the following treatments: PBS (control), mFc-rhGDF15 (as described in Example 3), or rFc-rmGDF15 (as described in Example 3) at 1p g/g. Eight-week old female mice were dosed subcutaneously into the flank for three days (Balb/C) or once (CB17-Scid). Body weight was measured daily.

    [0242] As shown in FIG. 5A and FIG. 5B, administration of mFc-rhGDF15 or rFc-rmGDF15 induced body weight loss in immune-competent mice (FIG. 5A) and immune-incompetent mice (FIG. 5B). These results indicate that a steady-state level of active rhGDF15 was achieved, because regardless of dose (one vs. three doses), both mFc-rhGDF15 and rFc-rmGDF15 induced sustained weight loss over the measured time course (7 days).

    [0243] The fusion proteins, mFc-rhGDF15 and rFc-rmGDF15, were further tested in additional immune-competent (C57BL6, Swiss Webster) and immune-incompetent (ICR-SCID) mouse strains. In each tested mouse strain, the administration of mFc-rhGDF15 or rFc-rmGDF15 induced cachexia, as measured by body weight loss. Similar results were obtained regardless of whether mFc-rhGDF15 was dosed subcutaneously or intraperitoneally.

    [0244] It was also investigated whether mFc-rhGDF15 induced weight loss regardless of the age of the mice treated with fusion protein. Swiss Webster (immune-competent) female mice of different ages (7, 13 and 25 weeks old) were divided into two groups of ten and treated with three doses per day of mFc-rhGDF15 or PBS (0.8 ?g/g, 7 week old mice; 0.6 ?g/g, 13 week old mice; or 0.4 ?g/g, 25 week old mice). mFc-rhGDF15-induced weight loss was observed in all three mice age populations. In each age population, the mice lost approximately 10% of their body weight following treatment with mFc-rhGDF15 measured at ten days post treatment.

    [0245] In another experiment, mFc-rhGDF15 induction of cachexia was investigated by measuring the loss of body weight, the loss of muscle mass, the loss of fat mass, and the expression levels of two molecular markers indicative of muscle degradation (i.e., mMuRF1 and mAtrogin). MuRF1 and Atrogin are E3-ubquitin ligases that are upregulated in multiple models of muscle atrophy and cachexia (Glass, D. (2010) CURR. OPIN. CLIN. NUTR. MET. CARE 13:225-229).

    [0246] Eight-week old female ICR-SCID mice were randomly divided into ten groups of ten mice each. Five groups (ten mice each) were dosed subcutaneously in the flank with PBS (control) and five groups (ten mice each) were dosed subcutaneously in the flank with mFc-rhGDF15 at 1.6 ?g/g on day one. Body weight was measured daily for up to 17 days. One control group and one treatment group were sacrificed at different time points (0, 1, 3, 7 and 16 days post dose). Gonadal fat and gastrocnemius muscles were removed surgically from each group of mice at the indicated sacrifice time, and weighed. Tissues were snap frozen in liquid nitrogen, and RNA was isolated from the gastrocnemius muscle samples. Levels of mMuRF1 and mAtrogin mRNA were measured by qRT-PCR in samples corresponding to groups collected after 1, 7, and 16 days post dose. Statistical analyses were performed using a two-way ANOVA.

    [0247] As shown in FIG. 6A, mFc-rhGDF15 induced body weight loss in ICR-SCID mice. Percent body weight was 79.4 percent when measured after 16 days following one dose of mFc-rhGDF15 (p<0.001). mFc-rhGDF15 also induced loss of fat (adipose tissue), as observed by the loss of gonadal fat (FIG. 6B; p<0.01 at day 7 and p<0.001 at day 16) and loss of muscle, as observed by the loss of gastrocnemius muscle (FIG. 6C; p<0.05 at days 1 and 3, and p<0.0001 at days 7 and 16). Administration of mFc-rhGDF15 also elevated gene expression of two enzymes associated with muscle degradation and cachexia, mMuRF1 (FIG. 6D; 6<0.001 at days 1, 7, and 16) and mAtrogin (FIG. 6E; p<0.001 at days 1 and 7, and p<0.01 at day 16).

    [0248] These results indicated that mFc-rhGDF15 induces cachexia in mice.

    Example 5: mFc-rhGDF15 Induces Cachexia with a Longer GDF15 Half-Life in Serum

    [0249] In this Example, the serum hGDF15 levels were measured following administration of mFc-rhGDF15, to determine the half-life of rhGDF15 in this model. Eight-week old female Balb/C nude mice were randomly divided into two groups of twelve mice each. Mice were dosed subcutaneously in the flank every twelve hours for three days (a total of six doses) with one of the following treatments: PBS (control) or mFc-rhGDF15 at 1.33 ?g/g. Body weight was measured daily. As shown in FIG. 7, mFc-rhGDF15 induced sustained body weight loss for at least one week after the final injection.

    [0250] In this experiment, hGDF15 serum levels were measured 0.2, 5, and 8 days after the last dose of mFc-rhGDF15. Mice were sacrificed at the indicated time, and sera were collected. Human GDF15 serum levels were determined by ELISA (R&D Systems, Cat. No. DY957E). Table 1 provides the serum levels (pg/mL) for each mouse in the study.

    TABLE-US-00007 TABLE 1 Days post Mouse Treatment Serum GDF15 last dose # Agent ?g/g (?g/mL); ELISA 0.2 1 mFc-rhGDF15 1.33 10.02 0.2 2 mFc-rhGDF15 1.33 9.54 0.2 3 mFc-rhGDF15 1.33 9.36 5 4 mFc-rhGDF15 1.33 8.24 5 5 mFc-rhGDF15 1.33 8.01 5 6 mFc-rhGDF15 1.33 6.59 8 7 mFc-rhGDF15 1.33 5.60 8 8 mFc-rhGDF15 1.33 5.52 8 9 mFc-rhGDF15 1.33 5.57

    [0251] The results in Table 1 reveal that strong, sustained levels of hGDF15 are present in the serum at least eight days after the last dose of mFc-rhGDF15.

    [0252] Serum samples from day 0.2 and day 5 after the last dose were also analyzed by Western blot (reducing gel; blot with an antibody against hGDF15 (R&D Systems, Cat. No AF957)) and quantified by Licor to determine the stability of mFc-rhGDF15 in the serum. Unexpectedly, two bands were observed. The upper band was approximately 40 kDa, and appeared to be mFc-rhGDF15. The lower band was approximately 15 kDa, and appeared to be cleaved mature rhGDF15. This indicated that mature rhGDF15 was released from mFc-rhGDF15 in the serum. Quantification of the two bands showed that about 90% of the rhGDF15 present in the serum was in the form of mFc-rhGDF15, with about 10% of the total rhGDF15 in the serum being present as the cleaved mature form (FIG. 8). Quantification showed a slight decrease in mFc-rhGDF15 in the serum samples collected five days after the last dose, but, surprisingly, a constant level of mature rhGDF15 remained in the serum. The ratio of mature rhGDF15 to mFc-rhGDF15 slightly increased over time, as a result of a decrease in mFc-rhGDF15 in the serum. Similar results were observed when rFc-rmGDF15 was injected into mice.

    [0253] The results presented in FIGS. 7-8 and Table 1 were unexpected. The expectation was that very little, if any, mature rhGDF15 would be cleaved (released) from the mFc-rhGDF15 by day 0.2, and that any cleaved rhGDF15 would be rapidly cleared from the serum, as had been previously observed. For example, in FIG. 4, a series of nine doses at 1 ?g/g per dose (for a total of 9 ?g/g) of cleaved-rhGDF15 was required to induce significant body weight loss in mice. These mice gained weight, almost immediately when dosing stopped. In contrast, a single dose of mFc-rhGDF15 at 0.1 ?g/g was sufficient to induce significant body weight loss for at least eight days (FIG. 9A; ten ICR-SCID mice dosed intrapertioneally with 0.1 ?g/g on day 1). The data in Table 1 revealed that rhGDF15 serum levels were stable for at least eight days, when rhGDF15 was administered as an mFc-rhGDF15 fusion protein.

    [0254] To determine the source of activity resulting in sustained body weight loss, we investigated whether the observed rhGDF15 activity was attributable to the mFc-rhGDF15 fusion protein, the released mature rhGDF15 form, or both. As shown in FIG. 9A, a low dose of mFc-rhGDF15 (0.1 ?g/g) resulted in body weight loss continuing for at least eight days. A lower dose of mFc-rhGDF15 (0.01 ?g/g) also induced body weight loss, but the effect was not sustained for longer than 3 days post dose.

    [0255] In this experiment, plasma was collected from three mice each dosed with 0.1 ?g/g or 0.01 ?g/g at 5 days post dose. Total rhGDF15 was measured by ELISA as described above. Total rhGDF15 plasma levels in the mice dosed with 0.1 ?g/g were above 70 ng/mL, consistent with the observation that these mice had significant weight loss (FIG. 9B). Total rhGDF15 plasma levels in mice dosed with 0.01 ?g/g were approximately 3.3 ng/mL, but it was observed that these mice were gaining weight (FIG. 9A and FIG. 9B). As described in FIG. 2, the threshold for hGDF15 to induce cachexia in tumor bearing mice is approximately 2 ng/mL. Thus, if both forms of rhGDF15 were active (i.e., mFc-rhGDF15 and released mature rhGDF15), then these mice should be losing weight, not gaining weight (i.e., 3.3 ng/mL total rhGDF15 is above the threshold of approximately 2 ng/mL hGDF15).

    [0256] To determine which form was the active form (i.e., either mFc-rhGDF15 or released mature rhGDF15), we considered the data from FIG. 8 which showed that approximately 90% of the total rhGDF15 in serum was in the mFc-rhGDF15 form, and the remaining 10% was the released mature form. Based on this extrapolation, approximately 3.0 ng/mL of rhGDF15 in the plasma was in the mFc-rhGDF15 form (i.e., 90% of 3.3 ng/mL). Once again, if mFc-rhGDF15 were active, these mice would be losing weight, not gaining weight because 3.3 ng/mL mFc-rhGDF15 is above the threshold of approximately 2 ng/mL hGDF15. The mice dosed with 0.1 ?g/g mFc-rhGDF15 served as an internal control, because these mice had sustained body weight loss indicating that at least one of the two forms must be active. A calculation of 10% of 70 ng/mL total rhGDF15 in these mice is 7 ng/mL released mature rhGDF15. This amount is consistent with inducing the observed body weight loss and the threshold observed in FIG. 2. Thus, the data indicate that the mFc-rhGDF15 is not an active form of the protein, and only the mature rhGDF15 is active. These results were unexpected, because: (a) there was no reason to predict that the Fc fusion protein (mFc-rhGDF15) would be inactive; and (b) there was no reason to predict that the Fc fusion protein would release mature rhGDF15 at the observed rate.

    [0257] These results indicate that mFc-rhGDF15 sustains a cachetic phenotype by slowly releasing mature rhGDF15 into the serum. These results further indicate that a steady state level of mature rhGDF15 in the plasma or serum can be achieved in a non-tumor bearing mouse by administering mFc-rhGDF15 to the mouse. Therefore, administration of mFc-rhGDF15 to non-tumor bearing mice is particularly useful as a mouse model of cachexia with a robust and sustained loss of muscle mass, loss of fat mass, and body weight loss (see FIGS. 6A-C).

    Example 6: Anti-GDF15 Antibodies

    [0258] This Example describes the production of anti-GDF15 monoclonal antibodies. Immunizations, fusions, and primary screens were conducted using conventional methods following the Repetitive Immunization Multiple Sites (RIMMS) protocol. Five AJ mice and five Balb/c mice were immunized with 6?His (SEQ ID NO: 266) tagged recombinant human GDF15 (His-rhGDF15) (R&D Systems, Inc., Minneapolis, MN). Two Balb/c mice with sera displaying the highest anti-GDF15 activity by Enzyme Linked Immunosorbent Assay (ELISA) were chosen for subsequent fusion. Spleens and lymph nodes from the appropriate mice were harvested. B-cells were harvested and fused with a myeloma line. Fusion products were serially diluted onto forty 96-well plates to near clonality. Two AJ mice with sera displaying the highest anti-GDF15 activity by ELISA were chosen for subsequent fusion. Spleens and lymph nodes from the appropriate mice were harvested. B-cells were harvested and fused with a myeloma line. Fusion products were serially diluted onto forty 96-well plates to near clonality.

    [0259] Approximately 3,840 supernatants from the cell fusions were screened by ELISA for binding to rhGDF15. A total of 172 supernatants containing antibodies against GDF15 were further characterized in vitro. A panel of hybridomas was selected, subcloned and expanded. Antibodies were expressed and subsequently purified by affinity chromatography on Protein G resin, under standard conditions.

    Example 7: Antibody Sequence Analysis

    [0260] The light chain isotype and heavy chain isotype of each monoclonal antibody in Example 6 was determined using the IsoStrip? Mouse Monoclonal Antibody Isotyping Kit according the kit vendor's instructions (Roche Applied Science, Indianapolis, IN). All antibodies were found to be kappa light chain, and IgG1 or IgG2b heavy chain.

    [0261] The heavy and light chain variable regions of the mouse monoclonal antibodies were sequenced using 5 RACE (Rapid Amplification of cDNA Ends). Total RNA was extracted from each monoclonal hybridoma cell line using the RNeasy? Miniprep kit according to the kit vendor's instructions (Qiagen, Valencia, CA). Full-length first strand cDNA containing 5 ends was generated using the SMARTer? RACE cDNA Amplification Kit (Clontech, Mountain View, CA) according to the kit vendor's instructions for 5 RACE.

    [0262] The variable regions of the light (kappa) and heavy (IgGlor IgG2b) chains were amplified by PCR using KOD Hot Start Polymerase (EMD Chemicals, Gibbstown, NJ) according to the kit vendor's instructions. For amplification of 5 cDNA ends in conjunction with the SMARTer M RACE cDNA Amplification Kit, the Universal Primer Mix A primer (Clontech), a mix of: 5 CTAATACGACTCACTATAGGGCAAGCAGTGGTATCAACGCAGAGT 3 (SEQ ID NO:233) and 5 CTAATACGACTCACTATAGGGC 3 (SEQ ID NO:225), was used as a 5 primer. Heavy chain variable regions were amplified using the above 5 primers and a 3 IgG1 constant region specific primer, 5 TATGCAAGGCTTACAACCACA 3 (SEQ ID NO:226), or a 3 IgG2b constant region specific primer, 5 AGGACAGGGGTTGATTGTTGA 3 (SEQ ID NO:227). Kappa chain variable regions were first amplified with the above 5 primers and a 3 kappa constant region specific primer, 5 CTCATTCCTGTTGAAGCTCTTGACAAT 3 (SEQ ID NO:228). The light chains were subjected to a second, nested, round of PCR using the Nested Universal Primer A (Clontech) 5 primer, 5 AAGCAGTGGTATCAACGCAGAGT 3 (SEQ ID NO:229) and a nested 3 kappa constant region specific primer, 5 CGACTGAGGCACCTCCAGATGTT 3 (SEQ ID NO:230). Individual PCR products were either purified using the Qiaquick? PCR Purification kit or isolated by agarose gel electrophoresis and purified using the Qiaquick? Gel Purification kit according to the kit vendor's instructions (Qiagen). The PCR products were subsequently cloned into the pCR?4Blunt plasmid using the Zero Blunt? TOPO? PCR Cloning according to the kit vendor's instructions (Invitrogen) and transformed into DH5-? bacteria (Invitrogen) through standard molecular biology techniques. Plasmid DNA isolated from transformed bacterial clones was sequenced using M13 Forward (5 GTAAAACGACGGCCAGT 3) (SEQ ID NO:231) and M13 Reverse primers (5 CAGGAAACAGCTATGACC 3) (SEQ ID NO:232) by Beckman Genomics (Danvers, MA), using standard dideoxy DNA sequencing methods to identify the sequence of the variable region sequences. The sequences were analyzed using Vector NTI software (Invitrogen) and the IMGT/V-Quest web server (imgt.cines.fr) to identify and confirm variable region sequences.

    [0263] The nucleic acid sequences encoding and the protein sequences defining variable regions of the murine monoclonal antibodies are shown below (amino terminal signal peptide sequences are not shown). CDR sequences (Kabat definition) are indicated by bold font and underlining in the amino acid sequences.

    [0264] Nucleic Acid Sequence Encoding the Heavy Chain Variable Region of the 01G06 Antibody (SEQ ID NO:39)

    TABLE-US-00008 1 gaggtcctgctgcaacagtctggacctgagctggtgaagcctggggcttcagtgaagata 61 ccctgcaaggcttctggatacacattcactgactacaacatggactgggtgaagcagagc 121 catggaaagagccttgagtggattggacaaattaatcctaacaatggtggtattttcttc 181 aaccagaagttcaagggcaaggccacattgactgtagacaagtcctccaatacagccttc 241 atggaggtccgcagcctgacatctgaggacactgcagtctattactgtgcaagagaggca 301 attactacggtaggcgctatggactactggggtcaaggaacctcagtcaccgtctcctca

    [0265] Protein Sequence Defining the Heavy Chain Variable Region of the 01G06 Antibody (SEQ ID NO:40)

    TABLE-US-00009 1 evllqqsgpelvkpgasvkipckasgytftdynmdwvkqshgkslewigqinpnnggiff 61 nqkfkgkatltvdkssntafmevrsltsedtavyycareaittvgamdywgqgtsvtvss

    [0266] Nucleic Acid Sequence Encoding the Kappa Chain Variable Region of the 01G06 Antibody (SEQ ID NO:75)

    TABLE-US-00010 1 gacatccagatgactcagtctccagcctccctatctgcatctgtgggagaaactgtcacc 61 atcacatgtcgaacaagtgagaatcttcacaattatttagcatggtatcagcagaaacag 121 ggaaaatctcctcagctcctggtctatgatgcaaaaaccttagcagatggtgtgccatca 181 aggttcagtggcagtggatcaggaacacaatattctctcaagatcaacagcctgcagcct 241 gaagattttgggagttattactgtcaacatttttggagtagtccttacacgttcggaggg 301 gggaccaagctggaaataaaa

    [0267] Protein Sequence Defining the Kappa Chain Variable Region of the 01G06 Antibody (SEQ ID NO:76)

    TABLE-US-00011 1 diqmtqspaslsasvgetvtitcrtsenlhnylawyqqkqgkspqllvydaktladgvps 61 rfsgsgsgtqyslkinslqpedfgsyycqhfwsspytfgggtkleik

    [0268] Nucleic Acid Sequence Encoding the Heavy Chain Variable Region of the 03G05 Antibody (SEQ ID NO:41)

    TABLE-US-00012 1 caggtccaactgcagcagcctggggctgaactggtgaagcctggggcttcagtgaagctg 61 tcctgcaaggcttctggctacaccttcaccagctactggattcactgggtgaaccagagg 121 cctggacaaggccttgagtggattggagacattaatcctagcaacggccgtagtaagtat 181 aatgagaagttcaagaacaaggccacaatgactgcagacaaatcctccaacacagcctac 241 atgcaactcagcagcctgacatctgaggactctgcggtctattactgtgcaagagaggtt 301 ctggatggtgctatggactactggggtcaaggaacctcagtcaccgtctcctca

    [0269] Protein Sequence Defining the Heavy Chain Variable Region of the 03G05 Antibody (SEQ ID NO:42)

    TABLE-US-00013 1 qvqlqqpgaelvkpgasvklsckasgytftsywihwvnqrpgqglewigdinpsngrsky 61 nekfknkatmtadkssntaymqlssltsedsavyycarevldgamdywgqgtsvtvss

    [0270] Nucleic Acid Sequence Encoding the Kappa Chain Variable Region of the 03G05 Antibody (SEQ ID NO:77)

    TABLE-US-00014 1 gacattgtgttgacccaatctccagcttctttggctgtgtctctagggcagagggccacc 61 atctcctgcagagccagcgaaagtgttgataattatggcattagttttatgaactggttc 121 caacagaaaccaggacagccacccaaactcctcatctatgctgcatccaaccaaggctcc 181 ggggtccctgccaggtttagtggcagtgggtctgggacagacttcagcctcaacatccat 241 cctatggaggaggatgatactgcaatgtatttctgtcagcaaagtaaggaggttccgtgg 301 acgttcggtggaggctccaagctggaaatcaaa

    [0271] Protein Sequence Defining the Kappa Chain Variable Region of the 03G05 Antibody (SEQ ID NO:78)

    TABLE-US-00015 1 divltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppklliyaasnqgs 61 gvparfsgsgsgtdfslnihpmeeddtamyfcqqskevpwtfgggskleik

    [0272] Nucleic Acid Sequence Encoding the Heavy Chain Variable Region of the 04F08 Antibody (SEQ ID NO:43)

    TABLE-US-00016 1 caggttactctgaaagagtctggccctgggatattgcagccctcccagaccctcagtctg 61 acttgttctttctctgggttttcactgagcacttatggtatgggtgtgacctggattcgt 121 cagccttcaggaaagggtctggagtggctggcacacatttactgggatgatgacaagcgc 181 tataacccatccctgaagagccggctcacaatctccaaggatacctccaacaaccaggta 241 ttcctcaagatcaccagtgtggacactgcagatactgccacatactactgtgctcaaacg 301 gggtatagtaacttgtttgcttactggggccaagggactctggtcactgtctctgca

    [0273] Protein Sequence Defining the Heavy Chain Variable Region of the 04F08 Antibody (SEQ ID NO:44)

    TABLE-US-00017 1 qvtlkesgpgilqpsqtlsltcsfsgfslstygmgvtwirqpsgkglewlahiywdddkr 61 ynpslksrltiskdtsnnqvflkitsvdtadtatyycaqtgysnlfaywgqgtlvtvsa

    [0274] Nucleic Acid Sequence Encoding the Kappa Chain Variable Region of the 04F08 Antibody (SEQ ID NO:79)

    TABLE-US-00018 1 gacattgtgatgacccagtctcaaaaattcatgtccacatcagtaggagacagggtcagc 61 gtcacctgcaaggccagtcagaatgtgggtactaatgtagcctggtatcaacagaaatta 121 ggacaatctcctaaaacactgatttactcggcatcctaccggtacagtggagtccctgat 181 cgcttcacaggcagtggatctgggacagatttcactctcaccatcagcaatgtgcagtct 241 gaagacttggcagagtatttctgtcagcaatataacagctatccgtacacgttcggaggg 301 gggaccaagctggaaataaaa

    [0275] Protein Sequence Defining the Kappa Chain Variable Region of the 04F08 Antibody (SEQ ID NO:80)

    TABLE-US-00019 1 divmtqsqkfmstsvgdrvsvtckasqnvgtnvawyqqklgqspktliysasyrysgvpd 61 rftgsgsgtdftltisnvqsedlaeyfcqqynsypytfgggtkleik

    [0276] Nucleic Acid Sequence Encoding the Heavy Chain Variable Region of the 06C11 Antibody (SEQ ID NO:45)

    TABLE-US-00020 1 caggttactctgaaagagtctggccctgggatattgcagccctcccagaccctcagtctg 61 acttgttctttctctgggttttcactgaacacttatggtatgggtgtgagctggattcgt 121 cagccttcaggaaagggtctggagtggctggcacacatttactgggatgatgacaagcgc 181 tataacccatccctgaagagccggctcacaatctccaaggatgcctccaacaaccgggtc 241 ttcctcaagatcaccagtgtggacactgcagatactgccacatactactgtgctcaaaga 301 ggttatgatgattactggggttactggggccaagggactctggtcactatctctgca

    [0277] Protein Sequence Defining the Heavy Chain Variable Region of the 06C11 Antibody (SEQ ID NO:46)

    TABLE-US-00021 1 qvtlkesgpgilqpsqtlsltcsfsgfslntygmgvswirqpsgkglewlahiywdddkr 61 ynpslksrltiskdasnnrvflkitsvdtadtatyycaqrgyddywgywgqgtlvtisa

    [0278] Nucleic Acid Sequence Encoding the Kappa Chain Variable Region of the 06C11 Antibody (SEQ ID NO:81)

    TABLE-US-00022 1 gacattgtgatgacccagtctcaaaaattcatgtccacatcagtaggagacagggtcagc 61 gtcacctgcaaggccagtcagaatgtgggtactaatgtagcctggtttcaacagaaacca 121 ggtcaatctcctaaagcactgatttactcggcatcttaccggtacagtggagtccctgat 181 cgcttcacaggcagtggatctgggacagatttcattctcaccatcagcaatgtgcagtct 241 gaagacctggcagagtatttctgtcagcaatataacaactatcctctcacgttcggtgct 301 gggaccaagctggagctgaaa

    [0279] Protein Sequence Defining the Kappa Chain Variable Region of the 06C11 Antibody (SEQ ID NO:82)

    TABLE-US-00023 1 divmtqsqkfmstsvgdrvsvtckasqnvgtnvawfqqkpgqspkaliysasyrysgvpd 61 rftgsgsgtdfiltisnvqsedlaeyfcqqynnypltfgagtklelk

    [0280] Nucleic Acid Sequence Encoding the Heavy Chain Variable Region of the 08G01 Antibody (SEQ ID NO:47)

    TABLE-US-00024 1 gaggtcctgctgcaacagtctggacctgaggtggtgaagcctggggcttcagtgaagata 61 ccctgcaaggcttctggatacacattcactgactacaacatggactgggtgaagcagagc 121 catggaaagagccttgagtggattggagagattaatcctaacaatggtggtactttctac 181 aaccagaagttcaagggcaaggccacattgactgtagacaagtcctccagcacagcctac 241 atggagctccgcagcctgacatctgaggacactgcagtctattactgtgcaagagaggca 301 attactacggtaggcgctatggactactggggtcaaggaacctcagtcaccgtctcctca [0281] 241 atggagctcc gcagcctgac atctgaggac actgcagtct attactgtgc aagagaggca [0282] 301 attactacgg taggcgctat ggactactgg ggtcaaggaa cctcagtcac cgtctcctca

    [0283] Protein Sequence Defining the Heavy Chain Variable Region of the 08G01 Antibody (SEQ ID NO:48)

    TABLE-US-00025 1 evllqqsgpevvkpgasvkipckasgytftdynmdwvkqshgkslewigeinpnnggtfy 61 nqkfkgkatltvdkssstaymelrsltsedtavyycareaittvgamdywgqgtsvtvss

    [0284] Nucleic Acid Sequence Encoding the Kappa Chain Variable Region of the 08G01 Antibody (SEQ ID NO:83)

    TABLE-US-00026 1 gacatccagatgactcagtctccagcctccctatctgcatctgtgggagaaactgtcacc 61 atcacatgtcgagcaagtgggaatattcacaattatttagcatggtatcagcagaaacag 121 ggaaaatctcctcagctcctggtctataatgcaaaaaccttagcagatggtgtgccatca 181 aggttcagtggcagtggatcaggaacacaatattctctcaagatcaacagcctgcagcct 241 gaagattttgggagttattactgtcaacatttttggagttctccttacacgttcggaggg 301 gggaccaagctggaaataaaa

    [0285] Protein Sequence Defining the Kappa Chain Variable Region of the 08G01 Antibody (SEQ ID NO:84)

    TABLE-US-00027 1 diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps 61 rfsgsgsgtqyslkinslqpedfgsyycqhfwsspytfgggtkleik

    [0286] Nucleic Acid Sequence Encoding the Heavy Chain Variable Region of the 14F11 Antibody (SEQ ID NO:49)

    TABLE-US-00028 1 caggttactctgaaagagtctggccctggaatattgcagccctcccagaccctcagtctg 61 acttgttctttctctgggttttcactgagcacttatggtatgggtgtaggctggattcgt 121 cagccttcaggaaagggtctagagtggctggcagacatttggtgggatgacgataagtac 181 tataacccatccctgaagagccggctcacaatctccaaggatacctccagcaatgaggta 241 ttcctcaagatcgccattgtggacactgcagatactgccacttactactgtgctcgaaga 301 ggtcactactctgctatggactactggggtcaaggaacctcagtcaccgtctcctca

    [0287] Protein Sequence Defining the Heavy Chain Variable Region of the 14F11 Antibody (SEQ ID NO:50)

    TABLE-US-00029 1 qvtlkesgpgilqpsqtlsltcsfsgfslstygmgvgwirqpsgkglewladiwwdddky 61 ynpslksrltiskdtssnevflkiaivdtadtatyycarrghysamdywgqgtsvtvss

    [0288] Nucleic Acid Sequence Encoding the Kappa Chain Variable Region of the 14F11 Antibody (SEQ ID NO:85)

    TABLE-US-00030 1 gacattgtaatgacccagtctcaaaaattcatgtccacatcagtaggagacagggtcagc 61 gtcacctgcaaggccagtcagaatgtgggtactaatgtagcctggtatcaacagaaacca 121 gggcaatctcctaaagcactgatttactcgccatcctaccggtacagtggagtccctgat 181 cgcttcacaggcagtggatctgggacagatttcactctcaccatcagcaatgtgcagtct 241 gaagacttggcagaatatttctgtcagcaatataacagctatcctcacacgttcggaggg 301 gggaccaagctggaaatgaaa

    [0289] Protein Sequence Defining the Kappa Chain Variable Region of the 14F11 Antibody (SEQ ID NO:86)

    TABLE-US-00031 1 divmtqsqkfmstsvgdrvsvtckasqnvgtnvawyqqkpgqspkaliyspsyrysgvpd 61 rftgsgsgtdftltisnvqsedlaeyfcqqynsyphtfgggtklemk

    [0290] Nucleic Acid Sequence Encoding the Heavy Chain Variable Region of the 17B11 Antibody (SEQ ID NO:51)

    TABLE-US-00032 1 caggttactctgaaagagtctggccctgggatattgcagccctcccagaccctcagtctg 61 acttgttctttctctgggttttcactgagcacttctggtatgggtgtgagttggattcgt 121 cagccttcaggaaagggtctggagtggctggcacacaatgactgggatgatgacaagcgc 181 tataagtcatccctgaagagccggctcacaatatccaaggatacctccagaaaccaggta 241 ttcctcaagatcaccagtgtggacactgcagatactgccacatactactgtgctcgaaga 301 gttgggggattagagggctattttgattactggggccaaggcaccactctcacagtctcc 361 tca

    [0291] Protein Sequence Defining the Heavy Chain Variable Region of the 17B11 Antibody (SEQ ID NO:52)

    TABLE-US-00033 1 qvtlkesgpgilqpsqtlsltcsfsgfslstsgmgvswirqpsgkglewlahndwdddkr 61 yksslksrltiskdtsrnqvflkitsvdtadtatyycarrvgglegyfdywgqgttltvs 121 s

    [0292] Nucleic Acid Sequence Encoding the Kappa Chain Variable Region of the 17B11 Antibody (SEQ ID NO:87)

    TABLE-US-00034 1 gacattgtgctgacacagtctcctgcttccttagctgtatctctggggcagagggccacc 61 atctcatgcagggccagccaaagtgtcagtacatctaggtttagttatatgcactggttc 121 caacagaaaccaggacaggcacccaaactcctcatcaagtatgcatccaacctagaatct 181 ggggtccctgccaggttcagtggcagtgggtctgggacagacttcaccctcaacatccat 241 cctgtggagggggaggatactgcaacatattactgtcagcacagttgggagattccgtac 301 acgttcggaggggggaccaagctggaaataaaa

    [0293] Protein Sequence Defining the Kappa Chain Variable Region of the 17B11 Antibody (SEQ ID NO:88)

    TABLE-US-00035 1 divltqspaslayslgqratiscrasqsvstsrfsymhwfqqkpgqapkllikyasnles 61 gvparfsgsgsgtdftlnihpvegedtatyycqhsweipytfgggtkleik

    [0294] The amino acid sequences defining the immunoglobulin heavy chain variable regions for the antibodies produced in Example 6 are aligned in FIG. 10. Amino terminal signal peptide sequences (for expression/secretion) are not shown. CDR.sub.1, CDR.sub.2, and CDR.sub.3 (Kabat definition) are identified by boxes. FIG. 11 shows an alignment of the separate CDR.sub.1, CDR.sub.2, and CDR.sub.3 sequences for each antibody.

    [0295] The amino acid sequences defining the immunoglobulin light chain variable regions of the antibodies in Example 6 are aligned in FIG. 12. Amino terminal signal peptide sequences (for expression/secretion) are not shown. CDR.sub.1, CDR.sub.2 and CDR.sub.3 are identified by boxes. FIG. 13 shows an alignment of the separate CDR.sub.1, CDR.sub.2, and CDR.sub.3 sequences for each antibody.

    [0296] Table 2 shows the SEQ ID NO. of each sequence discussed in this Example.

    TABLE-US-00036 TABLE 2 SEQ. ID NO. Nucleic Acid or Protein 39 01G06 Heavy Chain Variable Region-nucleic acid 40 01G06 Heavy Chain Variable Region-protein 75 01G06 Light (kappa) Chain Variable Region-nucleic acid 76 01G06 Light (kappa) Chain Variable Region-protein 1 01G06 Heavy Chain CDR.sub.1 7 01G06 Heavy Chain CDR.sub.2 15 01G06 Heavy Chain CDR.sub.3 21 01G06 Light (kappa) Chain CDR.sub.1 26 01G06 Light (kappa) Chain CDR.sub.2 32 01G06 Light (kappa) Chain CDR.sub.3 41 03G05 Heavy Chain Variable Region-nucleic acid 42 03G05 Heavy Chain Variable Region-protein 77 03G05 Light (kappa) Chain Variable Region-nucleic acid 78 03G05 Light (kappa) Chain Variable Region-protein 2 03G05 Heavy Chain CDR.sub.1 8 03G05 Heavy Chain CDR.sub.2 16 03G05 Heavy Chain CDR.sub.3 22 03G05 Light (kappa) Chain CDR.sub.1 27 03G05 Light (kappa) Chain CDR.sub.2 33 03G05 Light (kappa) Chain CDR.sub.3 43 04F08 Heavy Chain Variable Region-nucleic acid 44 04F08 Heavy Chain Variable Region-protein 79 04F08 Light (kappa) Chain Variable Region-nucleic acid 80 04F08 Light (kappa) Chain Variable Region-protein 3 04F08 Heavy Chain CDR.sub.1 9 04F08 Heavy Chain CDR.sub.2 17 04F08 Heavy Chain CDR.sub.3 23 04F08 Light (kappa) Chain CDR.sub.1 28 04F08 Light (kappa) Chain CDR.sub.2 34 04F08 Light (kappa) Chain CDR.sub.3 45 06C11 Heavy Chain Variable Region-nucleic acid 46 06C11 Heavy Chain Variable Region-protein 81 06C11 Light (kappa) Chain Variable Region-nucleic acid 82 06C11 Light (kappa) Chain Variable Region-protein 4 06C11 Heavy Chain CDR.sub.1 9 06C11 Heavy Chain CDR.sub.2 18 06C11 Heavy Chain CDR.sub.3 23 06C11 Light (kappa) Chain CDR.sub.1 28 06C11 Light (kappa) Chain CDR.sub.2 35 06C11 Light (kappa) Chain CDR.sub.3 47 08G01 Heavy Chain Variable Region-nucleic acid 48 08G01 Heavy Chain Variable Region-protein 83 08G01 Light (kappa) Chain Variable Region-nucleic acid 84 08G01 Light (kappa) Chain Variable Region-protein 1 08G01 Heavy Chain CDR.sub.1 10 08G01 Heavy Chain CDR.sub.2 15 08G01 Heavy Chain CDR.sub.3 24 08G01 Light (kappa) Chain CDR.sub.1 29 08G01 Light (kappa) Chain CDR.sub.2 32 08G01 Light (kappa) Chain CDR.sub.3 49 14F11 Heavy Chain Variable Region-nucleic acid 50 14F11 Heavy Chain Variable Region-protein 85 14F11 Light (kappa) Chain Variable Region-nucleic acid 86 14F11 Light (kappa) Chain Variable Region-protein 5 14F11 Heavy Chain CDR.sub.1 11 14F11 Heavy Chain CDR.sub.2 19 14F11 Heavy Chain CDR.sub.3 23 14F11 Light (kappa) Chain CDR.sub.1 30 14F11 Light (kappa) Chain CDR.sub.2 36 14F11 Light (kappa) Chain CDR.sub.3 51 17B11 Heavy Chain Variable Region-nucleic acid 52 17B11 Heavy Chain Variable Region-protein 87 17B11 Light (kappa) Chain Variable Region-nucleic acid 88 17B11 Light (kappa) Chain Variable Region-protein 6 17B11 Heavy Chain CDR.sub.1 12 17B11 Heavy Chain CDR.sub.2 20 17B11 Heavy Chain CDR.sub.3 25 17B11 Light (kappa) Chain CDR.sub.1 31 17B11 Light (kappa) Chain CDR.sub.2 37 17B11 Light (kappa) Chain CDR.sub.3

    [0297] Mouse monoclonal antibody heavy chain CDR sequences (Kabat, Chothia, and IMGT definitions) are shown in Table 3.

    TABLE-US-00037 TABLE3 Kabat VariableRegion CDR1 CDR2 CDR3 SEQIDNO 01G06 DYNMD QINPNNGGIFFNQKFKG EAITTVGAMDY 40 (SEQIDNO:1) (SEQIDNO:7) (SEQIDNO:15) 03G05 SYWIH DINPSNGRSKYNEKFKN EVLDGAMDY 42 (SEQIDNO:2) (SEQIDNO:8) (SEQIDNO:16) 04F08 TYGMGVT HIYWDDDKRYNPSLKS TGYSNLFAY 44 (SEQIDNO:3) (SEQIDNO:9) (SEQIDNO:17) 06C11 TYGMGVS HIYWDDDKRYNPSLKS RGYDDYWGY 46 (SEQIDNO:4) (SEQIDNO:9) (SEQIDNO:18) 08G01 DYNMD EINPNNGGTFYNQKFKG EAITTVGAMDY 48 (SEQIDNO:1) (SEQIDNO:10) (SEQIDNO:15) 14F11 TYGMGVG DIWWDDDKYYNPSLKS RGHYSAMDY 50 (SEQIDNO:5) (SEQIDNO:11) (SEQIDNO:19) 17B11 TSGMGVS HNDWDDDKRYKSSLKS RVGGLEGYFDY 52 (SEQIDNO:6) (SEQIDNO:12) (SEQIDNO:20) Chothia VariableRegion CDR1 CDR2 CDR3 SEQIDNO 01G06 GYTFTDY NPNNGG EAITTVGAMDY 40 (SEQIDNO:38) (SEQIDNO:143) (SEQIDNO:15) 03G05 GYTFTSY NPSNGR EVLDGAMDY 42 (SEQIDNO:128) (SEQIDNO:144) (SEQIDNO:16) 04F08 GFSLSTYGM YWDDD TGYSNLFAY 44 (SEQIDNO:130) (SEQIDNO:145) (SEQIDNO:17) 06C11 GFSLNTYGM YWDDD RGYDDYWGY 46 (SEQIDNO:132) (SEQIDNO:145) (SEQIDNO:18) 08G01 GYTFTDY NPNNGG EAITTVGAMDY 48 (SEQIDNO:38) (SEQIDNO:143) (SEQIDNO:15) 14F11 GFSLSTYGM WWDDD RGHYSAMDY 50 (SEQIDNO:130) (SEQIDNO:146) (SEQIDNO:19) 17B11 GFSLSTSGM DWDDD RVGGLEGYFDY 52 (SEQIDNO:134) (SEQIDNO:147) (SEQIDNO:20) IMGT VariableRegion CDR1 CDR2 CDR3 SEQIDNO 01G06 GYTFTDYN INPNNGGI AREAITTVGAMDY 40 (SEQIDNO:136) (SEQIDNO:148) (SEQIDNO:154) 03G05 GYTFTSYW INPSNGRS AREVLDGAMDY 42 (SEQIDNO:138) (SEQIDNO:149) (SEQIDNO:155) 04F08 GFSLSTYGMG IYWDDDK AQTGYSNLFAY 44 (SEQIDNO:140) (SEQIDNO:150) (SEQIDNO:156) 06C11 GFSLNTYGMG IYWDDDK AQRGYDDYWGY 46 (SEQIDNO:141) (SEQIDNO:150) (SEQIDNO:157) 08G01 GYTFTDYN INPNNGGT AREAITTVGAMDY 48 (SEQIDNO:136) (SEQIDNO:151) (SEQIDNO:154) 14F11 GFSLSTYGMG IWWDDDK ARRGHYSAMDY 50 (SEQIDNO:140) (SEQIDNO:152) (SEQIDNO:158) 17B11 GFSLSTSGMG NDWDDDK ARRVGGLEGYFDY 52 (SEQIDNO:142) (SEQIDNO:153) (SEQIDNO:159)

    [0298] Mouse monoclonal antibody Kappa light chain CDR sequences (Kabat, Chothia, and IMGT definitions) are shown in Table 4.

    TABLE-US-00038 TABLE4 Kabat/Chothia VariableRegion CDR1 CDR2 CDR3 SEQIDNO 01G06 RTSENLHNYLA DAKTLAD QHFWSSPYT 76 (SEQIDNO:21) (SEQIDNO:26) (SEQIDNO:32) 03G05 RASESVDNYGISFMN AASNQGS QQSKEVPWT 78 (SEQIDNO:22) (SEQIDNO:27) (SEQIDNO:33) 04F08 KASQNVGTNVA SASYRYS QQYNSYPYT 80 (SEQIDNO:23) (SEQIDNO:28) (SEQIDNO:34) 06C11 KASQNVGTNVA SASYRYS QQYNNYPLT 82 (SEQIDNO:23) (SEQIDNO:28) (SEQIDNO:35) 08G01 RASGNIHNYLA NAKTLAD QHFWSSPYT 84 (SEQIDNO:24) (SEQIDNO:29) (SEQIDNO:32) 14F11 KASQNVGTNVA SPSYRYS QQYNSYPHT 86 (SEQIDNO:23) (SEQIDNO:30) (SEQIDNO:36) 17B11 RASQSVSTSRFSYMH YASNLES QHSWEIPYT 88 (SEQIDNO:25) (SEQIDNO:31) (SEQIDNO:37) IMGT VariableRegion CDR1 CDR2 CDR3 SEQIDNO 01G06 ENLHNY DAK QHFWSSPYT 76 (SEQIDNO:160) (SEQIDNO:32) 03G05 ESVDNYGISF AAS QQSKEVPWT 78 (SEQIDNO:161) (SEQIDNO:33) 04F08 QNVGTN SAS QQYNSYPYT 80 (SEQIDNO:162) (SEQIDNO:34) 06C11 QNVGTN SAS QQYNNYPLT 82 (SEQIDNO:162) (SEQIDNO:35) 08G01 GNIHNY NAK QHFWSSPYT 84 (SEQIDNO:163) (SEQIDNO:32) 14F11 QNVGTN SPS QQYNSYPHT 86 (SEQIDNO:162) (SEQIDNO:36) 17B11 QSVSTSRFSY YAS QHSWEIPYT 88 (SEQIDNO:164) (SEQIDNO:37)

    [0299] To create the complete heavy or kappa chain antibody sequences, each variable sequence above is combined with its respective constant region. For example, a complete heavy chain comprises a heavy variable sequence followed by the murine IgG1 or IgG2b heavy chain constant sequence, and a complete kappa chain comprises a kappa variable sequence followed by the murine kappa light chain constant sequence.

    [0300] Nucleic Acid Sequence Encoding the Murine IgG1 Heavy Chain Constant Region (SEQ ID NO: 165)

    TABLE-US-00039 1 gccaaaacgacacccccatctgtctatccactggcccctggatctgctgcccaaactaac 61 tccatggtgaccctgggatgcctggtcaagggctatttccctgagccagtgacagtgacc 121 tggaactctggatccctgtccagcggtgtgcacaccttcccagctgtcctgcagtctgac 181 ctctacactctgagcagctcagtgactgtcccctccagcacctggcccagcgagaccgtc 241 acctgcaacgttgcccacccggccagcagcaccaaggtggacaagaaaattgtgcccagg 301 gattgtggttgtaagccttgcatatgtacagtcccagaagtatcatctgtcttcatcttc 361 cccccaaagcccaaggatgtgctcaccattactctgactcctaaggtcacgtgtgttgtg 421 gtagacatcagcaaggatgatcccgaggtccagttcagctggtttgtagatgatgtggag 481 gtgcacacagctcagacgcaaccccgggaggagcagttcaacagcactttccgctcagtc 541 agtgaacttcccatcatgcaccaggactggctcaatggcaaggagttcaaatgcagggtc 601 aacagtgcagctttccctgcccccatcgagaaaaccatctccaaaaccaaaggcagaccg 661 aaggctccacaggtgtacaccattccacctcccaaggagcagatggccaaggataaagtc 721 agtctgacctgcatgataacagacttcttccctgaagacattactgtggagtggcagtgg 781 aatgggcagccagcggagaactacaagaacactcagcccatcatggacacagatggctct 841 tacttcgtctacagcaagctcaatgtgcagaagagcaactgggaggcaggaaatactttc 901 acctgctctgtgttacatgagggcctgcacaaccaccatactgagaagagcctctcccac 961 tctcctggtaaa

    [0301] Protein Sequence Defining the Murine IgG1 Heavy Chain Constant Region (SEQ ID NO:166)

    TABLE-US-00040 1 akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd 61 lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcgckpcictvpevssvfif 121 ppkpkdvltitltpkvtcvvvdiskddpevqfswfvddvevhtaqtqpreeqfnstfrsv 181 selpimhqdwlngkefkcrvnsaafpapiektisktkgrpkapqvytipppkeqmakdkv 241 sltcmitdffpeditvewqwngqpaenykntqpimdtdgsyfvysklnvqksnweagntf 301 tcsvlheglhnhhtekslshspgk

    [0302] Nucleic Acid Sequence Encoding the Murine IgG2b Heavy Chain Constant Region (SEQ ID NO:167)

    TABLE-US-00041 1 gccaaaacaacacccccatcagtctatccactggcccctgggtgtggagatacaactggt 61 tcctccgtgactctgggatgcctggtcaagggctacttccctgagtcagtgactgtgact 121 tggaactctggatccctgtccagcagtgtgcacaccttcccagctctcctgcagtctgga 181 ctctacactatgagcagctcagtgactgtcccctccagcacctggccaagtcagaccgtc 241 acctgcagcgttgctcacccagccagcagcaccacggtggacaaaaaacttgagcccagc 301 gggcccatttcaacaatcaacccctgtcctccatgcaaggagtgtcacaaatgcccagct 361 cctaacctcgagggtggaccatccgtcttcatcttccctccaaatatcaaggatgtactc 421 atgatctccctgacacccaaggtcacgtgtgtggtggtggatgtgagcgaggatgaccca 481 gacgtccagatcagctggtttgtgaacaacgtggaagtacacacagctcagacacaaacc 541 catagagaggattacaacagtactatccgggtggtcagcaccctccccatccagcaccag 601 gactggatgagtggcaaggagttcaaatgcaaggtcaacaacaaagacctcccatcaccc 661 atcgagagaaccatctcaaaaattaaagggctagtcagagctccacaagtatacatcttg 721 ccgccaccagcagagcagttgtccaggaaagatgtcagtctcacttgcctggtcgtgggc 781 ttcaaccctggagacatcagtgtggagtggaccagcaatgggcatacagaggagaactac 841 aaggacaccgcaccagtcctagactctgacggttcttacttcatatatagcaagctcaat 901 atgaaaacaagcaagtgggagaaaacagattccttctcatgcaacgtgagacacgagggt 961 ctgaaaaattactacctgaagaagaccatctcccggtctccgggtaaa

    [0303] Protein Sequence Defining the Murine IgG2b Heavy Chain Constant Region (SEQ ID NO:168)

    TABLE-US-00042 1 akttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsg 61 lytmsssvtvpsstwpsqtvtcsvahpassttvdkklepsgpistinpcppckechkcpa 121 pnleggpsvfifppnikdvlmisltpkvtcvvvdvseddpdvqiswfvnnvevhtaqtqt 181 hredynstirvvstlpiqhqdwmsgkefkckvnnkdlpspiertiskikglvrapqvyil 241 pppaeqlsrkdvsltclvvgfnpgdisvewtsnghteenykdtapvldsdgsyfiyskln 301 mktskwektdsfscnvrheglknyylkktisrspgk

    [0304] Nucleic Acid Sequence Encoding the Murine Kappa Light Chain Constant Region (SEQ ID NO:169)

    TABLE-US-00043 1 cgggctgatgctgcaccaactgtatccatcttcccaccatccagtgagcagttaacatct 61 ggaggtgcctcagtcgtgtgcttcttgaacaacttctaccccaaagacatcaatgtcaag 121 tggaagattgatggcagtgaacgacaaaatggcgtcctgaacagttggactgatcaggac 181 agcaaagacagcacctacagcatgagcagcaccctcacgttgaccaaggacgagtatgaa 241 cgacataacagctatacctgtgaggccactcacaagacatcaacttcacccattgtcaag 301 agcttcaacaggaatgagtgt

    [0305] Protein Sequence Defining the Murine Kappa Light Chain Constant Region (SEQ ID NO:170)

    TABLE-US-00044 1 radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd 61 skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

    [0306] The following sequences represent the actual or contemplated full length heavy and light chain sequence (i.e., containing both the variable and constant regions sequences) for each antibody described in this Example. Signal sequences for proper secretion of the antibodies (e.g., signal sequences at the 5 end of the DNA sequences or the amino terminal end of the protein sequences) are not shown in the full length heavy and light chain sequences disclosed herein and are not included in the final secreted protein. Also not shown are stop codons for termination of translation required at the 3 end of the DNA sequences. It is within ordinary skill in the art to select a signal sequence and/or a stop codon for expression of the disclosed full length immunoglobulin heavy chain and light chain sequences. It is also contemplated that the variable region sequences can be ligated to other constant region sequences to produce active full length immunoglobulin heavy and light chains.

    [0307] Nucleic Acid Sequence Encoding the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 01G06 (SEQ ID NO:99)

    TABLE-US-00045 1 gaggtcctgctgcaacagtctggacctgagctggtgaagcctggggcttcagtgaagata 61 ccctgcaaggcttctggatacacattcactgactacaacatggactgggtgaagcagagc 121 catggaaagagccttgagtggattggacaaattaatcctaacaatggtggtattttcttc 181 aaccagaagttcaagggcaaggccacattgactgtagacaagtcctccaatacagccttc 241 atggaggtccgcagcctgacatctgaggacactgcagtctattactgtgcaagagaggca 301 attactacggtaggcgctatggactactggggtcaaggaacctcagtcaccgtctcctca 361 gccaaaacgacacccccatctgtctatccactggcccctggatctgctgcccaaactaac 421 tccatggtgaccctgggatgcctggtcaagggctatttccctgagccagtgacagtgacc 481 tggaactctggatccctgtccagcggtgtgcacaccttcccagctgtcctgcagtctgac 541 ctctacactctgagcagctcagtgactgtcccctccagcacctggcccagcgagaccgtc 601 acctgcaacgttgcccacccggccagcagcaccaaggtggacaagaaaattgtgcccagg 661 gattgtggttgtaagccttgcatatgtacagtcccagaagtatcatctgtcttcatcttc 721 cccccaaagcccaaggatgtgctcaccattactctgactcctaaggtcacgtgtgttgtg 781 gtagacatcagcaaggatgatcccgaggtccagttcagctggtttgtagatgatgtggag 841 gtgcacacagctcagacgcaaccccgggaggagcagttcaacagcactttccgctcagtc 901 agtgaacttcccatcatgcaccaggactggctcaatggcaaggagttcaaatgcagggtc 961 aacagtgcagctttccctgcccccatcgagaaaaccatctccaaaaccaaaggcagaccg 1021 aaggctccacaggtgtacaccattccacctcccaaggagcagatggccaaggataaagtc 1081 agtctgacctgcatgataacagacttcttccctgaagacattactgtggagtggcagtgg 1141 aatgggcagccagcggagaactacaagaacactcagcccatcatggacacagatggctct 1201 tacttcgtctacagcaagctcaatgtgcagaagagcaactgggaggcaggaaatactttc 1261 acctgctctgtgttacatgagggcctgcacaaccaccatactgagaagagcctctcccac 1321 tctcctggtaaa

    [0308] Protein Sequence Defining the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 01G06 (SEQ ID NO:100)

    TABLE-US-00046 1 evllqqsgpelvkpgasvkipckasgytftdynmdwvkqshgkslewigqinpnnggiff 61 nqkfkgkatltvdkssntafmevrsltsedtavyycareaittvgamdywgqgtsvtvss 121 akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd 181 lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcgckpcictvpevssvfif 241 ppkpkdvltitltpkvtcvvvdiskddpevqfswfvddvevhtaqtqpreeqfnstfrsv 301 selpimhqdwlngkefkcrvnsaafpapiektisktkgrpkapqvytipppkeqmakdkv 361 sltcmitdffpeditvewqwngqpaenykntqpimdtdgsyfvysklnvqksnweagntf 421 tcsvlheglhnhhtekslshspgk

    [0309] Nucleic Acid Sequence Encoding the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 01G06 (SEQ ID NO:101)

    TABLE-US-00047 1 gacatccagatgactcagtctccagcctccctatctgcatctgtgggagaaactgtcacc 61 atcacatgtcgaacaagtgagaatcttcacaattatttagcatggtatcagcagaaacag 121 ggaaaatctcctcagctcctggtctatgatgcaaaaaccttagcagatggtgtgccatca 181 aggttcagtggcagtggatcaggaacacaatattctctcaagatcaacagcctgcagcct 241 gaagattttgggagttattactgtcaacatttttggagtagtccttacacgttcggaggg 301 gggaccaagctggaaataaaacgggctgatgctgcaccaactgtatccatcttcccacca 361 tccagtgagcagttaacatctggaggtgcctcagtcgtgtgcttcttgaacaacttctac 421 cccaaagacatcaatgtcaagtggaagattgatggcagtgaacgacaaaatggcgtcctg 481 aacagttggactgatcaggacagcaaagacagcacctacagcatgagcagcaccctcacg 541 ttgaccaaggacgagtatgaacgacataacagctatacctgtgaggccactcacaagaca 601 tcaacttcacccattgtcaagagcttcaacaggaatgagtgt

    [0310] Protein Sequence Defining the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 01G06 (SEQ ID NO:102)

    TABLE-US-00048 1 diqmtqspaslsasvgetvtitcrtsenlhnylawyqqkqgkspqllvydaktladgvps 61 rfsgsgsgtqyslkinslqpedfgsyycqhfwsspytfgggtkleikradaaptvsifpp 121 sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt 181 ltkdeyerhnsytceathktstspivksfnrnec

    [0311] Nucleic Acid Sequence Encoding the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and 12G1 Constant Region) of 03G05 (SEQ ID NO:103)

    TABLE-US-00049 1 caggtccaactgcagcagcctggggctgaactggtgaagcctggggcttcagtgaagctg 61 tcctgcaaggcttctggctacaccttcaccagctactggattcactgggtgaaccagagg 121 cctggacaaggccttgagtggattggagacattaatcctagcaacggccgtagtaagtat 181 aatgagaagttcaagaacaaggccacaatgactgcagacaaatcctccaacacagcctac 241 atgcaactcagcagcctgacatctgaggactctgcggtctattactgtgcaagagaggtt 301 ctggatggtgctatggactactggggtcaaggaacctcagtcaccgtctcctcagccaaa 361 acgacacccccatctgtctatccactggcccctggatctgctgcccaaactaactccatg 421 gtgaccctgggatgcctggtcaagggctatttccctgagccagtgacagtgacctggaac 481 tctggatccctgtccagcggtgtgcacaccttcccagctgtcctgcagtctgacctctac 541 actctgagcagctcagtgactgtcccctccagcacctggcccagcgagaccgtcacctgc 601 aacgttgcccacccggccagcagcaccaaggtggacaagaaaattgtgcccagggattgt 661 ggttgtaagccttgcatatgtacagtcccagaagtatcatctgtcttcatcttcccccca 721 aagcccaaggatgtgctcaccattactctgactcctaaggtcacgtgtgttgtggtagac 781 atcagcaaggatgatcccgaggtccagttcagctggtttgtagatgatgtggaggtgcac 841 acagctcagacgcaaccccgggaggagcagttcaacagcactttccgctcagtcagtgaa 901 cttcccatcatgcaccaggactggctcaatggcaaggagttcaaatgcagggtcaacagt 961 gcagctttccctgcccccatcgagaaaaccatctccaaaaccaaaggcagaccgaaggct 1021 ccacaggtgtacaccattccacctcccaaggagcagatggccaaggataaagtcagtctg 1081 acctgcatgataacagacttcttccctgaagacattactgtggagtggcagtggaatggg 1141 cagccagcggagaactacaagaacactcagcccatcatggacacagatggctcttacttc 1201 gtctacagcaagctcaatgtgcagaagagcaactgggaggcaggaaatactttcacctgc 1261 tctgtgttacatgagggcctgcacaaccaccatactgagaagagcctctcccactctcct 1321 ggtaaa

    [0312] Protein Sequence Defining the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 03G05 (SEQ ID NO:104)

    TABLE-US-00050 1 qvqlqqpgaelvkpgasvklsckasgytftsywihwvnqrpgqglewigdinpsngrsky 61 nekfknkatmtadkssntaymqlssltsedsavyycarevldgamdywgqgtsvtvssak 121 ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly 181 tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcgckpcictvpevssvfifpp 241 kpkdvltitltpkvtcvvvdiskddpevqfswfvddvevhtaqtqpreeqfnstfrsvse 301 lpimhqdwlngkefkcrvnsaafpapiektisktkgrpkapqvytipppkeqmakdkvsl 361 tcmitdffpeditvewqwngqpaenykntqpimdtdgsyfvysklnvqksnweagntftc 421 svlheglhnhhtekslshspgk

    [0313] Nucleic Acid Sequence Encoding the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 03G05 (SEQ ID NO:105)

    TABLE-US-00051 1 gacattgtgttgacccaatctccagcttctttggctgtgtctctagggcagagggccacc 61 atctcctgcagagccagcgaaagtgttgataattatggcattagttttatgaactggttc 121 caacagaaaccaggacagccacccaaactcctcatctatgctgcatccaaccaaggctcc 181 ggggtccctgccaggtttagtggcagtgggtctgggacagacttcagcctcaacatccat 241 cctatggaggaggatgatactgcaatgtatttctgtcagcaaagtaaggaggttccgtgg 301 acgttcggtggaggctccaagctggaaatcaaacgggctgatgctgcaccaactgtatcc 361 atcttcccaccatccagtgagcagttaacatctggaggtgcctcagtcgtgtgcttcttg 421 aacaacttctaccccaaagacatcaatgtcaagtggaagattgatggcagtgaacgacaa 481 aatggcgtcctgaacagttggactgatcaggacagcaaagacagcacctacagcatgagc 541 agcaccctcacgttgaccaaggacgagtatgaacgacataacagctatacctgtgaggcc 601 actcacaagacatcaacttcacccattgtcaagagcttcaacaggaatgagtgt

    [0314] Protein Sequence Defining the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 03G05 (SEQ ID NO:106)

    TABLE-US-00052 1 divltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppklliyaasnqgs 61 gvparfsgsgsgtdfslnihpmeeddtamyfcqqskevpwtfgggskleikradaaptvs 121 ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms 181 stltltkdeyerhnsytceathktstspivksfnrnec

    [0315] Nucleic Acid Sequence Encoding the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 04F08 (SEQ ID NO:107)

    TABLE-US-00053 1 caggttactctgaaagagtctggccctgggatattgcagccctcccagaccctcagtctg 61 acttgttctttctctgggttttcactgagcacttatggtatgggtgtgacctggattcgt 121 cagccttcaggaaagggtctggagtggctggcacacatttactgggatgatgacaagcgc 181 tataacccatccctgaagagccggctcacaatctccaaggatacctccaacaaccaggta 241 ttcctcaagatcaccagtgtggacactgcagatactgccacatactactgtgctcaaacg 301 gggtatagtaacttgtttgcttactggggccaagggactctggtcactgtctctgcagcc 361 aaaacgacacccccatctgtctatccactggcccctggatctgctgcccaaactaactcc 421 atggtgaccctgggatgcctggtcaagggctatttccctgagccagtgacagtgacctgg 481 aactctggatccctgtccagcggtgtgcacaccttcccagctgtcctgcagtctgacctc 541 tacactctgagcagctcagtgactgtcccctccagcacctggcccagcgagaccgtcacc 601 tgcaacgttgcccacccggccagcagcaccaaggtggacaagaaaattgtgcccagggat 661 tgtggttgtaagccttgcatatgtacagtcccagaagtatcatctgtcttcatcttcccc 721 ccaaagcccaaggatgtgctcaccattactctgactcctaaggtcacgtgtgttgtggta 781 gacatcagcaaggatgatcccgaggtccagttcagctggtttgtagatgatgtggaggtg 841 cacacagctcagacgcaaccccgggaggagcagttcaacagcactttccgctcagtcagt 901 gaacttcccatcatgcaccaggactggctcaatggcaaggagttcaaatgcagggtcaac 961 agtgcagctttccctgcccccatcgagaaaaccatctccaaaaccaaaggcagaccgaag 1021 gctccacaggtgtacaccattccacctcccaaggagcagatggccaaggataaagtcagt 1081 ctgacctgcatgataacagacttcttccctgaagacattactgtggagtggcagtggaat 1141 gggcagccagcggagaactacaagaacactcagcccatcatggacacagatggctcttac 1201 ttcgtctacagcaagctcaatgtgcagaagagcaactgggaggcaggaaatactttcacc 1261 tgctctgtgttacatgagggcctgcacaaccaccatactgagaagagcctctcccactct 1321 cctggtaaa

    [0316] Protein Sequence Defining the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 04F08 (SEQ ID NO:108)

    TABLE-US-00054 1 qvtlkesgpgilqpsqtlsltcsfsgfslstygmgvtwirqpsgkglewlahiywdddkr 61 ynpslksrltiskdtsnnqvflkitsvdtadtatyycaqtgysnlfaywgqgtlvtvsaa 121 kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl 181 ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcgckpcictvpevssvfifp 241 pkpkdvltitltpkvtcvvvdiskddpevqfswfvddvevhtaqtqpreeqfnstfrsvs 301 elpimhqdwlngkefkcrvnsaafpapiektisktkgrpkapqvytipppkeqmakdkvs 361 ltcmitdffpeditvewqwngqpaenykntqpimdtdgsyfvysklnvqksnweagntft 421 csvlheglhnhhtekslshspgk

    [0317] Nucleic Acid Sequence Encoding the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 04F08 (SEQ ID NO: 109)

    TABLE-US-00055 1 gacattgtgatgacccagtctcaaaaattcatgtccacatcagtaggagacagggtcagc 61 gtcacctgcaaggccagtcagaatgtgggtactaatgtagcctggtatcaacagaaatta 121 ggacaatctcctaaaacactgatttactcggcatcctaccggtacagtggagtccctgat 181 cgcttcacaggcagtggatctgggacagatttcactctcaccatcagcaatgtgcagtct 241 gaagacttggcagagtatttctgtcagcaatataacagctatccgtacacgttcggaggg 301 gggaccaagctggaaataaaacgggctgatgctgcaccaactgtatccatcttcccacca 361 tccagtgagcagttaacatctggaggtgcctcagtcgtgtgcttcttgaacaacttctac 421 cccaaagacatcaatgtcaagtggaagattgatggcagtgaacgacaaaatggcgtcctg 481 aacagttggactgatcaggacagcaaagacagcacctacagcatgagcagcaccctcacg 541 ttgaccaaggacgagtatgaacgacataacagctatacctgtgaggccactcacaagaca 601 tcaacttcacccattgtcaagagcttcaacaggaatgagtgt

    [0318] Protein Sequence Defining the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 04F08 (SEQ ID NO:110)

    TABLE-US-00056 1 divmtqsqkfmstsvgdrvsvtckasqnvgtnvawyqqklgqspktliysasyrysgvpd 61 rftgsgsgtdftltisnvqsedlaeyfcqqynsypytfgggtkleikradaaptvsifpp 121 sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt 181 ltkdeyerhnsytceathktstspivksfnrnec

    [0319] Nucleic Acid Sequence Encoding the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 06C11 (SEQ ID NO:111)

    TABLE-US-00057 1 caggttactctgaaagagtctggccctgggatattgcagccctcccagaccctcagtctg 61 acttgttctttctctgggttttcactgaacacttatggtatgggtgtgagctggattcgt 121 cagccttcaggaaagggtctggagtggctggcacacatttactgggatgatgacaagcgc 181 tataacccatccctgaagagccggctcacaatctccaaggatgcctccaacaaccgggtc 241 ttcctcaagatcaccagtgtggacactgcagatactgccacatactactgtgctcaaaga 301 ggttatgatgattactggggttactggggccaagggactctggtcactatctctgcagcc 361 aaaacgacacccccatctgtctatccactggcccctggatctgctgcccaaactaactcc 421 atggtgaccctgggatgcctggtcaagggctatttccctgagccagtgacagtgacctgg 481 aactctggatccctgtccagcggtgtgcacaccttcccagctgtcctgcagtctgacctc 541 tacactctgagcagctcagtgactgtcccctccagcacctggcccagcgagaccgtcacc 601 tgcaacgttgcccacccggccagcagcaccaaggtggacaagaaaattgtgcccagggat 661 tgtggttgtaagccttgcatatgtacagtcccagaagtatcatctgtcttcatcttcccc 721 ccaaagcccaaggatgtgctcaccattactctgactcctaaggtcacgtgtgttgtggta 781 gacatcagcaaggatgatcccgaggtccagttcagctggtttgtagatgatgtggaggtg 841 cacacagctcagacgcaaccccgggaggagcagttcaacagcactttccgctcagtcagt 901 gaacttcccatcatgcaccaggactggctcaatggcaaggagttcaaatgcagggtcaac 961 agtgcagctttccctgcccccatcgagaaaaccatctccaaaaccaaaggcagaccgaag 1021 gctccacaggtgtacaccattccacctcccaaggagcagatggccaaggataaagtcagt 1081 ctgacctgcatgataacagacttcttccctgaagacattactgtggagtggcagtggaat 1141 gggcagccagcggagaactacaagaacactcagcccatcatggacacagatggctcttac 1201 ttcgtctacagcaagctcaatgtgcagaagagcaactgggaggcaggaaatactttcacc 1261 tgctctgtgttacatgagggcctgcacaaccaccatactgagaagagcctctcccactct 1321 cctggtaaa

    [0320] Protein Sequence Defining the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 06C11 (SEQ ID NO:112)

    TABLE-US-00058 1 qvtlkesgpgilqpsqtlsltcsfsgfslntygmgvswirqpsgkglewlahiywdddkr 61 ynpslksrltiskdasnnrvflkitsvdtadtatyycaqrgyddywgywgqgtlvtisaa 121 kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl 181 ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcgckpcictvpevssvfifp 241 pkpkdvltitltpkvtcvvvdiskddpevqfswfvddvevhtaqtqpreeqfnstfrsvs 301 elpimhqdwlngkefkcrvnsaafpapiektisktkgrpkapqvytipppkeqmakdkvs 361 ltcmitdffpeditvewqwngqpaenykntqpimdtdgsyfvysklnvqksnweagntft 421 csvlheglhnhhtekslshspgk

    [0321] Nucleic Acid Sequence Encoding the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 06C11 (SEQ ID NO:113)

    TABLE-US-00059 1 gacattgtgatgacccagtctcaaaaattcatgtccacatcagtaggagacagggtcagc 61 gtcacctgcaaggccagtcagaatgtgggtactaatgtagcctggtttcaacagaaacca 121 ggtcaatctcctaaagcactgatttactcggcatcttaccggtacagtggagtccctgat 181 cgcttcacaggcagtggatctgggacagatttcattctcaccatcagcaatgtgcagtct 241 gaagacctggcagagtatttctgtcagcaatataacaactatcctctcacgttcggtgct 301 gggaccaagctggagctgaaacgggctgatgctgcaccaactgtatccatcttcccacca 361 tccagtgagcagttaacatctggaggtgcctcagtcgtgtgcttcttgaacaacttctac 421 cccaaagacatcaatgtcaagtggaagattgatggcagtgaacgacaaaatggcgtcctg 481 aacagttggactgatcaggacagcaaagacagcacctacagcatgagcagcaccctcacg 541 ttgaccaaggacgagtatgaacgacataacagctatacctgtgaggccactcacaagaca 601 tcaacttcacccattgtcaagagcttcaacaggaatgagtgt

    [0322] Protein Sequence Defining the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 06C11 (SEQ ID NO:114)

    TABLE-US-00060 1 divmtqsqkfmstsvgdrvsvtckasqnvgtnvawfqqkpgqspkaliysasyrysgvpd 61 rftgsgsgtdfiltisnvqsedlaeyfcqqynnypltfgagtklelkradaaptvsifpp 121 sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt 181 ltkdeyerhnsytceathktstspivksfnrnec

    [0323] Nucleic Acid Sequence Encoding the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG2b Constant Region) of 08G01 (SEQ ID NO:115)

    TABLE-US-00061 1 gaggtcctgctgcaacagtctggacctgaggtggtgaagcctggggcttcagtgaagata 61 ccctgcaaggcttctggatacacattcactgactacaacatggactgggtgaagcagagc 121 catggaaagagccttgagtggattggagagattaatcctaacaatggtggtactttctac 181 aaccagaagttcaagggcaaggccacattgactgtagacaagtcctccagcacagcctac 241 atggagctccgcagcctgacatctgaggacactgcagtctattactgtgcaagagaggca 301 attactacggtaggcgctatggactactggggtcaaggaacctcagtcaccgtctcctca 361 gccaaaacaacacccccatcagtctatccactggcccctgggtgtggagatacaactggt 421 tcctccgtgactctgggatgcctggtcaagggctacttccctgagtcagtgactgtgact 481 tggaactctggatccctgtccagcagtgtgcacaccttcccagctctcctgcagtctgga 541 ctctacactatgagcagctcagtgactgtcccctccagcacctggccaagtcagaccgtc 601 acctgcagcgttgctcacccagccagcagcaccacggtggacaaaaaacttgagcccagc 661 gggcccatttcaacaatcaacccctgtcctccatgcaaggagtgtcacaaatgcccagct 721 cctaacctcgagggtggaccatccgtcttcatcttccctccaaatatcaaggatgtactc 781 atgatctccctgacacccaaggtcacgtgtgtggtggtggatgtgagcgaggatgaccca 841 gacgtccagatcagctggtttgtgaacaacgtggaagtacacacagctcagacacaaacc 901 catagagaggattacaacagtactatccgggtggtcagcaccctccccatccagcaccag 961 gactggatgagtggcaaggagttcaaatgcaaggtcaacaacaaagacctcccatcaccc 1021 atcgagagaaccatctcaaaaattaaagggctagtcagagctccacaagtatacatcttg 1081 ccgccaccagcagagcagttgtccaggaaagatgtcagtctcacttgcctggtcgtgggc 1141 ttcaaccctggagacatcagtgtggagtggaccagcaatgggcatacagaggagaactac 1201 aaggacaccgcaccagtcctagactctgacggttcttacttcatatatagcaagctcaat 1261 atgaaaacaagcaagtgggagaaaacagattccttctcatgcaacgtgagacacgagggt 1321 ctgaaaaattactacctgaagaagaccatctcccggtctccgggtaaa

    [0324] Protein Sequence Defining the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG2b Constant Region) of 08G01 (SEQ ID NO:116)

    TABLE-US-00062 1 evllqqsgpevvkpgasvkipckasgytftdynmdwvkqshgkslewigeinpnnggtfy 61 nqkfkgkatltvdkssstaymelrsltsedtavyycareaittvgamdywgqgtsvtvss 121 akttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsg 181 lytmsssvtvpsstwpsqtvtcsvahpassttvdkklepsgpistinpcppckechkcpa 241 pnleggpsvfifppnikdvlmisltpkvtcvvvdvseddpdvqiswfvnnvevhtaqtqt 301 hredynstirvvstlpiqhqdwmsgkefkckvnnkdlpspiertiskikglvrapqvyil 361 pppaeqlsrkdvsltclvvgfnpgdisvewtsnghteenykdtapvldsdgsyfiyskln 421 mktskwektdsfscnvrheglknyylkktisrspgk

    [0325] Nucleic Acid Sequence Encoding the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 08G01 (SEQ ID NO:117)

    TABLE-US-00063 1 gacatccagatgactcagtctccagcctccctatctgcatctgtgggagaaactgtcacc 61 atcacatgtcgagcaagtgggaatattcacaattatttagcatggtatcagcagaaacag 121 ggaaaatctcctcagctcctggtctataatgcaaaaaccttagcagatggtgtgccatca 181 aggttcagtggcagtggatcaggaacacaatattctctcaagatcaacagcctgcagcct 241 gaagattttgggagttattactgtcaacatttttggagttctccttacacgttcggaggg 301 gggaccaagctggaaataaaacgggctgatgctgcaccaactgtatccatcttcccacca 361 tccagtgagcagttaacatctggaggtgcctcagtcgtgtgcttcttgaacaacttctac 421 cccaaagacatcaatgtcaagtggaagattgatggcagtgaacgacaaaatggcgtcctg 481 aacagttggactgatcaggacagcaaagacagcacctacagcatgagcagcaccctcacg 541 ttgaccaaggacgagtatgaacgacataacagctatacctgtgaggccactcacaagaca 601 tcaacttcacccattgtcaagagcttcaacaggaatgagtgt

    [0326] Protein Sequence Defining the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 08G01 (SEQ ID NO:118)

    TABLE-US-00064 1 diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps 61 rfsgsgsgtqyslkinslqpedfgsyycqhfwsspytfgggtkleikradaaptvsifpp 121 sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt 181 ltkdeyerhnsytceathktstspivksfnrnec

    [0327] Nucleic Acid Sequence Encoding the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 14F11 (SEQ ID NO:119)

    TABLE-US-00065 1 caggttactctgaaagagtctggccctggaatattgcagccctcccagaccctcagtctg 61 acttgttctttctctgggttttcactgagcacttatggtatgggtgtaggctggattcgt 121 cagccttcaggaaagggtctagagtggctggcagacatttggtgggatgacgataagtac 181 tataacccatccctgaagagccggctcacaatctccaaggatacctccagcaatgaggta 241 ttcctcaagatcgccattgtggacactgcagatactgccacttactactgtgctcgaaga 301 ggtcactactctgctatggactactggggtcaaggaacctcagtcaccgtctcctcagcc 361 aaaacgacacccccatctgtctatccactggcccctggatctgctgcccaaactaactcc 421 atggtgaccctgggatgcctggtcaagggctatttccctgagccagtgacagtgacctgg 481 aactctggatccctgtccagcggtgtgcacaccttcccagctgtcctgcagtctgacctc 541 tacactctgagcagctcagtgactgtcccctccagcacctggcccagcgagaccgtcacc 601 tgcaacgttgcccacccggccagcagcaccaaggtggacaagaaaattgtgcccagggat 661 tgtggttgtaagccttgcatatgtacagtcccagaagtatcatctgtcttcatcttcccc 721 ccaaagcccaaggatgtgctcaccattactctgactcctaaggtcacgtgtgttgtggta 781 gacatcagcaaggatgatcccgaggtccagttcagctggtttgtagatgatgtggaggtg 841 cacacagctcagacgcaaccccgggaggagcagttcaacagcactttccgctcagtcagt 901 gaacttcccatcatgcaccaggactggctcaatggcaaggagttcaaatgcagggtcaac 961 agtgcagctttccctgcccccatcgagaaaaccatctccaaaaccaaaggcagaccgaag 1021 gctccacaggtgtacaccattccacctcccaaggagcagatggccaaggataaagtcagt 1081 ctgacctgcatgataacagacttcttccctgaagacattactgtggagtggcagtggaat 1141 gggcagccagcggagaactacaagaacactcagcccatcatggacacagatggctcttac 1201 ttcgtctacagcaagctcaatgtgcagaagagcaactgggaggcaggaaatactttcacc 1261 tgctctgtgttacatgagggcctgcacaaccaccatactgagaagagcctctcccactct 1321 cctaataaa

    [0328] Protein Sequence Defining the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 14F11 (SEQ ID NO:120)

    TABLE-US-00066 1 qvtlkesgpgilqpsqtlsltcsfsgfslstygmgvgwirqpsgkglewladiwwdddky 61 ynpslksrltiskdtssnevflkiaivdtadtatyycarrghysamdywgqgtsvtvssa 121 kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl 181 ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcgckpcictvpevssvfifp 241 pkpkdvltitltpkvtcvvvdiskddpevqfswfvddvevhtaqtqpreeqfnstfrsvs 301 elpimhqdwlngkefkcrvnsaafpapiektisktkgrpkapqvytipppkeqmakdkvs 361 ltcmitdffpeditvewqwngqpaenykntqpimdtdgsyfvysklnvqksnweagntft 421 csvlheglhnhhtekslshspgk

    [0329] Nucleic Acid Sequence Encoding the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 14F11 (SEQ ID NO: 121)

    TABLE-US-00067 1 gacattgtaatgacccagtctcaaaaattcatgtccacatcagtaggagacagggtcagc 61 gtcacctgcaaggccagtcagaatgtgggtactaatgtagcctggtatcaacagaaacca 121 gggcaatctcctaaagcactgatttactcgccatcctaccggtacagtggagtccctgat 181 cgcttcacaggcagtggatctgggacagatttcactctcaccatcagcaatgtgcagtct 241 gaagacttggcagaatatttctgtcagcaatataacagctatcctcacacgttcggaggg 301 gggaccaagctggaaatgaaacgggctgatgctgcaccaactgtatccatcttcccacca 361 tccagtgagcagttaacatctggaggtgcctcagtcgtgtgcttcttgaacaacttctac 421 cccaaagacatcaatgtcaagtggaagattgatggcagtgaacgacaaaatggcgtcctg 481 aacagttggactgatcaggacagcaaagacagcacctacagcatgagcagcaccctcacg 541 ttgaccaaggacgagtatgaacgacataacagctatacctgtgaggccactcacaagaca 601 tcaacttcacccattgtcaagagcttcaacaggaatgagtgt

    [0330] Protein Sequence Defining the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 14F11 (SEQ ID NO:122)

    TABLE-US-00068 1 divmtqsqkfmstsvgdrvsvtckasqnvgtnvawyqqkpgqspkaliyspsyrysgvpd 61 rftgsgsgtdftltisnvqsedlaeyfcqqynsyphtfgggtklemkradaaptvsifpp 121 sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt 181 ltkdeyerhnsytceathktstspivksfnrnec

    [0331] Nucleic Acid Sequence Encoding the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 17B11 (SEQ ID NO:123)

    TABLE-US-00069 1 caggttactctgaaagagtctggccctgggatattgcagccctcccagaccctcagtctg 61 acttgttctttctctgggttttcactgagcacttctggtatgggtgtgagttggattcgt 121 cagccttcaggaaagggtctggagtggctggcacacaatgactgggatgatgacaagcgc 181 tataagtcatccctgaagagccggctcacaatatccaaggatacctccagaaaccaggta 241 ttcctcaagatcaccagtgtggacactgcagatactgccacatactactgtgctcgaaga 301 gttgggggattagagggctattttgattactggggccaaggcaccactctcacagtctcc 361 tcagccaaaacgacacccccatctgtctatccactggcccctggatctgctgcccaaact 421 aactccatggtgaccctgggatgcctggtcaagggctatttccctgagccagtgacagtg 481 acctggaactctggatccctgtccagcggtgtgcacaccttcccagctgtcctgcagtct 541 gacctctacactctgagcagctcagtgactgtcccctccagcacctggcccagcgagacc 601 gtcacctgcaacgttgcccacccggccagcagcaccaaggtggacaagaaaattgtgccc 661 agggattgtggttgtaagccttgcatatgtacagtcccagaagtatcatctgtcttcatc 721 ttccccccaaagcccaaggatgtgctcaccattactctgactcctaaggtcacgtgtgtt 781 gtggtagacatcagcaaggatgatcccgaggtccagttcagctggtttgtagatgatgtg 841 gaggtgcacacagctcagacgcaaccccgggaggagcagttcaacagcactttccgctca 901 gtcagtgaacttcccatcatgcaccaggactggctcaatggcaaggagttcaaatgcagg 961 gtcaacagtgcagctttccctgcccccatcgagaaaaccatctccaaaaccaaaggcaga 1021 ccgaaggctccacaggtgtacaccattccacctcccaaggagcagatggccaaggataaa 1081 gtcagtctgacctgcatgataacagacttcttccctgaagacattactgtggagtggcag 1141 tggaatgggcagccagcggagaactacaagaacactcagcccatcatggacacagatggc 1201 tcttacttcgtctacagcaagctcaatgtgcagaagagcaactgggaggcaggaaatact 1261 ttcacctgctctgtgttacatgagggcctgcacaaccaccatactgagaagagcctctcc 1321 cactctcctggtaaa

    [0332] Protein Sequence Defining the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 17B11 (SEQ ID NO:124)

    TABLE-US-00070 1 qvtlkesgpgilqpsqtlsltcsfsgfslstsgmgvswirqpsgkglewlahndwdddkr 61 yksslksrltiskdtsrnqvflkitsvdtadtatyycarrvgglegyfdywgqgttltvs 121 sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs 181 dlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcgckpcictvpevssvfi 241 fppkpkdvltitltpkvtcvvvdiskddpevqfswfvddvevhtaqtqpreeqfnstfrs 301 vselpimhqdwlngkefkcrvnsaafpapiektisktkgrpkapqvytipppkeqmakdk 361 vsltcmitdffpeditvewqwngqpaenykntqpimdtdgsyfvysklnvqksnweagnt 421 ftcsvlheglhnhhtekslshspgk

    [0333] Nucleic Acid Sequence Encoding the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 17B11 (SEQ ID NO:125)

    TABLE-US-00071 1 gacattgtgctgacacagtctcctgcttccttagctgtatctctggggcagagggccacc 61 atctcatgcagggccagccaaagtgtcagtacatctaggtttagttatatgcactggttc 121 caacagaaaccaggacaggcacccaaactcctcatcaagtatgcatccaacctagaatct 181 ggggtccctgccaggttcagtggcagtgggtctgggacagacttcaccctcaacatccat 241 cctgtggagggggaggatactgcaacatattactgtcagcacagttgggagattccgtac 301 acgttcggaggggggaccaagctggaaataaaacgggctgatgctgcaccaactgtatcc 361 atcttcccaccatccagtgagcagttaacatctggaggtgcctcagtcgtgtgcttcttg 421 aacaacttctaccccaaagacatcaatgtcaagtggaagattgatggcagtgaacgacaa 481 aatggcgtcctgaacagttggactgatcaggacagcaaagacagcacctacagcatgagc 541 agcaccctcacgttgaccaaggacgagtatgaacgacataacagctatacctgtgaggcc 601 actcacaagacatcaacttcacccattgtcaagagcttcaacaggaatgagtgt

    [0334] Protein Sequence Defining the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 17B11 (SEQ ID NO: 126)

    TABLE-US-00072 1 divltqspaslavslgqratiscrasqsvstsrfsymhwfqqkpgqapkllikyasnles 61 gvparfsgsgsgtdftlnihpvegedtatyycqhsweipytfgggtkleikradaaptvs 121 ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms 181 stltltkdeyerhnsytceathktstspivksfnrnec

    [0335] Table 5 shows the correspondence between the full-length sequences of the antibodies discussed in this Example with those presented in the Sequence Listing.

    TABLE-US-00073 TABLE 5 SEQ ID NO. Nucleic Acid or Protein 99 01G06_Heavy Variable + IgG1 Constant-nucleic acid 100 01G06_Heavy Variable + IgG1 Constant-protein 101 01G06_Kappa Variable + Constant-nucleic acid 102 01G06_Kappa Variable + Constant-protein 103 03G05 Heavy Variable + IgG1 Constant-nucleic acid 104 03G05 Heavy Variable + IgG1 Constant-protein 105 03G05 Kappa Variable + Constant-nucleic acid 106 03G05 Kappa Variable + Constant-protein 107 04F08 Heavy Variable + IgG1 Constant-nucleic acid 108 04F08 Heavy Variable + IgG1 Constant-protein 109 04F08 Kappa Variable + Constant-nucleic acid 110 04F08 Kappa Variable + Constant-protein 111 06C11 Heavy Variable + IgG1 Constant-nucleic acid 112 06C11 Heavy Variable + IgG1 Constant-protein 113 06C11 Kappa Variable + Constant-nucleic acid 114 06C11 Kappa Variable + Constant-protein 115 08G01 Heavy Variable + IgG2b Constant-nucleic acid 116 08G01 Heavy Variable + IgG2b Constant-protein 117 08G01 Kappa Variable + Constant-nucleic acid 118 08G01 Kappa Variable + Constant-protein 119 14F11 Heavy Variable + IgG1 Constant-nucleic acid 120 14F11 Heavy Variable + IgG1 Constant-protein 121 14F11 Kappa Variable + Constant-nucleic acid 122 14F11 Kappa Variable + Constant-protein 123 17B11 Heavy Variable + IgG1 Constant-nucleic acid 124 17B11 Heavy Variable + IgG1 Constant-protein 125 17B11 Kappa Variable + Constant-nucleic acid 126 17B11 Kappa Variable + Constant-protein

    Example 8: Binding Affinities

    [0336] The binding affinities and kinetics of binding of antibodies to 6?His tagged (SEQ ID NO: 266) recombinant human GDF15 (His-rhGDF15 (R&D Systems, Inc.)), untagged recombinant human GDF15 (rhGDF15 (Peprotech, Rocky Hill, NJ), and recombinant human GDF15 produced as either mouse Fc fused to human GDF15 (mFc-rhGDF15) or a version in which the Fc was enzymatically removed (cleaved-rhGDF15) were measured by surface plasmon resonance, using a Biacore? T100 instrument (GE Healthcare, Piscataway, NJ).

    [0337] Rabbit anti-mouse IgGs (GE Healthcare) were immobilized on carboxymethylated dextran CM4 sensor chips (GE Healthcare) by amine coupling, according to a standard protocol. Analyses were performed at 37? C. using PBS containing 0.05% surfactant P20 as running buffer. The antibodies were captured in individual flow cells at a flow rate of 10 ?L/minute. Injection time was varied for each antibody to yield an Rmax between 30 and 60 RU. 250 pg/mL mouse Fc (Jackson ImmunoResearch, West Grove, PA) was injected at 30 ?L/minute for 120 seconds to block non-specific binding of capture antibodies to mouse Fc portion of the recombinant GDF15 protein when needed. Buffer, mFc-rhGDF15, cleaved-rhGDF15, His-rhGDF15, or rhGDF15 diluted in running buffer was injected sequentially over a reference surface (no antibody captured) and the active surface (antibody to be tested) for 240 seconds at 60 ?L/minute. The dissociation phase was monitored for up to 1500 seconds. The surface was then regenerated with two 60-second injections of 10 mM Glycine-HCl, pH 1.7, at a flow rate of 30 ?L/minute. The GDF15 concentration range tested was 30 nM to 0.625 nM.

    [0338] Kinetic parameters were determined using the kinetic function of the BIAevaluation software (GE Healthcare) with double reference subtraction. Kinetic parameters for each antibody, k.sub.a (association rate constant), k.sub.d (dissociation rate constant), and K.sub.D (equilibrium dissociation constant) were determined. Kinetic values of the monoclonal antibodies on mFc-rhGDF15, cleaved rhGDF15, His-rhGDF15, or rhGDF15 are summarized in Tables 6, 7, 8, and 9, respectively.

    TABLE-US-00074 TABLE 6 Antibody Binding to mFc-rhGDF15 Antibody k.sub.a (1/Ms) k.sub.d (1/s) K.sub.D (M) n 01G06 5.6E+06 7.0E?04 2.1E?10 7 03G05 1.0E+07 6.4E?04 6.9E?11 3 04F08 3.6E+06 6.4E?04 1.9E?10 3 06C11 4.5E+06 6.8E?04 1.7E?10 5 08G01 6.0E+06 1.1E?03 1.9E?10 4 14F11 1.7E+06 3.3E?04 2.2E?10 4 17B11 3.7E+06 5.1E?04 1.4E?10 3

    [0339] The data in Table 6 demonstrate that antibodies bind mFc-rhGDF15 with a K.sub.D of about 250 pM or less, 200 pM or less, 150 pM or less, 100 pM or less, 75 pM or less, or 50 pM or less.

    [0340] Kinetic values of the monoclonal antibodies on cleaved-rhGDF15 are summarized in Table 7.

    TABLE-US-00075 TABLE 7 Antibody Binding to Cleaved-rhGDF15 Antibody k.sub.a (1/Ms) k.sub.d (1/s) K.sub.D (M) n 01G06 7.5E+06 8.6E?04 1.1E?10 1 06C11 1.2E+07 2.0E?03 1.7E?10 2 14F11 5.7E+06 6.0E?04 1.1E?10 1

    [0341] The data in Table 7 demonstrate that antibodies 01G06, 06C11 and 14F11 bind cleaved-rhGDF15 with a K.sub.D of about 200 pM or less, 150 pM or less, or 100 pM or less.

    [0342] Kinetic values of the monoclonal antibodies on His-rhGDF15 are summarized in Table 8.

    TABLE-US-00076 TABLE 8 Antibody Binding to His-rhGDF15 Antibody k.sub.a (1/Ms) k.sub.d (1/s) K.sub.D (M) n 01G06 1.4E+07 1.1E?03 8.1E?11 2 06C11 2.9E+07 1.5E?03 5.1E?11 2 14F11 4.4E+06 4.2E?04 9.6E?11 1

    [0343] The data in Table 8 demonstrate that antibodies 01G06, 06C11 and 14F11 bind His-rhGDF15 with a K.sub.D of about 150 pM or less, 100 pM or less, 75 pM or less, or 50 pM or less.

    [0344] Kinetic values of the monoclonal antibodies on rhGDF15 are summarized in Table 9.

    TABLE-US-00077 TABLE 9 Antibody Binding to rhGDF15 Antibody k.sub.a (1/Ms) k.sub.d (1/s) K.sub.D (M) n 01G06 2.1E+07 1.9E?03 9.3E?11 1 06C11 2.2E+07 4.6E?03 2.1E?10 1 14F11 3.1E+07 2.2E?03 7.1E?11 1

    [0345] The data in Table 9 demonstrate that antibodies 01G06, 06C11 and 14F11 bind rhGDF15 with a K.sub.D of about 250 pM or less, 200 pM or less, 150 pM or less, 100 pM or less, 75 pM or less, or 50 pM or less.

    Example 9: Reversal of Cachexia in an mFc-rhGDF15-Induced Model

    [0346] This Example demonstrates the reversal of cachexia (as indicated by body weight loss) by antibody 01G06, 03G05, 04F08, 06C11, 14F11, or 17B11 in an mFc-rhGDF15-induced cachexia model. mFc-rhGDF15 (2 ?g/g) was administered subcutaneously into the flank of 8-week old female ICR-SCID mice. Body weight was measured daily. When body weight reached 93%, the mice were randomized into seven groups of ten mice each. Each group received one of the following treatments: murine IgG control, 01G06, 03G05, 04F08, 06C11, 14F11, or 17B11 at 10 mg/kg. Treatment was administered once by intra-peritoneal injection. Treatment with antibody 01G06, 03G05, 04F08, 06C11, 14F11, or 17B11 resulted in body weight increase relative to initial weight or about 100% (p<0.001) (FIG. 14 and Table 10).

    TABLE-US-00078 TABLE 10 Treatment % Body ANOVA Analysis Gr. Agent mg/kg Weight (compared to mIgG) 1 mIgG 10 77.1 NA 2 01G06 10 94.1 p < 0.001 3 03G05 10 95.1 p < 0.001 4 04F08 10 95.8 p < 0.001 5 06C11 10 93.8 p < 0.001 7 14F11 10 95.4 p < 0.001 8 17B11 10 92.8 p < 0.001

    [0347] The data in FIG. 14 and Table 10 indicate that the disclosed anti-GDF15 antibodies can reverse cachexia in an mFc-rhGDF15-induced mouse model (i.e., a non-tumor bearing mouse model).

    Example 10: Reversal of Cachexia in an HT-1080 Xenograft Tumor Model

    [0348] This Example demonstrates the reversal of cachexia (as indicated by body weight loss) by antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11 or 17B11 in an HT-1080 fibrosarcoma xenograft model. HT-1080 cells were grown in culture at 37? C. in an atmosphere containing 5% CO.sub.2, using Eagle's Minimum Essential Medium (ATCC, Catalog No. 30-2003) containing 10% FBS. Cells were inoculated subcutaneously into the flank of 8-week old female ICR SCID mice with 5?10.sup.6 cells per mouse in 50% matrigel. Body weight was measured daily. When body weight reached 93%, the mice were randomized into eight groups of ten mice each. Each group received one of the following treatments: murine IgG control, 01G06, 03G05, 04F08, 06C11, 08G01, 14F11 or 17B11 at 10 mg/kg. Treatment was administered every three days by intra-peritoneal injection. Treatment with antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11 or 17B11 resulted in body weight increase relative to initial weight or about 100% (p<0.001) (FIG. 15 and Table 11).

    TABLE-US-00079 TABLE 11 ANOVA ANALYSIS TREATMENT % BODY (COMPARED GR. AGENT MG/KG WEIGHT TO MIGG) 1 MIGG 10 81.4 NA 2 01G06 10 103.3 P < 0.001 3 03G05 10 106.1 p < 0.001 4 04F08 10 104.3 p < 0.001 5 06C11 10 106.6 p < 0.001 6 08G01 10 105.3 p < 0.001 7 14F11 10 99.6 p < 0.001 8 17B11 10 103.7 p < 0.001

    [0349] The data in FIG. 15 and Table 11 indicate that the disclosed anti-GDF15 antibodies can reverse cachexia in an HT-1080 fibrosarcoma xenograft model.

    [0350] Additional studies were conducted with antibody 01G06 to demonstrate the reversal of cachexia in this mouse model. HT-1080 cells were grown and inoculated subcutaneously into the flank of 8-week old female ICR SCID mice as described above. When body weight reached 93%, the mice were randomized into two groups of ten mice each. Each group received one of the following treatments: murine IgG control or 01G06 at 10 mg/kg. Treatment was administered once by intra-peritoneal injection. As shown in FIG. 16A, treatment with antibody 01G06 resulted in body weight increase to initial weight or 100% (p<0.001) (FIG. 16A).

    [0351] Food consumption was determined by weighing the food supply given to the mice daily (FIG. 16B). A significant increase in food consumption was observed in the 01G06 treated group for the first three days post treatment. After that time, no significant change was observed compared to the control group (mIgG).

    [0352] Water consumption was determined by weighing the water supply given to the mice daily. No significant change in water consumption was observed between groups.

    [0353] In this experiment, a group of ten mice were sacrificed at the time of the dose (baseline or 93% body weight, without treatment) and at the end of study (seven days post dose, either mIgG or 01G06). Gonadal fat and the gastrocnemius muscles were removed surgically and weighed as described above in Example 4 and tissues were snap frozen in liquid nitrogen. RNA was isolated from the gastrocnemius muscle samples to determine the levels of mMuRF1 and mAtrogin mRNA by RT-PCR, as described in Example 4.

    [0354] As shown in FIG. 16C, a significant reduction in gonadal fat mass was observed seven days post dose with mIgG, but not in the group treated with antibody 01G06. In addition, mice treated with mIgG displayed significant gastrocnemius muscle loss compared to the baseline group, while the group of mice treated with antibody 01G06 did not (FIG. 16D). Further, the levels of muscular degradation markers, mMuRF1 and mAtrogin, were significantly higher in the mIgG group compared to the 01G06 group (FIG. 16E).

    [0355] These results indicate that the disclosed anti-GDF15 antibodies can reverse cachexia measured by the loss of muscle mass, the loss of fat and involuntary weight loss in an HT-1080 xenograft tumor model.

    Example 11: Reversal of Cachexia in an HT-1080 Xenograft Tumor Model

    [0356] This Example demonstrates the reversal of cachexia (as indicated by body weight loss) by antibody 01G06 in an HT-1080 fibrosarcoma xenograft model. HT-1080 cells were grown in culture at 37? C. in an atmosphere containing 5% CO.sub.2, using Eagle's Minimum Essential Medium (ATCC, Catalog No. 30-2003) containing 10% FBS. Cells were inoculated subcutaneously into the flank of 8-week old female ICR SCID mice with 5?10.sup.6 cells per mouse in 50% matrigel. Body weight was measured daily. When body weight reached 80%, the mice were randomized into two groups of five mice each. Each group received one of the following treatments: murine IgG control, 01G06 dosed at 2 mg/kg on day 1 and day 7. Treatment was administered by intra-peritoneal injection. Treatment with antibody 01G06 resulted in body weight increase relative to initial weight or about 100% (p<0.001) (FIG. 17A and Table 12).

    TABLE-US-00080 TABLE 12 Treatment % Body ANOVA Analysis Gr. Agent mg/kg Weight (compared to mIgG) 1 mIgG 2 66.4 NA 2 01G06 2 97.16 p < 0.001

    [0357] The data in FIGS. 17A-B and Table 12 indicate that the disclosed anti-GDF15 antibodies can reverse cachexia in an HT-1080 fibrosarcoma xenograft model.

    [0358] In this experiment, a group of five mice were sacrificed at the time of dosing (baseline or 80% body weight loss, without treatment) and at the end of study (seven days post dose, either mIgG or 01G06). Liver, heart, slpeen, kidney, gonadal fat and the gastrocnemius muscles were removed surgically and weighed. As shown in FIG. 17B, a significant loss in liver, heart, spleen, kidney, gonadal fat and gastrocnemius muscle mass was observed seven days post dose with mIgG, but not in the group treated with antibody 01G06. In addition, mice treated with antibody 01G06 displayed significant liver and gonadal muscle gain compared to the baseline group (FIG. 17B).

    [0359] These results indicate that the disclosed anti-GDF15 antibodies can reverse cachexia measured by the loss of key organ mass, loss of muscle mass, loss of fat and involuntary weight loss in an HT-1080 xenograft tumor model.

    Example 12: Reversal of Cachexia in a K-562 Xenograft Tumor Model

    [0360] This Example demonstrates the reversal of cachexia (as indicated by body weight loss) by antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11 or 17B11 in a K-562 leukemia xenograft model. K-562 cells were grown in culture at 37? C. in an atmosphere containing 5% CO.sub.2, using Iscove's Modified Dulbecco's Medium (ATCC Catalog No. 30-2005) containing 10% FBS. Cells were inoculated subcutaneously into the flank of 8-week old female CB17SCRFMF mice with 2.5?10.sup.6 cells per mouse in 50% matrigel. Body weight was measured daily. When body weight reached 93%, the mice were randomly distributed into eight groups of ten mice each. Each group received one of the following treatments: murine IgG control, 01G06, 03G05, 04F08, 06C11, 08G01, 14F11 or 17B11 at 10 mg/kg. Treatment was administered every three days by intra-peritoneal injection. Treatment with antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11 or 17B11 resulted in body weight increase relative to initial weight or about 100% (p<0.001) (FIG. 18 and Table 13).

    TABLE-US-00081 TABLE 13 Treatment % Body ANOVA Analysis Gr. Agent mg/kg Weight (compared to mIgG) 1 mIgG 10 90.4 NA 2 01G06 10 106.5 p < 0.001 3 03G05 10 109.8 p < 0.001 4 04F08 10 108.9 p < 0.001 5 06C11 10 109.5 p < 0.001 6 08G01 10 107.2 p < 0.001 7 14F11 10 107.0 p < 0.001 8 17B11 10 105.3 p < 0.001

    [0361] The data in FIG. 18 and Table 13 indicate that the disclosed anti-GDF15 antibodies can reverse cachexia in a K-562 xenograft tumor model.

    Example 13: Additional Xenograft Tumor Models

    [0362] Antibody 01G06 was tested in additional tumor xenograft models including the TOV-21G ovarian xenograft model and the LS1034 colon xenograft model. In each model, antibody 01G06 reversed body weight loss compared to a PBS control (p<0.001 for the TOV-21G model and p<0.01 for the LS1034 model).

    Example 14: Humanization of Anti-GDF15 Antibodies

    [0363] This Example describes the humanization and chimerization of three murine antibodies, designated 01G06, 06C11, and 14F11, and the characterization of the resulting humanized antibodies. The humanized anti-GDF15 antibodies were designed, affinity matured by targeted CDR mutagenesis, and optimized using methods known in the art. The amino acid sequences were converted to codon-optimized DNA sequences and synthesized to include (in the following order): 5 HindIII restriction site, Kozak consensus sequence, amino terminal signal sequence, humanized variable region, human IgG1 or Kappa constant region, stop codon, and a 3 EcoRI restriction site.

    [0364] Chimeric (murine variable region and human constant region) 01G06, 06C11, and 14F11 heavy (human IgG1) and light (human Kappa) chains were also constructed. To generate chimeric antibodies, the murine variable regions were fused to the human constant region, and codon-optimized DNA sequences were synthesized, including (in the following order): 5 HindIII restriction site, Kozak consensus sequence, amino terminal signal sequence, mouse variable region, human IgG1 or Kappa constant region, stop codon, and 3 EcoRI restriction site.

    [0365] The humanized and chimeric heavy chains were subcloned into pEE6.4 (Lonza, Basel, Switzerland) via HindIII and EcoRI sites using In-Fusion? PCR cloning (Clontech, Mountain View, CA). The humanized and chimeric Kappa light chains were subcloned into pEE14.4 (Lonza) via HindIII and EcoRI sites using In-Fusion? PCR cloning.

    [0366] Humanized antibody chains or chimeric antibody chains were transiently transfected into 293T cells to produce antibody. Antibody was either purified or used in cell culture media supernatant for subsequent in vitro analysis. Binding of the chimeric and humanized antibodies to human GDF15 was measured as described below. The results are summarized in Tables 24-27.

    [0367] Each of the possible combinations of the chimeric or humanized 01G06 immunoglobulin heavy chain and immunoglobulin light chain variable regions is set forth below in Table 14.

    TABLE-US-00082 TABLE 14 Antibody Light Chain Variable Heavy Chain Variable Name Region Region Hu01G06-1 Ch01G06 Chimeric Kappa Ch01G06 Chimeric Heavy (SEQ ID NO: 76) (SEQ ID NO: 40) Hu01G06-14 Ch01G06 Chimeric Kappa Hu01G06 IGHV1-18 Heavy (SEQ ID NO: 76) (SEQ ID NO: 54) Hu01G06-15 Ch01G06 Chimeric Kappa Hu01G06 IGHV1-69 Heavy (SEQ ID NO: 76) (SEQ ID NO: 56) Hu01G06-147 Ch01G06 Chimeric Kappa Sh01G06 IGHV1-18 M69L (SEQ ID NO: 76) Heavy (SEQ ID NO: 58) Hu01G06-148 Ch01G06 Chimeric Kappa Sh01G06 IGHV1-18 M69L K64Q (SEQ ID NO: 76) G44S Heavy (SEQ ID NO: 60) Hu01G06-149 Ch01G06 Chimeric Kappa Sh01G06 IGHV1-18 M69L K64Q (SEQ ID NO: 76) Heavy (SEQ ID NO: 62) Hu01G06-150 Ch01G06 Chimeric Kappa Sh01G06 IGHV1-69 T30S I69L (SEQ ID NO: 76) Heavy (SEQ ID NO: 64) Hu01G06-151 Ch01G06 Chimeric Kappa Sh01G06 IGHV1-69 T30S K64Q (SEQ ID NO: 76) I69L Heavy (SEQ ID NO: 66) Hu01G06-4 Hu01G06 IGKV1-39 Kappa Ch01G06 Chimeric Heavy (SEQ ID NO: 90) (SEQ ID NO: 40) Hu01G06-46 Hu01G06 IGKV1-39 Kappa Hu01G06 IGHV1-18 Heavy (SEQ ID NO: 90) (SEQ ID NO: 54) Hu01G06-52 Hu01G06 IGKV1-39 Kappa Hu01G06 IGHV1-69 Heavy (SEQ ID NO: 90) (SEQ ID NO: 56) Hu01G06-100 Hu01G06 IGKV1-39 Kappa Sh01G06 IGHV1-18 M69L Heavy (SEQ ID NO: 90) (SEQ ID NO: 58) Hu01G06-102 Hu01G06 IGKV1-39 Kappa Sh01G06 IGHV1-18 M69L K64Q (SEQ ID NO: 90) G44S Heavy (SEQ ID NO: 60) Hu01G06-101 Hu01G06 IGKV1-39 Kappa Sh01G06 IGHV1-18 M69L (SEQ ID NO: 90) K64Q Heavy (SEQ ID NO: 62) Hu01G06-103 Hu01G06 IGKV1-39 Kappa Sh01G06 IGHV1-69 T30S (SEQ ID NO: 90) I69L Heavy (SEQ ID NO: 64) Hu01G06-104 Hu01G06 IGKV1-39 Kappa Sh01G06 IGHV1-69 T30S K64Q (SEQ ID NO: 90) I69L Heavy(SEQ ID NO: 66) Hu01G06-152 Hu01G06 IGKV1-39 S43A V48I Ch01G06 Chimeric Heavy Kappa (SEQ ID NO: 92) (SEQ ID NO: 40) Hu01G06-71 Hu01G06 IGKV1-39 S43A V48I Hu01G06 IGHV1-18 Heavy Kappa (SEQ ID NO: 92) (SEQ ID NO: 54) Hu01G06-77 Hu01G06 IGKV1-39 S43A V48I Hu01G06 IGHV1-69 Heavy Kappa (SEQ ID NO: 92) (SEQ ID NO: 56) Hu01G06-110 Hu01G06 IGKV1-39 S43A V48I Sh01G06 IGHV1-18 M69L Heavy Kappa (SEQ ID NO: 92) (SEQ ID NO: 58) Hu01G06-112 Hu01G06 IGKV1-39 S43A V48I Sh01G06 IGHV1-18 M69L K64Q Kappa (SEQ ID NO: 92) G44S Heavy (SEQ ID NO: 60) Hu01G06-111 Hu01G06 IGKV1-39 S43A V48I Sh01G06 IGHV1-18 M69L K64Q Kappa (SEQ ID NO: 92) Heavy (SEQ ID NO: 62) Hu01G06-113 Hu01G06 IGKV1-39 S43A V48I Sh01G06 IGHV1-69 T30S I69L Kappa (SEQ ID NO: 92) Heavy (SEQ ID NO: 64) Hu01G06-114 Hu01G06 IGKV1-39 S43A V48I Sh01G06 IGHV1-69 T30S K64Q Kappa (SEQ ID NO: 92) I69L Heavy (SEQ ID NO: 66) Hu01G06-122 Hu01G06 IGKV1-39 S43A V48I Hu01G06 IGHV1-18 F1 Heavy Kappa(SEQ ID NO: 92) (SEQ ID NO: 246) Hu01G06-119 Hu01G06 IGKV1-39 S43A V48I Hu01G06 IGHV1-18 F2 Heavy Kappa(SEQ ID NO: 92) (SEQ ID NO: 248) Hu01G06-135 Hu01G06 IGKV1-39 S43A V48I Hu01G06 IGHV1-69 F1 Heavy Kappa(SEQ ID NO: 92) (SEQ ID NO: 250) Hu01G06-138 Hu01G06 IGKV1-39 S43A V48I Hu01G06 IGHV1-69 F2 Heavy Kappa(SEQ ID NO: 92) (SEQ ID NO: 252) Hu01G06-153 Hu01G06 IGKV1-39 V48I Kappa Ch01G06 Chimeric Heavy (SEQ ID NO: 94) (SEQ ID NO: 40) Hu01G06-69 Hu01G06 IGKV1-39 V48I Kappa Hu01G06 IGHV1-18 Heavy (SEQ ID NO: 94) (SEQ ID NO: 54) Hu01G06-75 Hu01G06 IGKV1-39 V48I Kappa Hu01G06 IGHV1-69 Heavy (SEQ ID NO: 94) (SEQ ID NO: 56) HU01G06-105 Hu01G06 IGKV1-39 V48I Kappa Sh01G06 IGHV1-18 M69L Heavy (SEQ ID NO: 94) (SEQ ID NO: 58) Hu01G06-107 Hu01G06 IGKV1-39 V48I Kappa Sh01G06 IGHV1-18 M69L K64Q (SEQ ID NO: 94) G44S Heavy (SEQ ID NO: 60) Hu01G06-106 Hu01G06 IGKV1-39 V48I Kappa Sh01G06 IGHV1-18 M69L K64Q (SEQ ID NO: 94) Heavy (SEQ ID NO: 62) Hu01G06-108 Hu01G06 IGKV1-39 V48I Kappa Sh01G06 IGHV1-69 T30S I69L (SEQ ID NO: 94) Heavy (SEQ ID NO: 64) Hu01G06-109 Hu01G06 IGKV1-39 V48I Kappa Sh01G06 IGHV1-69 T30S K64Q (SEQ ID NO: 94) I69L Heavy (SEQ ID NO: 66) Hu01G06-154 Hu01G06 IGKV1-39 F2 Kappa Ch01G06 Chimeric Heavy (SEQ ID NO: 254) (SEQ ID NO: 40) Hu01G06-155 Hu01G06 IGKV1-39 F2 Kappa Hu01G06 IGHV1-18 Heavy (SEQ ID NO: 254) (SEQ ID NO: 54) Hu01G06-156 Hu01G06 IGKV1-39 F2 Kappa Hu01G06 IGHV1-69 Heavy (SEQ ID NO: 254) (SEQ ID NO: 56) Hu01G06-157 Hu01G06 IGKV1-39 F2 Kappa Sh01G06 IGHV1-18 M69L Heavy (SEQ ID NO: 254) (SEQ ID NO: 58) Hu01G06-158 Hu01G01 IGKV1-39 F2 Kappa Sh01G06 IGHV1-18 M69L K64Q (SEQ ID NO: 254) G44S Heavy (SEQ ID NO: 60) Hu01G06-159 Hu01G06 IGKV1-39 F2 Kappa Sh01G06 IGHV1-18 M69L K64Q (SEQ ID NO: 254) Heavy (SEQ ID NO: 62) Hu01G06-160 Hu01G06 IGKV1-39 F2 Kappa Sh01G06 IGHV1-69 T30S I69L (SEQ ID NO: 254) Heavy (SEQ ID NO: 64) Hu01G06-161 Hu01G06 IGKV1-39 F2 Kappa Su01G06 IGHV1-69 T30S K64Q (SEQ ID NO: 254) I69L Heavy (SEQ ID NO: 66) Hu01G06-130 Hu01G06 IGKV1-39 F2 Kappa Hu01G06 IGHV1-18 F1 Heavy (SEQ ID NO: 254) (SEQ ID NO: 246) Hu01G06-127 Hu01G06 IGKV1-39 F2 Kappa Hu01G06 IGHV1-18 F2 Heavy (SEQ ID NO: 254) (SEQ ID NO: 248) Hu01G06-143 Hu01G06 IGKV1-39 F2 Kappa Hu01G06 IGHV1-69 F1 Heavy (SEQ ID NO: 254) (SEQ ID NO: 250) Hu01G06-146 Hu01G06 IGKV1-39 F2 Kappa Hu01G06 IGHV1-69 F2 Heavy (SEQ ID NO: 254) (SEQ ID NO: 252)

    [0368] Each of the possible combinations of the chimeric or humanized 06C11 immunoglobulin heavy chain and immunoglobulin light chain variable regions is set forth below in Table 15.

    TABLE-US-00083 TABLE 15 Antibody Light Chain Variable Heavy Chain Variable Name Region Region Hu06C11-1 Ch06C11 Chimeric Kappa Ch06C11 Chimeric Heavy (SEQ ID NO: 82) (SEQ ID NO: 46) Hu06C11-7 Ch06C11 Chimeric Kappa HE LM 06C11 IGHV2-70 (SEQ ID NO: 82) Heavy (SEQ ID NO: 68) Hu06C11-10 Ch06C11 Chimeric Kappa Hu06C11 IGHV2-5 Heavy (SEQ ID NO: 82) (SEQ ID NO: 70) Hu06C11-12 Sh06C11 IGKV1-16 Kappa Ch06C11 Chimeric Heavy (SEQ ID NO: 96) (SEQ ID NO: 46) Hu06C11-27 Sh06C11 IGKV1-16 Kappa HE LM 06C11 IGHV2-70 (SEQ ID NO: 96) Heavy (SEQ ID NO: 68) Hu06C11-30 Sh06C11 IGKV1-16 Kappa Hu06C11 IGHV2-5 Heavy (SEQ ID NO: 96) (SEQ ID NO: 70)

    [0369] Each of the possible combinations of the chimeric or humanized 14F11 immunoglobulin heavy chain and immunoglobulin light chain variable regions is set forth below in Table 16.

    TABLE-US-00084 TABLE 16 Antibody Light Chain Variable Heavy Chain Variable Name Region Region Hu14F11-1 Ch14F11 Chimeric Kappa Ch14F11 Chimeric Heavy (SEQ ID NO: 86) (SEQ ID NO: 50) Hu14F11-14 Ch14F11 Chimeric Kappa Sh14F11 IGHV2-5 Heavy (SEQ ID NO: 86) (SEQ ID NO: 72) Hu14F11-15 Ch14F11 Chimeric Kappa Sh14F11 IGHV2-70 Heavy (SEQ ID NO: 86) (SEQ ID NO: 74) Hu14F11-11 Hu14F11 IGKV1-16 Kappa Ch14F11 Chimeric Heavy (SEQ ID NO: 98) (SEQ ID NO: 50) Hu14F11-39 Hu14F11 IGKV1-16 Kappa Sh14F11 IGHV2-5 Heavy (SEQ ID NO: 98 (SEQ ID NO: 72) Hu14F11-47 Hu14F11 IGKV1-16 Kappa Sh14F11 IGHV2-70 Heavy (SEQ ID NO: 98) (SEQ ID NO: 74)

    [0370] Each of the possible combinations of the chimeric 04F08, 06C11, and 14F11 immunoglobulin heavy chain and immunoglobulin light chain variable regions is set forth below in Table 17. Table 17

    TABLE-US-00085 TABLE 17 Light Chain Variable Region Heavy Chain Variable Region 04F08 Chimeric Kappa Ch06C11 Chimeric Heavy (SEQ ID NO: 80) (SEQ ID NO: 46) 04F08 Chimeric Kappa Ch14F11 Chimeric Heavy (SEQ ID NO: 80) (SEQ ID NO: 50) Ch06C11 Chimeric Kappa 04F08 Chimeric Heavy (SEQ ID NO: 82) (SEQ ID NO: 44) Ch06C11 Chimeric Kappa Ch14F11 Chimeric Heavy (SEQ ID NO: 82) (SEQ ID NO: 50) Ch14F11 Chimeric Kappa 04F08 Chimeric Heavy (SEQ ID NO: 86) (SEQ ID NO: 44) Ch14F11 Chimeric Kappa Ch06C11 Chimeric Heavy Light Chain Variable Region Heavy Chain Variable Region (SEQ ID NO: 86) (SEQ ID NO: 46)

    [0371] Each of the possible combinations of the chimeric 01G06 and chimeric 08G01 immunoglobulin heavy chain and immunoglobulin light chain variable regions is set forth below in Table 18.

    TABLE-US-00086 TABLE 18 Light Chain Variable Region Heavy Chain Variable Region Ch01G06 Chimeric Kappa 08G01 Chimeric Heavy (SEQ ID NO: 76) (SEQ ID NO: 48) 08G01 Chimeric Kappa Ch01G06 Chimeric Heavy (SEQ ID NO: 84) (SEQ ID NO: 40)

    [0372] The nucleic acid sequences and the encoded protein sequences defining variable regions of the chimeric and humanized 01G06, 06C11, and 14F11 antibodies are summarized below (amino terminal signal peptide sequences are not shown). CDR sequences (Kabat definition) are shown in bold and are underlined in the amino acid sequences.

    [0373] Nucleic Acid Sequence Encoding the Ch01G06 Chimeric Heavy Chain Variable Region (SEQ ID NO: 127)

    TABLE-US-00087 1 gaagtgttgttgcagcagtcagggccggagttggtaaaaccgggagcgtcggtgaaaatc 61 ccgtgcaaagcgtcggggtatacgtttacggactataacatggattgggtgaaacagtcg 121 catgggaaatcgcttgaatggattggtcagatcaatccgaataatggaggaatcttcttt 181 aatcagaagtttaaaggaaaagcgacgcttacagtcgataagtcgtcgaacacggcgttc 241 atggaagtacggtcgcttacgtcggaagatacggcggtctattactgtgcgagggaggcg 301 attacgacggtgggagcgatggactattggggacaagggacgtcggtcacggtatcgtcg

    [0374] Protein Sequence Defining the Ch01G06 Chimeric Heavy Chain Variable Region (SEQ ID NO:40)

    TABLE-US-00088 1 evllqqsgpelvkpgasvkipckasgytftdynmdwvkqshgkslewigqinpnnggiff 61 nqkfkgkatltvdkssntafmevrsltsedtavyycareaittvgamdywgqgtsvtvss

    [0375] Nucleic Acid Sequence Encoding the Hu01G06 IGHV1-18 Heavy Chain Variable Region (SEQ ID NO:53)

    TABLE-US-00089 1 caagtgcaacttgtgcagtcgggtgcggaagtcaaaaagccgggagcgtcggtgaaagta 61 tcgtgtaaagcgtcgggatatacgtttacggactataacatggactgggtacgacaggca 121 ccggggaaatcgttggaatggatcggacagattaatccgaacaatgggggaattttcttt 181 aatcagaaattcaaaggacgggcgacgttgacggtcgatacatcgacgaatacggcgtat 241 atggaattgaggtcgcttcgctcggacgatacggcggtctattactgcgccagggaggcg 301 atcacgacggtaggggcgatggattattggggacaggggacgcttgtgacggtatcgtcg

    [0376] Protein Sequence Defining the Hu01G06 IGHV1-18 Heavy Chain Variable Region (SEQ ID NO:54)

    TABLE-US-00090 1 qvqlvqsgaevkkpgasvkvsckasgytftdynmdwvrqapgkslewigqinpnnggiff 61 nqkfkgratltvdtstntaymelrslrsddtavyycareaittvgamdywgqgtlvtvss

    [0377] Nucleic Acid Sequence Encoding the Hu01G06 IGHV1-69 Heavy Chain Variable Region (SEQ ID NO:55)

    TABLE-US-00091 1 caagtccagcttgtccagtcgggagcggaagtgaagaaaccggggtcgtcggtcaaagta 61 tcgtgtaaagcgtcgggatatacgtttacggactataacatggattgggtacgacaggct 121 ccgggaaaatcattggaatggattggacagattaatccgaataatgggggtatcttcttt 181 aatcaaaagtttaaagggagggcgacgttgacggtggacaaatcgacaaatacggcgtat 241 atggaattgtcgtcgcttcggtcggaggacacggcggtgtattactgcgcgagggaggcg 301 atcacgacggtcggggcgatggattattggggacagggaacgcttgtgacggtatcgtcg

    [0378] Protein Sequence Defining the Hu01G06 IGHV1-69 Heavy Chain Variable Region (SEQ ID NO:56)

    TABLE-US-00092 1 qvqlvqsgaevkkpgssvkvsckasgytftdynmdwvrqapgkslewigqinpnnggiff 61 nqkfkgratltvdkstntaymelsslrsedtavyycareaittvgamdywgqgtlvtvss

    [0379] Nucleic Acid Sequence Encoding the Sh01G06 IGHV1-18 M69L Heavy Chain Variable Region (SEQ ID NO:57)

    TABLE-US-00093 1 caggtccagcttgtgcaatcgggagcggaagtgaagaaaccgggagcgtcggtaaaagtc 61 tcgtgcaaagcgtcggggtatacgtttacggactataacatggactgggtgcgccaagcg 121 cctggacagggtcttgaatggatggggcagattaatccgaataatggagggatcttcttt 181 aatcagaaattcaaaggaagggtaacgctgacgacagacacgtcaacatcgacggcctat 241 atggaattgcggtcgttgcgatcagatgatacggcggtctactattgtgcgagggaggcg 301 attacgacggtgggagcgatggattattggggacaggggacgttggtaacggtatcgtcg

    [0380] Protein Sequence Defining the Sh01G06 IGHV1-18 M69L Heavy Chain Variable Region (SEQ ID NO:58)

    TABLE-US-00094 1 qvglvqsgaevkkpgasvkvsckasgytftdynmdwvrqapgqglewmgqinpnnggiff 61 nqkfkgrvtlttdtststaymelrslrsddtavyycareaittvgamdywgqgtlvtvss

    [0381] Nucleic Acid Sequence Encoding the Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain Variable Region (SEQ ID NO:59)

    TABLE-US-00095 1 caggtccagcttgtgcaatcgggagcggaagtgaagaaaccgggagcgtcggtaaaagtc 61 tcgtgcaaagcgtcggggtatacgtttacggactataacatggactgggtgcgccaagcg 121 cctggacagagccttgaatggatggggcagattaatccgaataatggagggatcttcttt 181 aatcagaaattccagggaagggtaacgctgacgacagacacgtcaacatcgacggcctat 241 atggaattgcggtcgttgcgatcagatgatacggcggtctactattgtgcgagggaggcg 301 attacgacggtgggagcgatggattattggggacaggggacgttggtaacggtatcgtcg

    [0382] Protein Sequence Defining the Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain Variable Region (SEQ ID NO:60)

    TABLE-US-00096 1 qvqlvqsgaevkkpgasvkvsckasgytftdynmdwvrqapgqslewmgqinpnnggiff 61 nqkfqgrvtlttdtststaymelrslrsddtavyycareaittvgamdywgqgtlvtvss

    [0383] Nucleic Acid Sequence Encoding the Sh01G06 IGHV1-18 M69L K64Q Heavy Chain Variable Region (SEQ ID NO:61)

    TABLE-US-00097 1 caggtccagcttgtgcaatcgggagcggaagtgaagaaaccgggagcgtcggtaaaagtc 61 tcgtgcaaagcgtcggggtatacgtttacggactataacatggactgggtgcgccaagcg 121 cctggacagggtcttgaatggatggggcagattaatccgaataatggagggatcttcttt 181 aatcagaaattccagggaagggtaacgctgacgacagacacgtcaacatcgacggcctat 241 atggaattgcggtcgttgcgatcagatgatacggcggtctactattgtgcgagggaggcg 301 attacgacggtgggagcgatggattattggggacaggggacgttggtaacggtatcgtcg

    [0384] Protein Sequence Defining the Sh01G06 IGHV1-18 M69L K64Q Heavy Chain Variable Region (SEQ ID NO:62)

    TABLE-US-00098 1 qvqlvqsgaevkkpgasvkvsckasgytftdynmdwvrqapgqglewmgqinpnnggiff 61 nqkfqgrvtlttdtststaymelrslrsddtavyycareaittvgamdywgqgtlvtvss

    [0385] Nucleic Acid Sequence Encoding the Sh01G06 IGHV1-69 T30S I69L Heavy Chain Variable Region (SEQ ID NO:63)

    TABLE-US-00099 1 caagtacagcttgtacagtcgggagcggaagtcaagaaaccgggatcgtcggtcaaagtg 61 tcgtgtaaagcgtcgggatatacgtttagcgactataacatggattgggtgcgacaagcg 121 cctgggcagggacttgaatggatgggtcagatcaatccgaataatgggggaatctttttc 181 aatcagaagtttaaagggagggtaacgctgacggcggataaaagcacgtcaacggcgtat 241 atggagttgtcgtcgttgcggtcggaggacacggcggtctattactgcgcgagggaagcg 301 attacgacggtgggagcgatggattattgggggcagggaacgcttgtaacggtgtcatcg

    [0386] Protein Sequence Defining the Sh01G06 IGHV1-69 T30S I69L Heavy Chain Variable Region (SEQ ID NO:64)

    TABLE-US-00100 1 qvqlvqsgaevkkpgssvkvsckasgytfsdynmdwvrqapgqglewmgqinpnnggiff 61 nqkfkgrvtltadkststaymelsslrsedtavyycareaittvgamdywgqgtlvtvss

    [0387] Nucleic Acid Sequence Encoding the Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Chain Variable Region (SEQ ID NO:65)

    TABLE-US-00101 1 caagtacagcttgtacagtcgggagcggaagtcaagaaaccgggatcgtcggtcaaagtg 61 tcgtgtaaagcgtcgggatatacgtttagcgactataacatggattgggtgcgacaagcg 121 cctgggcagggacttgaatggatgggtcagatcaatccgaataatgggggaatctttttc 181 aatcagaagtttcaggggagggtaacgctgacggcggataaaagcacgtcaacggcgtat 241 atggagttgtcgtcgttgcggtcggaggacacggcggtctattactgcgcgagggaagcg 301 attacgacggtgggagcgatggattattgggggcagggaacgcttgtaacggtgtcatcg

    [0388] Protein Sequence Defining the Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Chain Variable Region (SEQ ID NO:66)

    TABLE-US-00102 1 qvqlvqsgaevkkpgssvkvsckasgytfsdynmdwvrqapgqglewmgqinpnnggiff 61 nqkfqgrvtltadkststaymelsslrsedtavyycareaittvgamdywgqgtlvtvss

    [0389] Nucleic Acid Sequence Encoding the Hu01G06 IGHV1-18 F1 Heavy Chain Variable Region (SEQ ID NO:245)

    TABLE-US-00103 1 caggtccagcttgtgcaatcgggagcggaagtgaagaaaccgggagcgtcggtaaaagtc 61 tcgtgcaaagcgtcggggtatacgtttacggactataacatggactgggtgcgccaagcg 121 cctggacagagccttgaatggatggggcagattaatccgtacaatcacctgatcttcttt 181 aatcagaaattccagggaagggtaacgctgacgacagacacgtcaacatcgacggcctat 241 atggaattgcggtcgttgcgatcagatgatacggcggtctactattgtgcgagggaggcg 301 attacgacggtgggagcgatggattattggggacaggggacgttggtaacggtatcgtcg

    [0390] Protein Sequence Defining the Hu01G06 IGHV1-18 F1 Heavy Chain Variable Region (SEQ ID NO:246)

    TABLE-US-00104 1 qvqlvqsgaevkkpgasvkvsckasgytftdynmdwvrqapgqslewmgqinpynhliff 61 nqkfqgrvtlttdtststaymelrslrsddtavyycareaittvgamdywgqgtlvtvss

    [0391] Nucleic Acid Sequence Encoding the Hu01G06 IGHV1-18 F2 Heavy Chain Variable Region (SEQ ID NO:247)

    TABLE-US-00105 1 caggtccagcttgtgcaatcgggagcggaagtgaagaaaccgggagcgtcggtaaaagtc 61 tcgtgcaaagcgtcggggtatacgtttacggactataacatggactgggtgcgccaagcg 121 cctggacagagccttgaatggatggggcagattaatccgaataatggactgatcttcttt 181 aatcagaaattccagggaagggtaacgctgacgacagacacgtcaacatcgacggcctat 241 atggaattgcggtcgttgcgatcagatgatacggcggtctactattgtgcgagggaggcg 301 attacgacggtgggagcgatggattattggggacaggggacgttggtaacggtatcgtcg

    [0392] Protein Sequence Defining the Hu01G06 IGHV1-18 F2 Heavy Chain Variable Region (SEQ ID NO:248)

    TABLE-US-00106 1 qvqlvqsgaevkkpgasvkvsckasgytftdynmdwvrqapgqslewmgqinpnngliff 61 nqkfqgrvtlttdtststaymelrslrsddtavyycareaittvgamdywgqgtlvtvss

    [0393] Nucleic Acid Sequence Encoding the Hu01G06 IGHV1-69 F1 Heavy Chain Variable Region (SEQ ID NO:249)

    TABLE-US-00107 1 caagtacagcttgtacagtcgggagcggaagtcaagaaaccgggatcgtcggtcaaagtg 61 tcgtgtaaagcgtcgggatatacgtttagcgactataacatggattgggtgcgacaagcg 121 cctgggcagggacttgaatggatgggtcagatcaatccgaataatgggctgatctttttc 181 aatcagaagtttaaagggagggtaacgctgacggcggataaaagcacgtcaacggcgtat 241 atggagttgtcgtcgttgcggtcggaggacacggcggtctattactgcgcgagggaagcg 301 attacgacggtgggagcgatggattattgggggcagggaacgcttgtaacggtgtcatcg

    [0394] Protein Sequence Defining the Hu01G06 IGHV1-69 F1 Heavy Chain Variable Region (SEQ ID NO:250)

    TABLE-US-00108 1 qvglvqsgaevkkpgssvkvsckasgytfsdynmdwvrqapgqglewmgqinpnngliff 61 nqkfkgrvtltadkststaymelsslrsedtavyycareaittvgamdywgqgtlvtvss

    [0395] Nucleic Acid Sequence Encoding the Hu01G06 IGHV1-69 F2 Heavy Chain Variable Region (SEQ ID NO:251)

    TABLE-US-00109 1 caagtacagcttgtacagtcgggagcggaagtcaagaaaccgggatcgtcggtcaaagtg 61 tcgtgtaaagcgtcgggatatacgtttagcgactataacatggattgggtgcgacaagcg 121 cctgggcagggacttgaatggatgggtcagatcaatccgtacaatcacctgatctttttc 181 aatcagaagtttaaagggagggtaacgctgacggcggataaaagcacgtcaacggcgtat 241 atggagttgtcgtcgttgcggtcggaggacacggcggtctattactgcgcgagggaagcg 301 attacgacggtgggagcgatggattattgggggcagggaacgcttgtaacggtgtcatcg

    [0396] Protein Sequence Defining the Hu01G06 IGHV1-69 F2 Heavy Chain Variable Region (SEQ ID NO:252)

    TABLE-US-00110 1 qvqlvqsgaevkkpgssvkvsckasgytfsdynmdwvrqapgqglewmgqinpynhliff 61 nqkfkgrvtltadkststaymelsslrsedtavyycareaittvgamdywgqgtlvtvss

    [0397] Nucleic Acid Sequence Encoding the Ch06C11 Chimeric Heavy Chain Variable Region (SEQ ID NO: 129)

    TABLE-US-00111 1 caggtgacactcaaagaatcaggacccggaatccttcagcccagccagaccttgtcgctg 61 acttgttcgttctccggtttcagcctgaatacttatgggatgggtgtgtcatggatcagg 121 caaccgtccgggaaaggattggagtggctcgcgcacatctactgggacgatgacaaacgc 181 tacaatccttcgctgaagagccgattgacgatttccaaggatgcctcgaacaaccgggta 241 tttcttaagatcacgtcggtcgatacggcagacacggcgacctattactgcgcccaaaga 301 gggtacgatgactattggggatattggggccaggggacactcgtcacaatttcagct

    [0398] Protein Sequence Defining the Ch06C11 Chimeric Heavy Chain Variable Region (SEQ ID NO:46)

    TABLE-US-00112 1 qvtlkesgpgilqpsqtlsltcsfsgfslntygmgvswirqpsgkglewlahiywdddkr 61 ynpslksrltiskdasnnrvflkitsvdtadtatyycaqrgyddywgywgqgtlvtisa

    [0399] Nucleic Acid Sequence Encoding the HE LM 06C11 IGHV2-70 Heavy Chain Variable Region (SEQ ID NO:67)

    TABLE-US-00113 1 caggtgactttgaaagaatccggtcccgcattggtaaagccaacccagacacttacgctc 61 acatgtacattttccggattcagcttgaacacttacgggatgggagtgtcgtggattcgg 121 caacctccggggaaggctctggagtggctggcgcacatctactgggatgatgacaaaagg 181 tataacccctcacttaaaacgagactgacgatctcgaaggacacaagcaagaatcaggtc 241 gtcctcacgattacgaatgtagacccggtggatactgccgtctattactgcgcgcaacgc 301 gggtatgatgactactggggatattggggtcagggcaccctcgtgaccatctcgtca

    [0400] Protein Sequence Defining the HE LM 06C11 IGHV2-70 Heavy Chain Variable Region (SEQ ID NO:68)

    TABLE-US-00114 1 qvtlkesgpalvkptqtltltctfsgfslntygmgvswirqppgkalewlahiywdddkr 61 ynpslktrltiskdtsknqvvltitnvdpvdtavyycaqrgyddywgywgqgtlvtiss

    [0401] Nucleic Acid Sequence Encoding the Hu06C11 IGHV2-5 Heavy Chain Variable Region (SEQ ID NO:69)

    TABLE-US-00115 1 caagtaacgctcaaggagtccggacccaccttggtgaagc cgacgcagaccttgactctt 61 acgtgcactttctcggggttttcactgaatacgtacggga tgggtgtctcatggatcagg 121 caacctccggggaaaggattggaatggctggcgcacatct actgggatgacgataagaga 181 tataacccaagcctcaagtcgcggctcaccattacaaaag atacatcgaaaaatcaggtc 241 gtacttactatcacgaacatggaccccgtggacacagcaa catattactgtgcccagcgc 301 ggctatgacgattattggggttactggggacagggaacac tggtcacggtgtccagc

    [0402] Protein Sequence Defining the Hu06C11 IGHV-2-5 Heavy Chain Variable Region (SEQ ID NO:70)

    TABLE-US-00116 1 qvtlkesgptlvkptqtltltctfsgfslntygmgvswir qppgkglewlahiywdddkr 61 ynpslksrltitkdtsknqvvltitnmdpvdtatyycaqr gyddywgywgqgtlvtvss

    [0403] Nucleic Acid Sequence Encoding the Ch14F11 Chimeric Heavy Chain Variable Region (SEQ ID NO:131)

    TABLE-US-00117 1 caggtcacgctgaaagagtcaggtcccggaatccttcaac cttcgcagacattgtcactc 61 acatgttccttctccgggttctcgctctcgacttatggca tgggtgtaggatggattcgg 121 cagcccagcgggaaggggcttgagtggttggcggatatct ggtgggacgacgacaaatac 181 tacaatccgagcctgaagtcccgcctcaccatttcgaaag atacgtcatcaaacgaagtc 241 tttttgaagatcgccatcgtggacacggcggatacagcga cgtattactgcgccagaagg 301 ggacactacagcgcaatggattattggggacaggggacct cggtgactgtgtcgtcc

    [0404] Protein Sequence Defining the Ch14F11 Chimeric Heavy Chain Variable Region (SEQ ID NO:50)

    TABLE-US-00118 1 qvtlkesgpgilqpsqtlsltcsfsgfslstygmgvgwir qpsgkglewladiwwdddky 61 ynpslksrltiskdtssnevflkiaivdtadtatyycarr ghysamdywgqgtsvtvss

    [0405] Nucleic Acid Sequence Encoding the Sh14F11 IGHV2-5 Heavy Chain Variable Region (SEQ ID NO:71)

    TABLE-US-00119 1 cagatcactttgaaagaaagcggaccgaccttggtcaagc ccacacaaaccctcacgctc 61 acgtgtacattttcggggttctcgctttcaacttacggga tgggagtagggtggattcgc 121 cagccgcctggtaaagcgttggagtggcttgcagacatct ggtgggacgacgataagtac 181 tataatccctcgctcaagtccagactgaccatcacgaaag atacgagcaagaaccaggtc 241 gtgctgacaatgactaacatggacccagtggatacggcta catattactgcgccaggcgg 301 ggtcactactcagcgatggattattggggccagggaacac tggtaacggtgtcgtcc

    [0406] Protein Sequence Defining the Sh14F11 IGHV2-5 Heavy Chain Variable Region (SEQ ID NO:72)

    TABLE-US-00120 1 qitlkesgptlvkptqtltltctfsgfslstygmgvgwir qppgkalewladiwwdddky 61 ynpslksrltitkdtsknqvvltmtnmdpvdtatyycarr ghysamdywgqgtlvtvss

    [0407] Nucleic Acid Sequence Encoding the Sh14F11 IGHV2-70 Heavy Chain Variable Region (SEQ ID NO:73)

    TABLE-US-00121 1 caagtgactctcaaggagtccggacccgccctggtcaaac caacgcagacactgacgctc 61 acatgcaccttcagcggattttcgttgtcaacgtacggca tgggtgtggggtggattcgc 121 cagcctccggggaaagcccttgaatggttggcggacatct ggtgggatgatgacaagtac 181 tataatccctcacttaagtcacggttgacgatctcgaaag acaccagcaagaaccaggta 241 gtgctgacaatgactaacatggacccggtcgatacagcgg tctactattgtgctagaagg 301 ggacactactccgcaatggattattggggtcaggggacgc tcgtaaccgtgtcgtcg

    [0408] Protein Sequence Defining the Sh14F11 IGHV2-70 Heavy Chain Variable Region (SEQ ID NO:74)

    TABLE-US-00122 1 qvtlkesgpalvkptqtltltctfsgfslstygmgvgwir qppgkalewladiwwdddky 61 ynpslksrltiskdtsknqvvltmtnmdpvdtavyycarr ghysamdywgqgtlvtvss

    [0409] Nucleic Acid Sequence Encoding the Ch01G06 Chimeric Kappa Chain Variable Region (SEQ ID NO:133)

    TABLE-US-00123 1 gacatccaaatgacccagtcacccgcgagcctttcggcgt cggtcggagaaacggtcacg 61 atcacgtgccggacatcagagaatctccataactacctcg cgtggtatcaacagaagcag 121 gggaagtcgccccagttgcttgtatacgatgcgaaaacgt tggcggatggggtgccgtcc 181 agattctcgggatcgggctcggggacgcagtactcgctca agatcaattcgctgcagccg 241 gaggactttgggtcgtactattgtcagcatttttggtcat caccgtatacatttggaggt 301 ggaacgaaacttgagattaag

    [0410] Protein Sequence Defining the Ch01G06 Chimeric Kappa Chain Variable Region (SEQ ID NO:76)

    TABLE-US-00124 1 diqmtqspaslsasvgetvtitcrtsenlhnylawyqqkq gkspqllvydaktladgvps 61 rfsgsgsgtqyslkinslqpedfgsyycqhfwsspytfgg gtkleik

    [0411] Nucleic Acid Sequence Encoding the Hu01G06 IGKV1-39 Kappa Chain Variable Region (SEQ ID NO:89)

    TABLE-US-00125 1 gacatccaaatgacccagtcgccgtcgtcgctttcagcgt cggtaggggatcgggtcaca 61 attacgtgccgaacgtcagagaatttgcataactacctcg cgtggtatcagcagaagccc 121 gggaagtcaccgaaactccttgtctacgatgcgaaaacgc tggcggatggagtgccgtcg 181 agattctcgggaagcggatccggtacggactatacgctta cgatctcatcgctccagccc 241 gaggactttgcgacgtactattgtcagcatttttggtcgt cgccctacacatttgggcag 301 gggaccaagttggaaatcaag

    [0412] Protein Sequence Defining the Hu01G06 IGKV1-39 Kappa Chain Variable Region (SEQ ID NO:90)

    TABLE-US-00126 1 diqmtqspsslsasvgdrvtitcrtsenlhnylawyqqkp gkspkllvydaktladgvps 61 rfsgsgsgtdytltisslqpedfatyycqhfwsspytfgq gtkleik

    [0413] Nucleic Acid Sequence Encoding the Hu01G06 IGKV1-39 S43A V48I Kappa Chain Variable Region (Also Referred to Herein as Hu01G06 IGKV1-39 F1 Kappa Chain Variable Region; SEQ ID NO:91)

    TABLE-US-00127 1 gacatccaaatgacccagtcgccgtcgtcgctttcagcgt cggtaggggatcgggtcaca 61 attacgtgccgaacgtcagagaatttgcataactacctcg cgtggtatcagcagaagccc 121 gggaaggccccgaaactccttatctacgatgcgaaaacgc tggcggatggagtgccgtcg 181 agattctcgggaagcggatccggtacggactatacgctta cgatctcatcgctccagccc 241 gaggactttgcgacgtactattgtcagcatttttggtcgt cgccctacacatttgggcag 301 gggaccaagttggaaatcaag

    [0414] Protein Sequence Defining the Hu01G06 IGKV1-39 S43A V48I Kappa Chain Variable Region (Also Referred to Herein as Hu01G06 IGKV1-39 F1 Kappa Chain Variable Region; SEQ ID NO:92)

    TABLE-US-00128 1 diqmtqspsslsasvgdrvtitcrtsenlhnylawyqqkp gkapklliydaktladgvps 61 rfsgsgsgtdytltisslqpedfatyycqhfwsspytfgq gtkleik

    [0415] Nucleic Acid Sequence Encoding the Hu01G06 IGKV1-39 V48I Kappa Chain Variable Region (SEQ ID NO:93)

    TABLE-US-00129 1 gacatccaaatgacccagtcgccgtcgtcgctttcagcgt cggtaggggatcgggtcaca 61 attacgtgccgaacgtcagagaatttgcataactacctcg cgtggtatcagcagaagccc 121 gggaagtcaccgaaactccttatctacgatgcgaaaacgc tggcggatggagtgccgtcg 181 agattctcgggaagcggatccggtacggactatacgctta cgatctcatcgctccagccc 241 gaggactttgcgacgtactattgtcagcatttttggtcgt cgccctacacatttgggcag 301 gggaccaagttggaaatcaag

    [0416] Protein Sequence Defining the Hu01G06 IGKV1-39 V48I Kappa Chain Variable Region (SEQ ID NO:94)

    TABLE-US-00130 1 diqmtqspsslsasvgdrvtitcrtsenlhnylawyqqkp gkspklliydaktladgvps 61 rfsgsgsgtdytltisslqpedfatyycqhfwsspytfgq gtkleik

    [0417] Nucleic Acid Sequence Encoding the Hu01G06 IGKV1-39 F1 Kappa Chain Variable Region (Also Referred to Herein as Hu01G06 IGKV1-39 S43A V48I Kappa Chain Variable Region; SEQ ID NO:91)

    TABLE-US-00131 1 gacatccaaatgacccagtcgccgtcgtcgctttcagcgt cggtaggggatcgggtcaca 61 attacgtgccgaacgtcagagaatttgcataactacctcg cgtggtatcagcagaagccc 121 gggaaggccccgaaactccttatctacgatgcgaaaacgc tggcggatggagtgccgtcg 181 agattctcgggaagcggatccggtacggactatacgctta cgatctcatcgctccagccc 241 gaggactttgcgacgtactattgtcagcatttttggtcgt cgccctacacatttgggcag 301 gggaccaagttggaaatcaag

    [0418] Protein Sequence Defining the Hu01G06 IGKV1-39 F1 Kappa Chain Variable Region (Also Referred to Herein as Hu01G06 IGKV1-39 S43A V48I Kappa Chain Variable Region; SEQ ID NO:92)

    TABLE-US-00132 1 diqmtqspsslsasvgdrvtitcrtsenlhnylawyqqkp gkapklliydaktladgvps 61 rfsgsgsgtdytltisslqpedfatyycqhfwsspytfgq gtkleik

    [0419] Nucleic Acid Sequence Encoding the Hu01G06 IGKV1-39 F2 Kappa Chain Variable Region (SEQ ID NO:253)

    TABLE-US-00133 1 gacatccaaatgacccagtcgccgtcgtcgctttcagcgt cggtaggggatcgggtcaca 61 attacgtgccgaacgtcagagaatttgcataactacctcg cgtggtatcagcagaagccc 121 gggaagtcaccgaaactccttatctacgatgcgaaaacgc tggcggatggagtgccgtcg 181 agattctcgggaagcggatccggtacggactatacgctta cgatctcatcgctccagccc 241 gaggactttgcgacgtactattgtcagcatttttggtcgg acccctacacatttgggcag 301 gggaccaagttggaaatcaag

    [0420] Protein Sequence Defining the Hu01G06 IGKV1-39 F2 Kappa Chain Variable Region (SEQ ID NO:254)

    TABLE-US-00134 1 diqmtqspsslsasvgdrvtitcrtsenlhnylawyqqkp gkspklliydaktladgvps 61 rfsgsgsgtdytltisslqpedfatyycqhfwsdpytfgq gtkleik

    [0421] Nucleic Acid Sequence Encoding the Ch06C11 Chimeric Kappa Chain Variable Region (SEQ ID NO:135)

    TABLE-US-00135 1 gatatcgtcatgacccagtcccagaagttcatgtcaactt cagtgggagacagagtgtcc 61 gtcacatgtaaagcctcgcaaaatgtgggaaccaacgtag cgtggttccagcagaaacct 121 ggccaatcaccgaaggcactgatctactcggccagctata ggtactcgggagtaccagat 181 cggtttacggggtcggggagcgggacggactttatcctca ctatttccaatgtccagtcg 241 gaggaccttgcggaatacttctgccagcagtataacaact atcccctcacgtttggtgct 301 ggtacaaaattggagttgaag

    [0422] Protein Sequence Defining the Ch06C11 Chimeric Kappa Chain Variable Region (SEQ ID NO:82)

    TABLE-US-00136 1 divmtqsqkfmstsvgdrvsvtckasqnvgtnvawfqqkp gqspkaliysasyrysgvpd 61 rftgsgsgtdfiltisnvqsedlaeyfcqqynnypltfga gtklelk

    [0423] Nucleic Acid Sequence Encoding the Sh06C11 IGKV1-16 Kappa Chain Variable Region (SEQ ID NO:95)

    TABLE-US-00137 1 gacatccaaatgacccaatcgccctcctccctctccgcat cagtaggggaccgcgtcaca 61 attacttgcaaagcgtcgcagaacgtcggaacgaatgtgg cgtggtttcagcagaagccc 121 ggaaaagctccgaagagcttgatctactcggcctcatata ggtattcgggtgtgccgagc 181 cggtttagcgggtcggggtcaggtactgatttcacgctca caatttcatcgttgcagcca 241 gaagatttcgccacatattactgtcagcagtacaacaatt accctctgacgttcggccag 301 ggaaccaaacttgagatcaag

    [0424] Protein Sequence Defining the Sh06C11 IGKV1-16 Kappa Chain Variable Region (SEQ ID NO:96)

    TABLE-US-00138 1 diqmtqspsslsasvgdrvtitckasqnvgtnvawfqqkp gkapksliysasyrysgvps 61 rfsgsgsgtdftltisslqpedfatyycqqynnypltfgq gtkleik

    [0425] Nucleic Acid Sequence Encoding the Ch14F11 Chimeric Kappa Chain Variable Region (SEQ ID NO: 137)

    TABLE-US-00139 1 gacatcgtgatgacacagtcacagaaattcatgtccacat ccgtcggtgatagagtatcc 61 gtcacgtgtaaggcctcgcaaaacgtaggaactaatgtgg cgtggtatcaacagaagcca 121 ggacagtcacccaaagcactcatctacagcccctcatatc ggtacagcggggtgccggac 181 aggttcacgggatcggggagcgggaccgattttacactga ccatttcgaatgtccagtcg 241 gaggaccttgcggaatacttctgccagcagtataactcgt accctcacacgtttggaggt 301 ggcactaagttggagatgaaa

    [0426] Protein Sequence Defining the Ch14F11 Chimeric Kappa Chain Variable Region (SEQ ID NO:86)

    TABLE-US-00140 1 divmtqsqkfmstsvgdrvsvtckasqnvgtnvawyqqkp gqspkaliyspsyrysgvpd 61 rftgsgsgtdftltisnvqsedlaeyfcqqynsyphtfgg gtklemk

    [0427] Nucleic Acid Sequence Encoding the Hu14F11 IGKV1-16 Kappa Chain Variable Region (SEQ ID NO:97)

    TABLE-US-00141 1 gatatccagatgacacagtcaccctcgtcgctctcagctt ccgtaggcgacagggtcact 61 attacgtgtaaagcatcacagaacgtcggaacgaatgtgg cgtggtttcagcagaagccc 121 gggaagagccccaaagcgcttatctactccccgtcgtatc ggtattccggtgtgccaagc 181 agattttcggggtcaggttcgggaactgactttaccctga ccatctcgtccctccaaccg 241 gaagatttcgccacgtacttctgccagcagtacaacagct atcctcacacattcggacaa 301 gggacaaagttggagattaaa

    [0428] Protein Sequence Defining the Hu14F11 IGKV1-16 Kappa Chain Variable Region (SEQ ID NO:98)

    TABLE-US-00142 1 diqmtqspsslsasvgdrvtitckasqnvgtnvawfqqkp gkspkaliyspsyrysgvps 61 rfsgsgsgtdftltisslqpedfatyfcqqynsyphtfgq gtkleik

    [0429] The amino acid sequences defining the immunoglobulin heavy chain variable regions for the antibodies produced in Example 13 are aligned in FIG. 19. Amino terminal signal peptide sequences (for proper expression/secretion) are not shown. CDR.sub.1, CDR.sub.2, and CDR.sub.3 (Kabat definition) are identified by boxes. FIG. 20 show an alignment of the separate CDR.sub.1, CDR.sub.2, and CDR.sub.3 sequences for each of the variable region sequences shown in FIG. 19.

    [0430] The amino acid sequences defining the immunoglobulin light chain variable regions for the antibodies in Example 13 are aligned in FIG. 21. Amino terminal signal peptide sequences (for proper expression/secretion) are not shown. CDR.sub.1, CDR.sub.2 and CDR.sub.3 are identified by boxes. FIG. 22 shows an alignment of the separate CDR.sub.1, CDR.sub.2, and CDR.sub.3 sequences for each of the variable region sequences shown in FIG. 21.

    [0431] Table 19 is a concordance chart showing the SEQ ID NO. of each sequence discussed in this Example.

    TABLE-US-00143 TABLE 19 SEQ. ID NO. Nucleic Acid or Protein 127 Ch01G06 Chimeric Heavy Chain Variable Region-nucleic acid 40 Ch01G06 Chimeric Heavy Chain Variable Region-protein 1 Ch01G06 Chimeric Heavy Chain CDR.sub.1 7 Ch01G06 Chimeric Heavy Chain CDR.sub.2 15 Ch01G06 Chimeric Heavy Chain CDR.sub.3 53 Hu01G06 IGHV1-18 Heavy Chain Variable Region-nucleic acid 54 Hu01G06 IGHV1-18 Heavy Chain Variable Region-protein 1 Hu01G06 IGHV1-18 Heavy Chain CDR.sub.1 7 Hu01G06 IGHV1-18 Heavy Chain CDR.sub.2 15 Hu01G06 IGHV1-18 Heavy Chain CDR.sub.3 55 Hu01G06 IGHV1-69 Heavy Chain Variable Region-nucleic acid 56 Hu01G06 IGHV1-69 Heavy Chain Variable Region-protein 1 Hu01G06 IGHV1-69 Heavy Chain CDR.sub.1 7 Hu01G06 IGHV1-69 Heavy Chain CDR.sub.2 15 Hu01G06 IGHV1-69 Heavy Chain CDR.sub.3 57 Sh01G06 IGHV1-18 M69L Heavy Chain Variable Region-nucleic acid 58 Sh01G06 IGHV1-18 M69L Heavy Chain Variable Region-protein 1 Sh01G06 IGHV1-18 M69L Heavy Chain CDR.sub.1 7 Sh01G06 IGHV1-18 M69L Heavy Chain CDR.sub.2 15 Sh01G06 IGHV1-18 M69L Heavy Chain CDR.sub.3 59 Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain Variable Region-nucleic acid 60 Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain Variable Region-protein 1 Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain CDR.sub.1 13 Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain CDR.sub.2 15 Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain CDR.sub.3 61 Sh01G06 IGHV1-18 M69L K64Q Heavy Chain Variable Region-nucleic acid 62 Sh01G06 IGHV1-18 M69L K64Q Heavy Chain Variable Region-protein 1 Sh01G06 IGHV1-18 M69L K64Q Heavy Chain CDR.sub.1 13 Sh01G06 IGHV1-18 M69L K64Q Heavy Chain CDR.sub.2 15 Sh01G06 IGHV1-18 M69L K64Q Heavy Chain CDR.sub.3 63 Sh01G06 IGHV1-69 T30S I69L Heavy Chain Variable Region-nucleic acid 64 Sh01G06 IGHV1-69 T30S I69L Heavy Chain Variable Region-protein 1 Sh01G06 IGHV1-69 T30S I69L Heavy Chain CDR.sub.1 7 Sh01G06 IGHV1-69 T30S I69L Heavy Chain CDR.sub.2 15 Sh01G06 IGHV1-69 T30S I69L Heavy Chain CDR.sub.3 65 Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Chain Variable Region-nucleic acid 66 Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Chain Variable Region-protein 1 Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Chain CDR.sub.1 13 Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Chain CDR.sub.2 15 Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Chain CDR.sub.3 245 Hu01G06 IGHV1-18 F1 Heavy Chain Variable Region-nucleic acid 246 Hu01G06 IGHV1-18 F1 Heavy Chain Variable Region-protein 1 Hu01G06 IGHV1-18 F1 Heavy Chain CDR.sub.1 236 Hu01G06 IGHV1-18 F1 Heavy Chain CDR.sub.2 15 Hu01G06 IGHV1-18 F1 Heavy Chain CDR.sub.3 247 Hu01G06 IGHV1-18 F2 Heavy Chain Variable Region-nucleic acid 248 Hu01G06 IGHV1-18 F2 Heavy Chain Variable Region-protein 1 Hu01G06 IGHV1-18 F2 Heavy Chain CDR.sub.1 237 Hu01G06 IGHV1-18 F2 Heavy Chain CDR.sub.2 15 Hu01G06 IGHV1-18 F2 Heavy Chain CDR.sub.3 259 Hu01G06 IGHV1-69 F1 Heavy Chain Variable Region-nucleic acid 250 Hu01G06 IGHV1-69 F1 Heavy Chain Variable Region-protein 1 Hu01G06 IGHV1-69 F1 Heavy Chain CDR.sub.1 238 Hu01G06 IGHV1-69 F1 Heavy Chain CDR.sub.2 15 Hu01G06 IGHV1-69 F1 Heavy Chain CDR.sub.3 251 Hu01G06 IGHV1-69 F2 Heavy Chain Variable Region-nucleic acid 252 Hu01G06 IGHV1-69 F2 Heavy Chain Variable Region-protein 1 Hu01G06 IGHV1-69 F2 Heavy Chain CDR.sub.1 239 Hu01G06 IGHV1-69 F2 Heavy Chain CDR.sub.2 15 Hu01G06 IGHV1-69 F2 Heavy Chain CDR.sub.3 129 Ch06C11 Chimeric Heavy Chain Variable Region-nucleic acid 46 Ch06C11 Chimeric Heavy Chain Variable Region-protein 4 Ch06C11 Chimeric Heavy Chain CDR.sub.1 9 Ch06C11 Chimeric Heavy Chain CDR.sub.2 18 Ch06C11 Chimeric Heavy Chain CDR.sub.3 67 HE LM 06C11 IGHV2-70 Heavy Chain Variable Region-nucleic acid 68 HE LM 06C11 IGHV2-70 Heavy Chain Variable Region-protein 4 HE LM 06C11 IGHV2-70 Heavy Chain CDR.sub.1 14 HE LM 06C11 IGHV2-70 Heavy Chain CDR.sub.2 18 HE LM 06C11 IGHV2-70 Heavy Chain CDR.sub.3 69 Hu06C11 IGHV2-5 Heavy Chain Variable Region-nucleic acid 70 Hu06C11 IGHV2-5 Heavy Chain Variable Region-protein 4 Hu06C11 IGHV2-5 Heavy Chain CDR.sub.1 9 Hu06C11 IGHV2-5 Heavy Chain CDR.sub.2 18 Hu06C11 IGHV2-5 Heavy Chain CDR.sub.3 131 Ch14F11 Chimeric Heavy Chain Variable Region-nucleic acid 50 Ch14F11 Chimeric Heavy Chain Variable Region-protein 5 Ch14F11 Chimeric Heavy Chain CDR.sub.1 11 Ch14F11 Chimeric Heavy Chain CDR.sub.2 19 Ch14F11 Chimeric Heavy Chain CDR.sub.3 71 Sh14F11 IGHV2-5 Heavy Chain Variable Region-nucleic acid 72 Sh14F11 IGHV2-5 Heavy Chain Variable Region-protein 5 Sh14F11 IGHV2-5 Heavy Chain CDR.sub.1 11 Sh14F11 IGHV2-5 Heavy Chain CDR.sub.2 19 Sh14F11 IGHV2-5 Heavy Chain CDR.sub.3 73 Sh14F11 IGHV2-70 Heavy Chain Variable Region-nucleic acid 74 Sh14F11 IGHV2-70 Heavy Chain Variable Region-protein 5 Sh14F11 IGHV2-70 Heavy Chain CDR.sub.1 11 Sh14F11 IGHV2-70 Heavy Chain CDR.sub.2 19 Sh14F11 IGHV2-70 Heavy Chain CDR.sub.3 133 Ch01G06 Chimeric Light (kappa) Chain Variable Region-nucleic acid 76 Ch01G06 Chimeric Light (kappa) Chain Variable Region-protein 21 Ch01G06 Chimeric Light (kappa) Chain CDR.sub.1 26 Ch01G06 Chimeric Light (kappa) Chain CDR.sub.2 32 Ch01G06 Chimeric Light (kappa) Chain CDR.sub.3 89 Hu01G06 IGKV1-39 Light (kappa) Chain Variable Region-nucleic acid 90 Hu01G06 IGKV1-39 Light (kappa) Chain Variable Region-protein 21 Hu01G06 IGKV1-39 Light (kappa) Chain CDR.sub.1 26 Hu01G06 IGKV1-39 Light (kappa) Chain CDR.sub.2 32 Hu01G06 IGKV1-39 Light (kappa) Chain CDR.sub.3 91 Hu01G06 IGKV1-39 S43A V48I Light (kappa) Chain Variable Region-nucleic acid 92 Hu01G06 IGKV1-39 S43A V48I Light (kappa) Chain Variable Region-protein 21 Hu01G06 IGKV1-39 S43A V48I Light (kappa) Chain CDR.sub.1 26 Hu01G06 IGKV1-39 S43A V48I Light (kappa) Chain CDR.sub.2 32 Hu01G06 IGKV1-39 S43A V48I Light (kappa) Chain CDR.sub.3 93 Hu01G06 IGKV1-39 V48I Light (kappa) Chain Variable Region-nucleic acid 94 Hu01G06 IGKV1-39 V48I Light (kappa) Chain Variable Region-protein 21 Hu01G06 IGKV1-39 V48I Light (kappa) Chain CDR.sub.1 26 Hu01G06 IGKV1-39 V48I Light (kappa) Chain CDR.sub.2 32 Hu01G06 IGKV1-39 V48I Light (kappa) Chain CDR.sub.3 91 Hu01G06 IGKV1-39 F1 Light (kappa) Chain Variable Region-nucleic acid 92 Hu01G06 IGKV1-39 F1 Light (kappa) Chain Variable Region-protein 21 Hu01G06 IGKV1-39 F1 Light (kappa) Chain CDR.sub.1 26 Hu01G06 IGKV1-39 F1 Light (kappa) Chain CDR.sub.2 32 Hu01G06 IGKV1-39 F1 Light (kappa) Chain CDR.sub.3 253 Hu01G06 IGKV1-39 F2 Light (kappa) Chain Variable Region-nucleic acid 254 Hu01G06 IGKV1-39 F2 Light (kappa) Chain Variable Region-protein 21 Hu01G06 IGKV1-39 F2 Light (kappa) Chain CDR.sub.1 26 Hu01G06 IGKV1-39 F2 Light (kappa) Chain CDR.sub.2 244 Hu01G06 IGKV1-39 F2 Light (kappa) Chain CDR.sub.3 135 Ch06C11 Chimeric Light (kappa) Chain Variable Region-nucleic acid 82 Ch06C11 Chimeric Light (kappa) Chain Variable Region-protein 23 Ch06C11 Chimeric Light (kappa) Chain CDR.sub.1 28 Ch06C11 Chimeric Light (kappa) Chain CDR.sub.2 35 Ch06C11 Chimeric Light (kappa) Chain CDR.sub.3 95 Sh06C11 IGKV1-16 Light (kappa) Chain Variable Region-nucleic acid 96 Sh06C11 IGKV1-16 Light (kappa) Chain Variable Region-protein 23 Sh06C11 IGKV1-16 Light (kappa) Chain CDR.sub.1 28 Sh06C11 IGKV1-16 Light (kappa) Chain CDR.sub.2 35 Sh06C11 IGKV1-16 Light (kappa) Chain CDR.sub.3 137 Ch14F11 Chimeric Light (kappa) Chain Variable Region-nucleic acid 86 Ch14F11 Chimeric Light (kappa) Chain Variable Region-protein 23 Ch14F11 Chimeric Light (kappa) Chain CDR.sub.1 30 Ch14F11 Chimeric Light (kappa) Chain CDR.sub.2 36 Ch14F11 Chimeric Light (kappa) Chain CDR.sub.3 97 Hu14F11 IGKV1-16 Light (kappa) Chain Variable Region-nucleic acid 98 Hu14F11 IGKV1-16 Light (kappa) Chain Variable Region-protein 23 Hu14F11 IGKV1-16 Light (kappa) Chain CDR.sub.1 30 Hu14F11 IGKV1-16 Light (kappa) Chain CDR.sub.2 36 Hu14F11 IGKV1-16 Light (kappa) Chain CDR.sub.3

    [0432] Humanized monoclonal antibody heavy chain CDR sequences (Kabat, Chothia, and IMGT definitions) are shown in Table 20.

    TABLE-US-00144 TABLE20 VariableRegion CDR1 CDR2 CDR3 SEQIDNO: Kabat Ch01G06Chimeric DYNMD QINPNNGGIFFNQKFKG EAITTVGAMDY 40 (SEQIDNO:1) (SEQIDNO:7) (SEQIDNO:15) Hu01G06IGHV1- DYNMD QINPNNGGIFFNQKFKG EAITTVGAMDY 54 18 (SEQIDNO:1) (SEQIDNO:7) (SEQIDNO:15) Hu01G06IGHV1- DYNMD QINPNNGGIFFNQKFKG EAITTVGAMDY 56 69 (SEQIDNO:1) (SEQIDNO:7) (SEQIDNO:15) Sh01G06IGHV1- DYNMD QINPNNGGIFFNQKFKG EAITTVGAMDY 58 18M69L (SEQIDNO:1) (SEQIDNO:7) (SEQIDNO:15) Sh01G06IGHV1- DYNMD QINPNNGGIFFNQKFQG EAITTVGAMDY 60 18M69LK64Q (SEQIDNO:1) (SEQIDNO:13) (SEQIDNO:15) G44S Sh01G06IGHV1- DYNMD QINPNNGGIFFNQKFQG EAITTVGAMDY 62 18M69LK64Q (SEQIDNO:1) (SEQIDNO:13) (SEQIDNO:15) Sh01G06IGHV1- DYNMD QINPNNGGIFFNQKFKG EAITTVGAMDY 64 69T30SI69L (SEQIDNO:1) (SEQIDNO:7) (SEQIDNO:15) Sh01G06IGHV1- DYNMD QINPNNGGIFFNQKFQG EAITTVGAMDY 66 69T30SK64Q (SEQIDNO:1) (SEQIDNO:13) (SEQIDNO:15) I69L Hu01G06IGHV1- DYNMD QINPYNHLIFFNQKFQG EAITTVGAMDY 246 18F1 (SEQIDNO:1) (SEQIDNO:236) (SEQIDNO:15) Hu01G06IGHV1- DYNMD QINPNNGLIFFNQKFQG EAITTVGAMDY 248 18F2 (SEQIDNO:1) (SEQIDNO:237) (SEQIDNO:15) Hu01G06IGHV1- DYNMD QINPNNGLIFFNQKFKG EAITTVGAMDY 250 69F1 (SEQIDNO:1) (SEQIDNO:238) (SEQIDNO:15) Hu01G06IGHV1- DYNMD QINPYNHLIFFNQKFKG EAITTVGAMDY 252 69F2 (SEQIDNO:1) (SEQIDNO:239) (SEQIDNO:15) Ch06C11Chimeric TYGMGVS HIYWDDDKRYNPSLKS RGYDDYWGY 46 (SEQIDNO:4) (SEQIDNO:9) (SEQIDNO:18) HELM06C11 TYGMGVS HIYWDDDKRYNPSLKT RGYDDYWGY 68 IGHV2-70 (SEQIDNO:4) (SEQIDNO:14) (SEQIDNO:18) Hu06C11IGHV2- TYGMGVS HIYWDDDKRYNPSLKS RGYDDYWGY 70 5 (SEQIDNO:4) (SEQIDNO:9) (SEQIDNO:18) Ch14F11Chimeric TYGMGVG DIWWDDDKYYNPSLKS RGHYSAMDY 50 (SEQIDNO:5) (SEQIDNO:11) (SEQIDNO:19) Sh14F11IGHV2-5 TYGMGVG DIWWDDDKYYNPSLKS RGHYSAMDY 72 (SEQIDNO:5) (SEQIDNO:11) (SEQIDNO:19) Sh14F11IGHV2- TYGMGVG DIWWDDDKYYNPSLKS RGHYSAMDY 74 70 (SEQIDNO:5) (SEQIDNO:11) (SEQIDNO:19) Chothia Ch01G06 GYTFTDY NPNNGG EAITTVGAMDY 40 Chimeric (SEQIDNO:38) (SEQIDNO:143) (SEQIDNO:15) Hu0106IGHV1- GYTFTDY NPNNGG EAITTVGAMDY 54 18 (SEQIDNO:38) (SEQIDNO:143) (SEQIDNO:15) Hu01G06IGHV1- GYTFTDY NPNNGG EAITTVGAMDY 56 69 (SEQIDNO:38) (SEQIDNO:143) (SEQIDNO:15) Sh01G06IGHV1- GYTFTDY NPNNGG EAITTVGAMDY 58 18M69L (SEQIDNO:38) (SEQIDNO:143) (SEQIDNO:15) Sh01G06IGHV1- GYTFTDY NPNNGG EAITTVGAMDY 60 18M69LK64Q (SEQIDNO:38) (SEQIDNO:143) (SEQIDNO:15) G44S Sh01G06IGHV1- GYTFTDY NPNNGG EAITTVGAMDY 62 18M69LK64Q (SEQIDNO:38) (SEQIDNO:143) (SEQIDNO:15) Sh01G06IGHV1- GYTFSDY NPNNGG EAITTVGAMDY 64 69T30SI69L (SEQIDNO:234) (SEQIDNO:143) (SEQIDNO:15) Sh01G06IGHV1- GYTFSDY NPNNGG EAITTVGAMDY 66 69T30SK64Q (SEQIDNO:234) (SEQIDNO:143) (SEQIDNO:15) I69L Hu01G06IGHV1- GYTFTDY NPYNHL EAITTVGAMDY 246 18F1 (SEQIDNO:38) (SEQIDNO:240) (SEQIDNO:15) Hu01G06IGHV1- GYTFTDY NPNNGL EAITTVGAMDY 248 18F2 (SEQIDNO:38) (SEQIDNO:241) (SEQIDNO:15) Hu01G06IGHV1- GYTFSDY NPNNGL EAITTVGAMDY 250 69Fl (SEQIDNO:234) (SEQIDNO:241) (SEQIDNO:15) Hu01G06IGHV1- GYTFSDY NPYNHL EAITTVGAMDY 252 69F2 (SEQIDNO:234) (SEQIDNO:240) (SEQIDNO:15) Ch06C11 GFSLNTYGM YWDDD RGYDDYWGY 46 Chimeric (SEQIDNO:132) (SEQIDNO:145) (SEQIDNO:18) HELM06C11 GFSLNTYGM YWDDD RGYDDYWGY 68 IGHV2-70 (SEQIDNO:132) (SEQIDNO:145) (SEQIDNO:18) Hu06C11IGHV2- GFSLNTYGM YWDDD RGYDDYWGY 70 5 (SEQIDNO:132) (SEQIDNO:145) (SEQIDNO:18) Ch14F11Chimeric GFSLSTYGM WWDDD RGHYSAMDY 50 (SEQIDNO:130) (SEQIDNO:146) (SEQIDNO:19) GFSLSTYGM WWDDD RGHYSAMDY 72 Sh14F11IGHV2-5 (SEQIDNO:130) (SEQIDNO:146) (SEQIDNO:19) Sh14F11IGHV2- GFSLSTYGM WWDDD RGHYSAMDY 74 70 (SEQIDNO:130) (SEQIDNO:146) (SEQIDNO:19) IMGT Ch01G06 GYTFTDYN INPNNGGI AREAITTVGAMDY 40 Chimeric (SEQIDNO:136) (SEQIDNO:148) (SEQIDNO:154) Hu01G06 GYTFTDYN INPNNGGI AREAITTVGAMDY 54 IGHV1-18 (SEQIDNO:136) (SEQIDNO:148) (SEQIDNO:154) Hu01G06 GYTFTDYN INPNNGGI AREAITTVGAMDY 56 IGHV1-69 (SEQIDNO:136) (SEQIDNO:148) (SEQIDNO:154) Sh01G06 GYTFTDYN INPNNGGI AREAITTVGAMDY 58 IGHV1-18M69L (SEQIDNO:136) (SEQIDNO:148) (SEQIDNO:154) Sh01G06 GYTFTDYN INPNNGGI AREAITTVGAMDY 60 IGHV1-18M69L (SEQIDNO:136) (SEQIDNO:148) (SEQIDNO:154) K64QG44S Sh01G06 GYTFTDYN INPNNGGI AREAITTVGAMDY 62 IGHV1-18M69L (SEQIDNO:136) (SEQIDNO:148) (SEQIDNO:154) K64Q Sh01G06 GYTFSDYN INPNNGGI AREAITTVGAMDY 64 IGHV1-69T30S (SEQIDNO:235) (SEQIDNO:148) (SEQIDNO:154) I69L Sh01G06 GYTFSDYN INPNNGGI AREAITTVGAMDY 66 IGHV1-69T30S (SEQIDNO:235) (SEQIDNO:148) (SEQIDNO:154) K64QI69L Hu01G06 GYTFTDYN INPYNHLI AREAITTVGAMDY 246 IGHV1-18F1 (SEQIDNO:136) (SEQIDNO:242) (SEQIDNO:154) Hu01G06 GYTFTDYN INPNNGLI AREAITTVGAMDY 248 IGHV1-18F2 (SEQIDNO:136) (SEQIDNO:243) (SEQIDNO:154) Hu01G06 GYTFSDYN INPNNGLI AREAITTVGAMDY 250 IGHV1-69F1 (SEQIDNO:235) (SEQIDNO:243) (SEQIDNO:154) Hu01G06 GYTFSDYN INPYNHLI AREAITTVGAMDY 252 IGHV1-69F2 (SEQIDNO:235) (SEQIDNO:242) (SEQIDNO:154) Ch06C11 GFSLNTYGMG IYWDDDK AQRGYDDYWGY 46 Chimeric (SEQIDNO:141) (SEQIDNO:150) (SEQIDNO:157) HELM06C11 GFSLNTYGMG IYWDDDK AQRGYDDYWGY 68 IGHV2-70 (SEQIDNO:141) (SEQIDNO:150) (SEQIDNO:157) Hu06C11 GFSLNTYGMG IYWDDDK AQRGYDDYWGY 70 IGHV2-5 (SEQIDNO:141) (SEQIDNO:150) (SEQIDNO:157) Ch14F11 GFSLSTYGMG IWWDDDK ARRGHYSAMDY 50 Chimeric (SEQIDNO:140) (SEQIDNO:152) (SEQIDNO:158) Sh14F11IGHV2- GFSLSTYGMG IWWDDDK ARRGHYSAMDY 72 5 (SEQIDNO:140) (SEQIDNO:152) (SEQIDNO:158) Sh14F11IGHV2- GFSLSTYGMG IWWDDDK ARRGHYSAMDY 74 70 (SEQIDNO:140) (SEQIDNO:152) (SEQIDNO:158)

    [0433] Humanized monoclonal antibody Kappa light chain CDR sequences (Kabat, Chothia, and IMGT definitions) are shown in Table 21.

    TABLE-US-00145 TABLE21 VariableRegion CDR1 CDR2 CDR3 SEQIDNO: Kabat/Chothia Ch01G06Chimeric RTSENLHNYLA DAKTLAD QHFWSSPYT 76 (SEQIDNO:21) (SEQIDNO:26) (SEQIDNO:32) Hu01G06IGKV1-39 RTSENLHNYLA DAKTLAD QHFWSSPYT 90 (SEQIDNO:21) (SEQIDNO:26) (SEQIDNO:32) Hu01G06IGKV1-39 RTSENLHNYLA DAKTLAD QHFWSSPYT 92 S43AV48I(also (SEQIDNO:21) (SEQIDNO:26) (SEQIDNO:32) knownasHu0106 IGKV1-39F1) Hu01G06IGKV1-39 RTSENLHNYLA DAKTLAD QHFWSSPYT 94 V48I (SEQIDNO:21) (SEQIDNO:26) (SEQIDNO:32) Hu01G06IGKV1-39 RTSENLHNYLA DAKTLAD QHFWSSPYT 92 F1(alsoknownas (SEQIDNO:21) (SEQIDNO:26) (SEQIDNO:32) Hu01G06IGKV1-39 S43AV481) Hu01G06IGKV1-39 RTSENLHNYLA DAKTLAD QHFWSDPYT 254 F2 (SEQIDNO:21) (SEQIDNO:26) (SEQIDNO:244) Ch06C11Chimeric KASQNVGTNVA SASYRYS QQYNNYPLT 82 (SEQIDNO:23) (SEQIDNO:28) (SEQIDNO:35) Sh06C11IGKV1-16 KASQNVGTNVA SASYRYS QQYNNYPLT 96 (SEQIDNO:23) (SEQIDNO:28) (SEQIDNO:35) Ch14F11Chimeric KASQNVGTNVA SPSYRYS QQYNSYPHT 86 (SEQIDNO:23) (SEQIDNO:30) (SEQIDNO:36) Hu14F11IGKV1-16 KASQNVGTNVA SPSYRYS QQYNSYPHT 98 (SEQIDNO:23) (SEQIDNO:30) (SEQIDNO:36) IMGT Ch01G06Chimeric ENLHNY DAK QHFWSSPYT 76 (SEQIDNO:160) (SEQIDNO:32) Hu01G06IGKV1-39 ENLHNY DAK QHFWSSPYT 90 (SEQIDNO:160) (SEQIDNO:32) Hu01G06IGKV1-39 ENLHNY DAK QHFWSSPYT 92 S43AV48I(also (SEQIDNO:160) (SEQIDNO:32) knownasHu01G06 IGKV1-39Fl) Hu01G06IGKV1-39 ENLHNY DAK QHFWSSPYT 94 V48I (SEQIDNO:160) DAK (SEQIDNO:32) Hu01G06IGKV1-39 ENLHNY QHFWSSPYT 92 F1(alsoknownas (SEQIDNO:160) (SEQIDNO:32) Hu01G06IGKV1-39 S43AV48I) Hu01G06IGKV1-39 ENLHNY DAK QHFWSDPYT 254 F2 (SEQIDNO:160) (SEQIDNO:244) Ch06C11Chimeric QNVGTN SAS QQYNNYPLT 82 (SEQIDNO:162) (SEQIDNO:35) Sh06C11IGKV1-16 QNVGTN SAS QQYNNYPLT 96 (SEQIDNO:162) (SEQIDNO:35) Ch14F11Chimeric QNVGTN SPS QQYNSYPHT 86 (SEQIDNO:162) (SEQIDNO:36) Hu14F11IGKV1-16 QNVGTN SPS QQYNSYPHT 98 (SEQIDNO:162) (SEQIDNO:36)

    [0434] To create the complete chimeric and humanized heavy or kappa chain antibody sequences, each variable sequence above is combined with its respective human constant region. For example, a complete heavy chain comprises a heavy variable sequence followed by a human IgG1 heavy chain constant sequence. A complete kappa chain comprises a kappa variable sequence followed by the human kappa light chain constant sequence.

    [0435] Nucleic Acid Sequence Encoding the Human IgG1 Heavy Chain Constant Region (SEQ ID NO:171)

    TABLE-US-00146 1 gcctcaacaaaaggaccaagtgtgttcccactcgccccta gcagcaagagtacatccggg 61 ggcactgcagcactcggctgcctcgtcaaggattattttc cagagccagtaaccgtgagc 121 tggaacagtggagcactcacttctggtgtccatacttttc ctgctgtcctgcaaagctct 181 ggcctgtactcactcagctccgtcgtgaccgtgccatctt catctctgggcactcagacc 241 tacatctgtaatgtaaaccacaagcctagcaatactaagg tcgataagcgggtggaaccc 301 aagagctgcgacaagactcacacttgtcccccatgccctg cccctgaacttctgggcggt 361 cccagcgtctttttgttcccaccaaagcctaaagatactc tgatgataagtagaacaccc 421 gaggtgacatgtgttgttgtagacgtttcccacgaggacc cagaggttaagttcaactgg 481 tacgttgatggagtcgaagtacataatgctaagaccaagc ctagagaggagcagtataat 541 agtacataccgtgtagtcagtgttctcacagtgctgcacc aagactggctcaacggcaaa 601 gaatacaaatgcaaagtgtccaacaaagcactcccagccc ctatcgagaagactattagt 661 aaggcaaaggggcagcctcgtgaaccacaggtgtacactc tgccacccagtagagaggaa 721 atgacaaagaaccaagtctcattgacctgcctggtgaaag gcttctaccccagcgacatc 781 gccgttgagtgggagagtaacggtcagcctgagaacaatt acaagacaacccccccagtg 841 ctggatagtgacgggtctttctttctgtacagtaagctga ctgtggacaagtcccgctgg 901 cagcagggtaacgtcttcagctgttccgtgatgcacgagg cattgcacaaccactacacc 961 cagaagtcactgagcctgagcccagggaag

    [0436] Protein Sequence Defining the Human IgG1 Heavy Chain Constant Region (SEQ ID NO:172)

    TABLE-US-00147 1 astkgpsvfplapsskstsggtaalgclvkdyfpepvtvs wnsgaltsgvhtfpavlqss 61 glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep kscdkthtcppcpapellgg 121 psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnw yvdgvevhnaktkpreeqyn 181 styrvvsvltvlhqdwlngkeykckvsnkalpapiektis kakgqprepqvytlppsree 241 mtknqvsltclvkgfypsdiavewesngqpennykttppv ldsdgsfflyskltvdksrw 301 qqgnvfscsvmhealhnhytqkslslspgk

    [0437] Nucleic Acid Sequence Encoding the Human Kappa Light Chain Constant Region (SEQ ID NO:173)

    TABLE-US-00148 1 cgcacagttgctgcccccagcgtgttcattttcccaccta gcgatgagcagctgaaaagc 61 ggtactgcctctgtcgtatgcttgctcaacaacttttacc cacgtgaggctaaggtgcag 121 tggaaagtggataatgcacttcaatctggaaacagtcaag agtccgtgacagaacaggac 181 agcaaagactcaacttattcactctcttccaccctgactc tgtccaaggcagactatgaa 241 aaacacaaggtatacgcctgcgaggttacacaccagggtt tgtctagtcctgtcaccaag 301 tccttcaataggggcgaatgt

    [0438] Protein Sequence Defining the Human Kappa Light Chain Constant Region (SEQ ID NO:174)

    TABLE-US-00149 1 rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvq wkvdnalqsgnsqesvteqd 61 skdstyslsstltlskadyekhkvyacevthqglsspvtk sfnrgec

    [0439] The following sequences represent the actual or contemplated full length heavy and light chain sequence (i.e., containing both the variable and constant regions sequences) for each antibody described in this Example. Signal sequences for proper secretion of the antibodies (e.g., signal sequences at the 5 end of the DNA sequences or the amino terminal end of the protein sequences) are not shown in the full length heavy and light chain sequences disclosed herein and are not included in the final secreted protein. Also not shown are stop codons for termination of translation required at the 3 end of the DNA sequences. It is within ordinary skill in the art to select a signal sequence and/or a stop codon for expression of the disclosed full length immunoglobulin heavy chain and light chain sequences. It is also contemplated that the variable region sequences can be ligated to other constant region sequences to produce active full length immunoglobulin heavy and light chains.

    [0440] Nucleic Acid Sequence Encoding the Full Length Ch01G06 Chimeric Heavy Chain (Mouse Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:175)

    TABLE-US-00150 1 gaagtgttgttgcagcagtcagggccggagttggtaaaac cgggagcgtcggtgaaaatc 61 ccgtgcaaagcgtcggggtatacgtttacggactataaca tggattgggtgaaacagtcg 121 catgggaaatcgcttgaatggattggtcagatcaatccga ataatggaggaatcttcttt 181 aatcagaagtttaaaggaaaagcgacgcttacagtcgata agtcgtcgaacacggcgttc 241 atggaagtacggtcgcttacgtcggaagatacggcggtct attactgtgcgagggaggcg 301 attacgacggtgggagcgatggactattggggacaaggga cgtcggtcacggtatcgtcg 361 gcctcaacaaaaggaccaagtgtgttcccactcgccccta gcagcaagagtacatccggg 421 ggcactgcagcactcggctgcctcgtcaaggattattttc cagagccagtaaccgtgagc 481 tggaacagtggagcactcacttctggtgtccatacttttc ctgctgtcctgcaaagctct 541 ggcctgtactcactcagctccgtcgtgaccgtgccatctt catctctgggcactcagacc 601 tacatctgtaatgtaaaccacaagcctagcaatactaagg tcgataagcgggtggaaccc 661 aagagctgcgacaagactcacacttgtcccccatgccctg cccctgaacttctgggcggt 721 cccagcgtctttttgttcccaccaaagcctaaagatactc tgatgataagtagaacaccc 781 gaggtgacatgtgttgttgtagacgtttcccacgaggacc cagaggttaagttcaactgg 841 tacgttgatggagtcgaagtacataatgctaagaccaagc ctagagaggagcagtataat 901 agtacataccgtgtagtcagtgttctcacagtgctgcacc aagactggctcaacggcaaa 961 gaatacaaatgcaaagtgtccaacaaagcactcccagccc ctatcgagaagactattagt 1021 aaggcaaaggggcagcctcgtgaaccacaggtgtacactc tgccacccagtagagaggaa 1081 atgacaaagaaccaagtctcattgacctgcctggtgaaag gcttctaccccagcgacatc 1141 gccgttgagtgggagagtaacggtcagcctgagaacaatt acaagacaacccccccagtg 1201 ctggatagtgacgggtctttctttctgtacagtaagctga ctgtggacaagtcccgctgg 1261 cagcagggtaacgtcttcagctgttccgtgatgcacgagg cattgcacaaccactacacc 1321 cagaagtcactgagcctgagcccagggaag

    [0441] Protein Sequence Defining the Full Length Ch01G06 Chimeric Heavy Chain (Mouse Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:176)

    TABLE-US-00151 1 evllqqsgpelvkpgasvkipckasgytftdynmdwvkqs hgkslewigqinpnnggiff 61 nqkfkgkatltvdkssntafmevrsltsedtavyycarea ittvgamdywgqgtsvtvss 121 astkgpsvfplapsskstsggtaalgclvkdyfpepvtvs wnsgaltsgvhtfpavlqss 181 glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep kscdkthtcppcpapellgg 241 psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnw yvdgvevhnaktkpreeqyn 301 styrvvsvltvlhqdwlngkeykckvsnkalpapiektis kakgqprepqvytlppsree 361 mtknqvsltclvkgfypsdiavewesngqpennykttppv ldsdgsfflyskltvdksrw 421 qqgnvfscsvmhealhnhytqkslslspgk

    [0442] Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGHV1-18 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:177)

    TABLE-US-00152 1 caagtgcaacttgtgcagtcgggtgcggaagtcaaaaagc cgggagcgtcggtgaaagta 61 tcgtgtaaagcgtcgggatatacgtttacggactataaca tggactgggtacgacaggca 121 ccggggaaatcgttggaatggatcggacagattaatccga acaatgggggaattttcttt 181 aatcagaaattcaaaggacgggcgacgttgacggtcgata catcgacgaatacggcgtat 241 atggaattgaggtcgcttcgctcggacgatacggcggtct attactgcgccagggaggcg 301 atcacgacggtaggggcgatggattattggggacagggga cgcttgtgacggtatcgtcg 361 gcctcaacaaaaggaccaagtgtgttcccactcgccccta gcagcaagagtacatccggg 421 ggcactgcagcactcggctgcctcgtcaaggattattttc cagagccagtaaccgtgagc 481 tggaacagtggagcactcacttctggtgtccatacttttc ctgctgtcctgcaaagctct 541 ggcctgtactcactcagctccgtcgtgaccgtgccatctt catctctgggcactcagacc 601 tacatctgtaatgtaaaccacaagcctagcaatactaagg tcgataagcgggtggaaccc 661 aagagctgcgacaagactcacacttgtcccccatgccctg cccctgaacttctgggcggt 721 cccagcgtctttttgttcccaccaaagcctaaagatactc tgatgataagtagaacaccc 781 gaggtgacatgtgttgttgtagacgtttcccacgaggacc cagaggttaagttcaactgg 841 tacgttgatggagtcgaagtacataatgctaagaccaagc ctagagaggagcagtataat 901 agtacataccgtgtagtcagtgttctcacagtgctgcacc aagactggctcaacggcaaa 961 gaatacaaatgcaaagtgtccaacaaagcactcccagccc ctatcgagaagactattagt 1021 aaggcaaaggggcagcctcgtgaaccacaggtgtacactc tgccacccagtagagaggaa 1081 atgacaaagaaccaagtctcattgacctgcctggtgaaag gcttctaccccagcgacatc 1141 gccgttgagtgggagagtaacggtcagcctgagaacaatt acaagacaacccccccagtg 1201 ctggatagtgacgggtctttctttctgtacagtaagctga ctgtggacaagtcccgctgg 1261 cagcagggtaacgtcttcagctgttccgtgatgcacgagg cattgcacaaccactacacc 1321 cagaagtcactgagcctgagcccagggaag

    [0443] Protein Sequence Defining the Full Length Hu01G06 IGHV1-18 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:178)

    TABLE-US-00153 1 qvqlvqsgaevkkpgasvkvsckasgytftdynmdwvrqa pgkslewigqinpnnggiff 61 nqkfkgratltvdtstntaymelrslrsddtavyycarea ittvgamdywgqgtlvtvss 121 astkgpsvfplapsskstsggtaalgclvkdyfpepvtvs wnsgaltsgvhtfpavlqss 181 glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep kscdkthtcppcpapellgg 241 psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnw yvdgvevhnaktkpreeqyn 301 styrvvsvltvlhqdwlngkeykckvsnkalpapiektis kakgqprepqvytlppsree 361 mtknqvsltclvkgfypsdiavewesngqpennykttppv ldsdgsfflyskltvdksrw 421 qqgnvfscsvmhealhnhytqkslslspgk

    [0444] Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGHV1-69 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:179)

    TABLE-US-00154 1 caagtccagcttgtccagtcgggagcggaagtgaagaaac cggggtcgtcggtcaaagta 61 tcgtgtaaagcgtcgggatatacgtttacggactataaca tggattgggtacgacaggct 121 ccgggaaaatcattggaatggattggacagattaatccga ataatgggggtatcttcttt 181 aatcaaaagtttaaagggagggcgacgttgacggtggaca aatcgacaaatacggcgtat 241 atggaattgtcgtcgcttcggtcggaggacacggcggtgt attactgcgcgagggaggcg 301 atcacgacggtcggggcgatggattattggggacagggaa cgcttgtgacggtatcgtcg 361 gcctcaacaaaaggaccaagtgtgttcccactcgccccta gcagcaagagtacatccggg 421 ggcactgcagcactcggctgcctcgtcaaggattattttc cagagccagtaaccgtgagc 481 tggaacagtggagcactcacttctggtgtccatacttttc ctgctgtcctgcaaagctct 541 ggcctgtactcactcagctccgtcgtgaccgtgccatctt catctctgggcactcagacc 601 tacatctgtaatgtaaaccacaagcctagcaatactaagg tcgataagcgggtggaaccc 661 aagagctgcgacaagactcacacttgtcccccatgccctg cccctgaacttctgggcggt 721 cccagcgtctttttgttcccaccaaagcctaaagatactc tgatgataagtagaacaccc 781 gaggtgacatgtgttgttgtagacgtttcccacgaggacc cagaggttaagttcaactgg 841 tacgttgatggagtcgaagtacataatgctaagaccaagc ctagagaggagcagtataat 901 agtacataccgtgtagtcagtgttctcacagtgctgcacc aagactggctcaacggcaaa 961 gaatacaaatgcaaagtgtccaacaaagcactcccagccc ctatcgagaagactattagt 1021 aaggcaaaggggcagcctcgtgaaccacaggtgtacactc tgccacccagtagagaggaa 1081 atgacaaagaaccaagtctcattgacctgcctggtgaaag gcttctaccccagcgacatc 1141 gccgttgagtgggagagtaacggtcagcctgagaacaatt acaagacaacccccccagtg 1201 ctggatagtgacgggtctttctttctgtacagtaagctga ctgtggacaagtcccgctgg 1261 cagcagggtaacgtcttcagctgttccgtgatgcacgagg cattgcacaaccactacacc 1321 cagaagtcactgagcctgagcccagggaag

    [0445] Protein Sequence Defining the Full Length Hu01G06 IGHV1-69 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:180)

    TABLE-US-00155 1 qvqlvqsgaevkkpgssvkvsckasgytftdynmdwvrqa pgkslewigqinpnnggiff 61 nqkfkgratltvdkstntaymelsslrsedtavyycarea ittvgamdywgqgtlvtvss 121 astkgpsvfplapsskstsggtaalgclvkdyfpepvtvs wnsgaltsgvhtfpavlqss 181 glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep kscdkthtcppcpapellgg 241 psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnw yvdgvevhnaktkpreeqyn 301 styrvvsvltvlhqdwlngkeykckvsnkalpapiektis kakgqprepqvytlppsree 361 mtknqvsltclvkgfypsdiavewesngqpennykttppv ldsdgsfflyskltvdksrw 421 qqgnvfscsvmhealhnhytqkslslspgk

    [0446] Nucleic Acid Sequence Encoding the Full Length Sh01G06 IGHV1-18 M69L Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:181)

    TABLE-US-00156 1 caggtccagcttgtgcaatcgggagcggaagtgaagaaac cgggagcgtcggtaaaagtc 61 tcgtgcaaagcgtcggggtatacgtttacggactataaca tggactgggtgcgccaagcg 121 cctggacagggtcttgaatggatggggcagattaatccga ataatggagggatcttcttt 181 aatcagaaattcaaaggaagggtaacgctgacgacagaca cgtcaacatcgacggcctat 241 atggaattgcggtcgttgcgatcagatgatacggcggtct actattgtgcgagggaggcg 301 attacgacggtgggagcgatggattattggggacagggga cgttggtaacggtatcgtcg 361 gcctcaacaaaaggaccaagtgtgttcccactcgccccta gcagcaagagtacatccggg 421 ggcactgcagcactcggctgcctcgtcaaggattattttc cagagccagtaaccgtgagc 481 tggaacagtggagcactcacttctggtgtccatacttttc ctgctgtcctgcaaagctct 541 ggcctgtactcactcagctccgtcgtgaccgtgccatctt catctctgggcactcagacc 601 tacatctgtaatgtaaaccacaagcctagcaatactaagg tcgataagcgggtggaaccc 661 aagagctgcgacaagactcacacttgtcccccatgccctg cccctgaacttctgggcggt 721 cccagcgtctttttgttcccaccaaagcctaaagatactc tgatgataagtagaacaccc 781 gaggtgacatgtgttgttgtagacgtttcccacgaggacc cagaggttaagttcaactgg 841 tacgttgatggagtcgaagtacataatgctaagaccaagc ctagagaggagcagtataat 901 agtacataccgtgtagtcagtgttctcacagtgctgcacc aagactggctcaacggcaaa 961 gaatacaaatgcaaagtgtccaacaaagcactcccagccc ctatcgagaagactattagt 1021 aaggcaaaggggcagcctcgtgaaccacaggtgtacactc tgccacccagtagagaggaa 1081 atgacaaagaaccaagtctcattgacctgcctggtgaaag gcttctaccccagcgacatc 1141 gccgttgagtgggagagtaacggtcagcctgagaacaatt acaagacaacccccccagtg 1201 ctggatagtgacgggtctttctttctgtacagtaagctga ctgtggacaagtcccgctgg 1261 cagcagggtaacgtcttcagctgttccgtgatgcacgagg cattgcacaaccactacacc 1321 cagaagtcactgagcctgagcccagggaag

    [0447] Protein Sequence Defining the Full Length Sh01G06 IGHV1-18 M69L Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:182)

    TABLE-US-00157 1 qvqlvqsgaevkkpgasvkvsckasgytftdynmdwvrqa pgqglewmgqinpnnggiff 61 nqkfkgrvtlttdtststaymelrslrsddtavyycarea ittvgamdywgqgtlvtvss 121 astkgpsvfplapsskstsggtaalgclvkdyfpepvtvs wnsgaltsgvhtfpavlqss 181 glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep kscdkthtcppcpapellgg 241 psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnw yvdgvevhnaktkpreeqyn 301 styrvvsvltvlhqdwlngkeykckvsnkalpapiektis kakgqprepqvytlppsree 361 mtknqvsltclvkgfypsdiavewesngqpennykttppv ldsdgsfflyskltvdksrw 421 qqgnvfscsvmhealhnhytqkslslspgk

    [0448] Nucleic Acid Sequence Encoding the Full Length Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:183)

    TABLE-US-00158 1 caggtccagcttgtgcaatcgggagcggaagtgaagaaac cgggagcgtcggtaaaagtc 61 tcgtgcaaagcgtcggggtatacgtttacggactataaca tggactgggtgcgccaagcg 121 cctggacagagccttgaatggatggggcagattaatccga ataatggagggatcttcttt 181 aatcagaaattccagggaagggtaacgctgacgacagaca cgtcaacatcgacggcctat 241 atggaattgcggtcgttgcgatcagatgatacggcggtct actattgtgcgagggaggcg 301 attacgacggtgggagcgatggattattggggacagggga cgttggtaacggtatcgtcg 361 gcctcaacaaaaggaccaagtgtgttcccactcgccccta gcagcaagagtacatccggg 421 ggcactgcagcactcggctgcctcgtcaaggattattttc cagagccagtaaccgtgagc 481 tggaacagtggagcactcacttctggtgtccatacttttc ctgctgtcctgcaaagctct 541 ggcctgtactcactcagctccgtcgtgaccgtgccatctt catctctgggcactcagacc 601 tacatctgtaatgtaaaccacaagcctagcaatactaagg tcgataagcgggtggaaccc 661 aagagctgcgacaagactcacacttgtcccccatgccctg cccctgaacttctgggcggt 721 cccagcgtctttttgttcccaccaaagcctaaagatactc tgatgataagtagaacaccc 781 gaggtgacatgtgttgttgtagacgtttcccacgaggacc cagaggttaagttcaactgg 841 tacgttgatggagtcgaagtacataatgctaagaccaagc ctagagaggagcagtataat 901 agtacataccgtgtagtcagtgttctcacagtgctgcacc aagactggctcaacggcaaa 961 gaatacaaatgcaaagtgtccaacaaagcactcccagccc ctatcgagaagactattagt 1021 aaggcaaaggggcagcctcgtgaaccacaggtgtacactc tgccacccagtagagaggaa 1081 atgacaaagaaccaagtctcattgacctgcctggtgaaag gcttctaccccagcgacatc 1141 gccgttgagtgggagagtaacggtcagcctgagaacaatt acaagacaacccccccagtg 1201 ctggatagtgacgggtctttctttctgtacagtaagctga ctgtggacaagtcccgctgg 1261 cagcagggtaacgtcttcagctgttccgtgatgcacgagg cattgcacaaccactacacc 1321 cagaagtcactgagcctgagcccagggaag

    [0449] Protein Sequence Defining the Full Length Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:184)

    TABLE-US-00159 1 qvqlvqsgaevkkpgasvkvsckasgytftdynmdwvrqa pgqslewmgqinpnnggiff 61 nqkfqgrvtlttdtststaymelrslrsddtavyycarea ittvgamdywgqgtlvtvss 121 astkgpsvfplapsskstsggtaalgclvkdyfpepvtvs wnsgaltsgvhtfpavlqss 181 glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep kscdkthtcppcpapellgg 241 psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnw yvdgvevhnaktkpreeqyn 301 styrvvsvltvlhqdwlngkeykckvsnkalpapiektis kakgqprepqvytlppsree 361 mtknqvsltclvkgfypsdiavewesngqpennykttppv ldsdgsfflyskltvdksrw 421 qqgnvfscsvmhealhnhytqkslslspgk

    [0450] Nucleic Acid Sequence Encoding the Full Length Sh01G06 IGHV1-18 M69L K64Q Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:185)

    TABLE-US-00160 1 caggtccagcttgtgcaatcgggagcggaagtgaagaaac cgggagcgtcggtaaaagtc 61 tcgtgcaaagcgtcggggtatacgtttacggactataaca tggactgggtgcgccaagcg 121 cctggacagggtcttgaatggatggggcagattaatccga ataatggagggatcttcttt 181 aatcagaaattccagggaagggtaacgctgacgacagaca cgtcaacatcgacggcctat 241 atggaattgcggtcgttgcgatcagatgatacggcggtct actattgtgcgagggaggcg 301 attacgacggtgggagcgatggattattggggacagggga cgttggtaacggtatcgtcg 361 gcctcaacaaaaggaccaagtgtgttcccactcgccccta gcagcaagagtacatccggg 421 ggcactgcagcactcggctgcctcgtcaaggattattttc cagagccagtaaccgtgagc 481 tggaacagtggagcactcacttctggtgtccatacttttc ctgctgtcctgcaaagctct 541 ggcctgtactcactcagctccgtcgtgaccgtgccatctt catctctgggcactcagacc 601 tacatctgtaatgtaaaccacaagcctagcaatactaagg tcgataagcgggtggaaccc 661 aagagctgcgacaagactcacacttgtcccccatgccctg cccctgaacttctgggcggt 721 cccagcgtctttttgttcccaccaaagcctaaagatactc tgatgataagtagaacaccc 781 gaggtgacatgtgttgttgtagacgtttcccacgaggacc cagaggttaagttcaactgg 841 tacgttgatggagtcgaagtacataatgctaagaccaagc ctagagaggagcagtataat 901 agtacataccgtgtagtcagtgttctcacagtgctgcacc aagactggctcaacggcaaa 961 gaatacaaatgcaaagtgtccaacaaagcactcccagccc ctatcgagaagactattagt 1021 aaggcaaaggggcagcctcgtgaaccacaggtgtacactc tgccacccagtagagaggaa 1081 atgacaaagaaccaagtctcattgacctgcctggtgaaag gcttctaccccagcgacatc 1141 gccgttgagtgggagagtaacggtcagcctgagaacaatt acaagacaacccccccagtg 1201 ctggatagtgacgggtctttctttctgtacagtaagctga ctgtggacaagtcccgctgg 1261 cagcagggtaacgtcttcagctgttccgtgatgcacgagg cattgcacaaccactacacc 1321 cagaagtcactgagcctgagcccagggaag

    [0451] Protein Sequence Defining the Full Length Sh01G06 IGHV1-18 M69L K64Q Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:186)

    TABLE-US-00161 1 qvqlvqsgaevkkpgasvkvsckasgytftdynmdwvrqapgqglewmgqinpnnggiff 61 nqkfqgrvtlttdtststaymelrslrsddtavyycareaittvgamdywgqgtivtvss 121 astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss 181 glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdkthtcppcpapellgg 241 psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn 301 styrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsree 361 mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw 421 qqgnvfscsvmhealhnhytqkslslspgk

    [0452] Nucleic Acid Sequence Encoding the Full Length Sh01G06 IGHV1-69 T30S I69L Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:187)

    TABLE-US-00162 1 caagtacagcttgtacagtcgggagcggaagtcaagaaaccgggatcgtcggtcaaagtg 61 tcgtgtaaagcgtcgggatatacgtttagcgactataacatggattgggtgcgacaagcg 121 cctgggcagggacttgaatggatgggtcagatcaatccgaataatgggggaatctttttc 181 aatcagaagtttaaagggagggtaacgctgacggcggataaaagcacgtcaacggcgtat 241 atggagttgtcgtcgttgcggtcggaggacacggcggtctattactgcgcgagggaagcg 301 attacgacggtgggagcgatggattattgggggcagggaacgcttgtaacggtgtcatcg 361 gcctcaacaaaaggaccaagtgtgttcccactcgcccctagcagcaagagtacatccggg 421 ggcactgcagcactcggctgcctcgtcaaggattattttccagagccagtaaccgtgagc 481 tggaacagtggagcactcacttctggtgtccatacttttcctgctgtcctgcaaagctct 541 ggcctgtactcactcagctccgtcgtgaccgtgccatcttcatctctgggcactcagacc 601 tacatctgtaatgtaaaccacaagcctagcaatactaaggtcgataagcgggtggaaccc 661 aagagctgcgacaagactcacacttgtcccccatgccctgcccctgaacttctgggcggt 721 cccagcgtctttttgttcccaccaaagcctaaagatactctgatgataagtagaacaccc 781 gaggtgacatgtgttgttgtagacgtttcccacgaggacccagaggttaagttcaactgg 841 tacgttgatggagtcgaagtacataatgctaagaccaagcctagagaggagcagtataat 901 agtacataccgtgtagtcagtgttctcacagtgctgcaccaagactggctcaacggcaaa 961 gaatacaaatgcaaagtgtccaacaaagcactcccagcccctatcgagaagactattagt 1021 aaggcaaaggggcagcctcgtgaaccacaggtgtacactctgccacccagtagagaggaa 1081 atgacaaagaaccaagtctcattgacctgcctggtgaaaggcttctaccccagcgacatc 1141 gccgttgagtgggagagtaacggtcagcctgagaacaattacaagacaacccccccagtg 1201 ctggatagtgacgggtctttctttctgtacagtaagctgactgtggacaagtcccgctgg 1261 cagcagggtaacgtcttcagctgttccgtgatgcacgaggcattgcacaaccactacacc 1321 cagaagtcactgagcctgagcccagggaag

    [0453] Protein Sequence Defining the Full Length Sh01G06 IGHV1-69 T30S I69L Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:188)

    TABLE-US-00163 1 qvqlvqsgaevkkpgssvkvsckasgytfsdynmdwvrqapgqglewmgqinpnnggiff 61 nqkfkgrvtltadkststaymelsslrsedtavyycareaittvgamdywgqgtivtvss 121 astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss 181 glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdkthtcppcpapellgg 241 psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn 301 styrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsree 361 mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw 421 qqgnvfscsvmhealhnhytqkslslspgk

    [0454] Nucleic Acid Sequence Encoding the Full Length Sh01G06 IGHV1-69 T30S K640 I69L Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:189)

    TABLE-US-00164 1 caagtacagcttgtacagtcgggagcggaagtcaagaaaccgggatcgtcggtcaaagtg 61 tcgtgtaaagcgtcgggatatacgtttagcgactataacatggattgggtgcgacaagcg 121 cctgggcagggacttgaatggatgggtcagatcaatccgaataatgggggaatctttttc 181 aatcagaagtttcaggggagggtaacgctgacggcggataaaagcacgtcaacggcgtat 241 atggagttgtcgtcgttgcggtcggaggacacggcggtctattactgcgcgagggaagcg 301 attacgacggtgggagcgatggattattgggggcagggaacgcttgtaacggtgtcatcg 361 gcctcaacaaaaggaccaagtgtgttcccactcgcccctagcagcaagagtacatccggg 421 ggcactgcagcactcggctgcctcgtcaaggattattttccagagccagtaaccgtgagc 481 tggaacagtggagcactcacttctggtgtccatacttttcctgctgtcctgcaaagctct 541 ggcctgtactcactcagctccgtcgtgaccgtgccatcttcatctctgggcactcagacc 601 tacatctgtaatgtaaaccacaagcctagcaatactaaggtcgataagcgggtggaaccc 661 aagagctgcgacaagactcacacttgtcccccatgccctgcccctgaacttctgggcggt 721 cccagcgtctttttgttcccaccaaagcctaaagatactctgatgataagtagaacaccc 781 gaggtgacatgtgttgttgtagacgtttcccacgaggacccagaggttaagttcaactgg 841 tacgttgatggagtcgaagtacataatgctaagaccaagcctagagaggagcagtataat 901 agtacataccgtgtagtcagtgttctcacagtgctgcaccaagactggctcaacggcaaa 961 gaatacaaatgcaaagtgtccaacaaagcactcccagcccctatcgagaagactattagt 1021 aaggcaaaggggcagcctcgtgaaccacaggtgtacactctgccacccagtagagaggaa 1081 atgacaaagaaccaagtctcattgacctgcctggtgaaaggcttctaccccagcgacatc 1141 gccgttgagtgggagagtaacggtcagcctgagaacaattacaagacaacccccccagtg 1201 ctggatagtgacgggtctttctttctgtacagtaagctgactgtggacaagtcccgctgg 1261 cagcagggtaacgtcttcagctgttccgtgatgcacgaggcattgcacaaccactacacc 1321 cagaagtcactgagcctgagcccagggaag

    [0455] Protein Sequence Defining the Full Length Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:190)

    TABLE-US-00165 1 qvqlvqsgaevkkpgssvkvsckasgytfsdynmdwvrqapgqglewmgqinpnnggiff 61 nqkfqgrvtltadkststaymelsslrsedtavyycareaittvgamdywgqgtivtvss 121 astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss 181 glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdkthtcppcpapellgg 241 psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn 301 styrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsree 361 mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw 421 qqgnvfscsvmhealhnhytqkslslspgk

    [0456] Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGHV1-18 F1 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:255)

    TABLE-US-00166 1 caggtccagcttgtgcaatcgggagcggaagtgaagaaaccgggagcgtcggtaaaagtc 61 tcgtgcaaagcgtcggggtatacgtttacggactataacatggactgggtgcgccaagcg 121 cctggacagagccttgaatggatggggcagattaatccgtacaatcacctgatcttcttt 181 aatcagaaattccagggaagggtaacgctgacgacagacacgtcaacatcgacggcctat 241 atggaattgcggtcgttgcgatcagatgatacggcggtctactattgtgcgagggaggcg 301 attacgacggtgggagcgatggattattggggacaggggacgttggtaacggtatcgtcg 361 gcctcaacaaaaggaccaagtgtgttcccactcgcccctagcagcaagagtacatccggg 421 ggcactgcagcactcggctgcctcgtcaaggattattttccagagccagtaaccgtgagc 481 tggaacagtggagcactcacttctggtgtccatacttttcctgctgtcctgcaaagctct 541 ggcctgtactcactcagctccgtcgtgaccgtgccatcttcatctctgggcactcagacc 601 tacatctgtaatgtaaaccacaagcctagcaatactaaggtcgataagcgggtggaaccc 661 aagagctgcgacaagactcacacttgtcccccatgccctgcccctgaacttctgggcggt 721 cccagcgtctttttgttcccaccaaagcctaaagatactctgatgataagtagaacaccc 781 gaggtgacatgtgttgttgtagacgtttcccacgaggacccagaggttaagttcaactgg 841 tacgttgatggagtcgaagtacataatgctaagaccaagcctagagaggagcagtataat 901 agtacataccgtgtagtcagtgttctcacagtgctgcaccaagactggctcaacggcaaa 961 gaatacaaatgcaaagtgtccaacaaagcactcccagcccctatcgagaagactattagt 1021 aaggcaaaggggcagcctcgtgaaccacaggtgtacactctgccacccagtagagaggaa 1081 atgacaaagaaccaagtctcattgacctgcctggtgaaaggcttctaccccagcgacatc 1141 gccgttgagtgggagagtaacggtcagcctgagaacaattacaagacaacccccccagtg 1201 ctggatagtgacgggtctttctttctgtacagtaagctgactgtggacaagtcccgctgg 1261 cagcagggtaacgtcttcagctgttccgtgatgcacgaggcattgcacaaccactacacc 1321 cagaagtcactgagcctgagcccagggaag

    [0457] Protein Sequence Defining the Full Length Hu01G06 IGHV1-18 F1 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:256)

    TABLE-US-00167 1 qvqlvqsgaevkkpgasvkvsckasgytftdynmdwvrqapgqslewmgqinpynhliff 61 nqkfqgrvtlttdtststaymelrslrsddtavyycareaittvgamdywgqgtivtvss 121 astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss 181 glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdkthtcppcpapellgg 241 psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn 301 styrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsree 361 mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw 421 qqgnvfscsvmhealhnhytqkslslspgk

    [0458] Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGHV1-18 F2 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:257)

    TABLE-US-00168 1 caggtccagcttgtgcaatcgggagcggaagtgaagaaaccgggagcgtcggtaaaagtc 61 tcgtgcaaagcgtcggggtatacgtttacggactataacatggactgggtgcgccaagcg 121 cctggacagagccttgaatggatggggcagattaatccgaataatggactgatcttcttt 181 aatcagaaattccagggaagggtaacgctgacgacagacacgtcaacatcgacggcctat 241 atggaattgcggtcgttgcgatcagatgatacggcggtctactattgtgcgagggaggcg 301 attacgacggtgggagcgatggattattggggacaggggacgttggtaacggtatcgtcg 361 gcctcaacaaaaggaccaagtgtgttcccactcgcccctagcagcaagagtacatccggg 421 ggcactgcagcactcggctgcctcgtcaaggattattttccagagccagtaaccgtgagc 481 tggaacagtggagcactcacttctggtgtccatacttttcctgctgtcctgcaaagctct 541 ggcctgtactcactcagctccgtcgtgaccgtgccatcttcatctctgggcactcagacc 601 tacatctgtaatgtaaaccacaagcctagcaatactaaggtcgataagcgggtggaaccc 661 aagagctgcgacaagactcacacttgtcccccatgccctgcccctgaacttctgggcggt 721 cccagcgtctttttgttcccaccaaagcctaaagatactctgatgataagtagaacaccc 781 gaggtgacatgtgttgttgtagacgtttcccacgaggacccagaggttaagttcaactgg 841 tacgttgatggagtcgaagtacataatgctaagaccaagcctagagaggagcagtataat 901 agtacataccgtgtagtcagtgttctcacagtgctgcaccaagactggctcaacggcaaa 961 gaatacaaatgcaaagtgtccaacaaagcactcccagcccctatcgagaagactattagt 1021 aaggcaaaggggcagcctcgtgaaccacaggtgtacactctgccacccagtagagaggaa 1081 atgacaaagaaccaagtctcattgacctgcctggtgaaaggcttctaccccagcgacatc 1141 gccgttgagtgggagagtaacggtcagcctgagaacaattacaagacaacccccccagtg 1201 ctggatagtgacgggtctttctttctgtacagtaagctgactgtggacaagtcccgctgg 1261 cagcagggtaacgtcttcagctgttccgtgatgcacgaggcattgcacaaccactacacc 1321 cagaagtcactgagcctgagcccagggaag

    [0459] Protein Sequence Defining the Full Length Hu01G06 IGHV1-18 F2 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:258)

    TABLE-US-00169 1 qvqlvqsgaevkkpgasvkvsckasgytftdynmdwvrqapgqslewmgqinpnngliff 61 nqkfqgrvtlttdtststaymelrslrsddtavyycareaittvgamdywgqgtivtvss 121 astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss 181 glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdkthtcppcpapellgg 241 psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn 301 styrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsree 361 mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw 421 qqgnvfscsvmhealhnhytqkslslspgk

    [0460] Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGHV1-69 F1 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:259)

    TABLE-US-00170 1 caagtacagcttgtacagtcgggagcggaagtcaagaaaccgggatcgtcggtcaaagtg 61 tcgtgtaaagcgtcgggatatacgtttagcgactataacatggattgggtgcgacaagcg 121 cctgggcagggacttgaatggatgggtcagatcaatccgaataatgggctgatctttttc 181 aatcagaagtttaaagggagggtaacgctgacggcggataaaagcacgtcaacggcgtat 241 atggagttgtcgtcgttgcggtcggaggacacggcggtctattactgcgcgagggaagcg 301 attacgacggtgggagcgatggattattgggggcagggaacgcttgtaacggtgtcatcg 361 gcctcaacaaaaggaccaagtgtgttcccactcgcccctagcagcaagagtacatccggg 421 ggcactgcagcactcggctgcctcgtcaaggattattttccagagccagtaaccgtgagc 481 tggaacagtggagcactcacttctggtgtccatacttttcctgctgtcctgcaaagctct 541 ggcctgtactcactcagctccgtcgtgaccgtgccatcttcatctctgggcactcagacc 601 tacatctgtaatgtaaaccacaagcctagcaatactaaggtcgataagcgggtggaaccc 661 aagagctgcgacaagactcacacttgtcccccatgccctgcccctgaacttctgggcggt 721 cccagcgtctttttgttcccaccaaagcctaaagatactctgatgataagtagaacaccc 781 gaggtgacatgtgttgttgtagacgtttcccacgaggacccagaggttaagttcaactgg 841 tacgttgatggagtcgaagtacataatgctaagaccaagcctagagaggagcagtataat 901 agtacataccgtgtagtcagtgttctcacagtgctgcaccaagactggctcaacggcaaa 961 gaatacaaatgcaaagtgtccaacaaagcactcccagcccctatcgagaagactattagt 1021 aaggcaaaggggcagcctcgtgaaccacaggtgtacactctgccacccagtagagaggaa 1081 atgacaaagaaccaagtctcattgacctgcctggtgaaaggcttctaccccagcgacatc 1141 gccgttgagtgggagagtaacggtcagcctgagaacaattacaagacaacccccccagtg 1201 ctggatagtgacgggtctttctttctgtacagtaagctgactgtggacaagtcccgctgg 1261 cagcagggtaacgtcttcagctgttccgtgatgcacgaggcattgcacaaccactacacc 1321 cagaagtcactgagcctgagcccagggaag

    [0461] Protein Sequence Defining the Full Length Hu01G06 IGHV1-69 F1 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:260)

    TABLE-US-00171 1 qvqlvqsgaevkkpgssvkvsckasgytfsdynmdwvrqapgqglewmgqinpnngliff 61 nqkfkgrvtltadkststaymelsslrsedtavyycareaittvgamdywgqgtivtvss 121 astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss 181 glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdkthtcppcpapellgg 241 psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn 301 styrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsree 361 mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw 421 qqgnvfscsvmhealhnhytqkslslspgk

    [0462] Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGHV1-69 F2 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:261)

    TABLE-US-00172 1 caagtacagcttgtacagtcgggagcggaagtcaagaaaccgggatcgtcggtcaaagtg 61 tcgtgtaaagcgtcgggatatacgtttagcgactataacatggattgggtgcgacaagcg 121 cctgggcagggacttgaatggatgggtcagatcaatccgtacaatcacctgatctttttc 181 aatcagaagtttaaagggagggtaacgctgacggcggataaaagcacgtcaacggcgtat 241 atggagttgtcgtcgttgcggtcggaggacacggcggtctattactgcgcgagggaagcg 301 attacgacggtgggagcgatggattattgggggcagggaacgcttgtaacggtgtcatcg 361 gcctcaacaaaaggaccaagtgtgttcccactcgcccctagcagcaagagtacatccggg 421 ggcactgcagcactcggctgcctcgtcaaggattattttccagagccagtaaccgtgagc 481 tggaacagtggagcactcacttctggtgtccatacttttcctgctgtcctgcaaagctct 541 ggcctgtactcactcagctccgtcgtgaccgtgccatcttcatctctgggcactcagacc 601 tacatctgtaatgtaaaccacaagcctagcaatactaaggtcgataagcgggtggaaccc 661 aagagctgcgacaagactcacacttgtcccccatgccctgcccctgaacttctgggcggt 721 cccagcgtctttttgttcccaccaaagcctaaagatactctgatgataagtagaacaccc 781 gaggtgacatgtgttgttgtagacgtttcccacgaggacccagaggttaagttcaactgg 841 tacgttgatggagtcgaagtacataatgctaagaccaagcctagagaggagcagtataat 901 agtacataccgtgtagtcagtgttctcacagtgctgcaccaagactggctcaacggcaaa 961 gaatacaaatgcaaagtgtccaacaaagcactcccagcccctatcgagaagactattagt 1021 aaggcaaaggggcagcctcgtgaaccacaggtgtacactctgccacccagtagagaggaa 1081 atgacaaagaaccaagtctcattgacctgcctggtgaaaggcttctaccccagcgacatc 1141 gccgttgagtgggagagtaacggtcagcctgagaacaattacaagacaacccccccagtg 1201 ctggatagtgacgggtctttctttctgtacagtaagctgactgtggacaagtcccgctgg 1261 cagcagggtaacgtcttcagctgttccgtgatgcacgaggcattgcacaaccactacacc 1321 cagaagtcactgagcctgagcccagggaag

    [0463] Protein Sequence Defining the Full Length Hu01G06 IGHV1-69 F2 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:262)

    TABLE-US-00173 1 qvqlvqsgaevkkpgssvkvsckasgytfsdynmdwvrqapgqglewmgqinpynhliff 61 nqkfkgrvtltadkststaymelsslrsedtavyycareaittvgamdywgqgtivtvss 121 astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss 181 glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdkthtcppcpapellgg 241 psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn 301 styrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsree 361 mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw 421 qqgnvfscsvmhealhnhytqkslslspgk

    [0464] Nucleic Acid Sequence Encoding the Full Length Ch06C11 Chimeric Heavy Chain (Mouse Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:191)

    TABLE-US-00174 1 caggtgacactcaaagaatcaggacccggaatccttcagcccagccagaccttgtcgctg 61 acttgttcgttctccggtttcagcctgaatacttatgggatgggtgtgtcatggatcagg 121 caaccgtccgggaaaggattggagtggctcgcgcacatctactgggacgatgacaaacgc 181 tacaatccttcgctgaagagccgattgacgatttccaaggatgcctcgaacaaccgggta 241 tttcttaagatcacgtcggtcgatacggcagacacggcgacctattactgcgcccaaaga 301 gggtacgatgactattggggatattggggccaggggacactcgtcacaatttcagctgcc 361 tcaacaaaaggaccaagtgtgttcccactcgcccctagcagcaagagtacatccgggggc 421 actgcagcactcggctgcctcgtcaaggattattttccagagccagtaaccgtgagctgg 481 aacagtggagcactcacttctggtgtccatacttttcctgctgtcctgcaaagctctggc 541 ctgtactcactcagctccgtcgtgaccgtgccatcttcatctctgggcactcagacctac 601 atctgtaatgtaaaccacaagcctagcaatactaaggtcgataagcgggtggaacccaag 661 agctgcgacaagactcacacttgtcccccatgccctgcccctgaacttctgggcggtccc 721 agcgtctttttgttcccaccaaagcctaaagatactctgatgataagtagaacacccgag 781 gtgacatgtgttgttgtagacgtttcccacgaggacccagaggttaagttcaactggtac 841 gttgatggagtcgaagtacataatgctaagaccaagcctagagaggagcagtataatagt 901 acataccgtgtagtcagtgttctcacagtgctgcaccaagactggctcaacggcaaagaa 961 tacaaatgcaaagtgtccaacaaagcactcccagcccctatcgagaagactattagtaag 1021 gcaaaggggcagcctcgtgaaccacaggtgtacactctgccacccagtagagaggaaatg 1081 acaaagaaccaagtctcattgacctgcctggtgaaaggcttctaccccagcgacatcgcc 1141 gttgagtgggagagtaacggtcagcctgagaacaattacaagacaacccccccagtgctg 1201 gatagtgacgggtctttctttctgtacagtaagctgactgtggacaagtcccgctggcag 1261 cagggtaacgtcttcagctgttccgtgatgcacgaggcattgcacaaccactacacccag 1321 aagtcactgagcctgagcccagggaag

    [0465] Protein Sequence Defining the Full Length Ch06C11 Chimeric Heavy Chain (Mouse Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:192)

    TABLE-US-00175 1 qvtlkesgpgilqpsqtlsltcsfsgfslntygmgvswirqpsgkglewlahiywdddkr 61 ynpslksrltiskdasnnryflkitsvdtadtatyycaqrgyddywgywgqgtivtisaa 121 stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg 181 lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdkthtcppcpapellggp 241 svflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyns 301 tyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsreem 361 tknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwq 421 qgnvfscsvmhealhnhytqkslslspgk

    [0466] Nucleic Acid Sequence Encoding the Full Length HE LM 06C11 IGHV2-70 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:193)

    TABLE-US-00176 1 caggtgactttgaaagaatccggtcccgcattggtaaagc caacccagacacttacgctc 61 acatgtacattttccggattcagcttgaacacttacggga tgggagtgtcgtggattcgg 121 caacctccggggaaggctctggagtggctggcgcacatct actgggatgatgacaaaagg 181 tataacccctcacttaaaacgagactgacgatctcgaagg acacaagcaagaatcaggtc 241 gtcctcacgattacgaatgtagacccggtggatactgccg tctattactgcgcgcaacgc 301 gggtatgatgactactggggatattggggtcagggcaccc tcgtgaccatctcgtcagcc 361 tcaacaaaaggaccaagtgtgttcccactcgcccctagca gcaagagtacatccgggggc 421 actgcagcactcggctgcctcgtcaaggattattttccag agccagtaaccgtgagctgg 481 aacagtggagcactcacttctggtgtccatacttttcctg ctgtcctgcaaagctctggc 541 ctgtactcactcagctccgtcgtgaccgtgccatcttcat ctctgggcactcagacctac 601 atctgtaatgtaaaccacaagcctagcaatactaaggtcg ataagcgggtggaacccaag 661 agctgcgacaagactcacacttgtcccccatgccctgccc ctgaacttctgggcggtccc 721 agcgtctttttgttcccaccaaagcctaaagatactctga tgataagtagaacacccgag 781 gtgacatgtgttgttgtagacgtttcccacgaggacccag aggttaagttcaactggtac 841 gttgatggagtcgaagtacataatgctaagaccaagccta gagaggagcagtataatagt 901 acataccgtgtagtcagtgttctcacagtgctgcaccaag actggctcaacggcaaagaa 961 tacaaatgcaaagtgtccaacaaagcactcccagccccta tcgagaagactattagtaag 1021 gcaaaggggcagcctcgtgaaccacaggtgtacactctgc cacccagtagagaggaaatg 1081 acaaagaaccaagtctcattgacctgcctggtgaaaggct tctaccccagcgacatcgcc 1141 gttgagtgggagagtaacggtcagcctgagaacaattaca agacaacccccccagtgctg 1201 gatagtgacgggtctttctttctgtacagtaagctgactg tggacaagtcccgctggcag 1261 cagggtaacgtcttcagctgttccgtgatgcacgaggcat tgcacaaccactacacccag 1321 aagtcactgagcctgagcccagggaag

    [0467] Protein Sequence Defining the Full Length HE LM 06C11 IGHV2-70 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:194)

    TABLE-US-00177 1 qvtlkesgpalvkptqtltltctfsgfslntygmgvswir qppgkalewlahiywdddkr 61 ynpslktrltiskdtsknqvvltitnvdpvdtavyycaqr gyddywgywgqgtivtissa 121 stkgpsvfplapsskstsggtaalgclvkdyfpepvtvsw nsgaltsgvhtfpavlqssg 181 lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepk scdkthtcppcpapellggp 241 svflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwy vdgvevhnaktkpreeqyns 301 tyrvvsvltvlhqdwlngkeykckvsnkalpapiektisk akgqprepqvytlppsreem 361 tknqvsltclvkgfypsdiavewesngqpennykttppvl dsdgsfflyskltvdksrwq 421 qgnvfscsvmhealhnhytqkslslspgk

    [0468] Nucleic Acid Sequence Encoding the Full Length Hu06C11 IGHV2-5 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:195)

    TABLE-US-00178 1 caagtaacgctcaaggagtccggacccaccttggtgaagc cgacgcagaccttgactctt 61 acgtgcactttctcggggttttcactgaatacgtacggga tgggtgtctcatggatcagg 121 caacctccggggaaaggattggaatggctggcgcacatct actgggatgacgataagaga 181 tataacccaagcctcaagtcgcggctcaccattacaaaag atacatcgaaaaatcaggtc 241 gtacttactatcacgaacatggaccccgtggacacagcaa catattactgtgcccagcgc 301 ggctatgacgattattggggttactggggacagggaacac tggtcacggtgtccagcgcc 361 tcaacaaaaggaccaagtgtgttcccactcgcccctagca gcaagagtacatccgggggc 421 actgcagcactcggctgcctcgtcaaggattattttccag agccagtaaccgtgagctgg 481 aacagtggagcactcacttctggtgtccatacttttcctg ctgtcctgcaaagctctggc 541 ctgtactcactcagctccgtcgtgaccgtgccatcttcat ctctgggcactcagacctac 601 atctgtaatgtaaaccacaagcctagcaatactaaggtcg ataagcgggtggaacccaag 661 agctgcgacaagactcacacttgtcccccatgccctgccc ctgaacttctgggcggtccc 721 agcgtctttttgttcccaccaaagcctaaagatactctga tgataagtagaacacccgag 781 gtgacatgtgttgttgtagacgtttcccacgaggacccag aggttaagttcaactggtac 841 gttgatggagtcgaagtacataatgctaagaccaagccta gagaggagcagtataatagt 901 acataccgtgtagtcagtgttctcacagtgctgcaccaag actggctcaacggcaaagaa 961 tacaaatgcaaagtgtccaacaaagcactcccagccccta tcgagaagactattagtaag 1021 gcaaaggggcagcctcgtgaaccacaggtgtacactctgc cacccagtagagaggaaatg 1081 acaaagaaccaagtctcattgacctgcctggtgaaaggct tctaccccagcgacatcgcc 1141 gttgagtgggagagtaacggtcagcctgagaacaattaca agacaacccccccagtgctg 1201 gatagtgacgggtctttctttctgtacagtaagctgactg tggacaagtcccgctggcag 1261 cagggtaacgtcttcagctgttccgtgatgcacgaggcat tgcacaaccactacacccag 1321 aagtcactgagcctgagcccagggaag

    [0469] Protein Sequence Defining the Full Length Hu06C11 IGHV2-5 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:196)

    TABLE-US-00179 1 qvtlkesgptlvkptqtltltctfsgfslntygmgvswir qppgkglewlahiywdddkr 61 ynpslksrltitkdtsknqvvltitnmdpvdtatyycaqr gyddywgywgqgtlvtvssa 121 stkgpsvfplapsskstsggtaalgclvkdyfpepvtvsw nsgaltsgvhtfpavlqssg 181 lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepk scdkthtcppcpapellggp 241 svflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwy vdgvevhnaktkpreeqyns 301 tyrvvsvltvlhqdwlngkeykckvsnkalpapiektisk akgqprepqvytlppsreem 361 tknqvsltclvkgfypsdiavewesngqpennykttppvl dsdgsfflyskltvdksrwq 421 qgnvfscsvmhealhnhytqkslslspgk

    [0470] Nucleic Acid Sequence Encoding the Full Length Ch14F11 Chimeric Heavy Chain (Mouse Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:197)

    TABLE-US-00180 1 caggtcacgctgaaagagtcaggtcccggaatccttcaac cttcgcagacattgtcactc 61 acatgttccttctccgggttctcgctctcgacttatggca tgggtgtaggatggattcgg 121 cagcccagcgggaaggggcttgagtggttggcggatatct ggtgggacgacgacaaatac 181 tacaatccgagcctgaagtcccgcctcaccatttcgaaag atacgtcatcaaacgaagtc 241 tttttgaagatcgccatcgtggacacggcggatacagcga cgtattactgcgccagaagg 301 ggacactacagcgcaatggattattggggacaggggacct cggtgactgtgtcgtccgcc 361 tcaacaaaaggaccaagtgtgttcccactcgcccctagca gcaagagtacatccgggggc 421 actgcagcactcggctgcctcgtcaaggattattttccag agccagtaaccgtgagctgg 481 aacagtggagcactcacttctggtgtccatacttttcctg ctgtcctgcaaagctctggc 541 ctgtactcactcagctccgtcgtgaccgtgccatcttcat ctctgggcactcagacctac 601 atctgtaatgtaaaccacaagcctagcaatactaaggtcg ataagcgggtggaacccaag 661 agctgcgacaagactcacacttgtcccccatgccctgccc ctgaacttctgggcggtccc 721 agcgtctttttgttcccaccaaagcctaaagatactctga tgataagtagaacacccgag 781 gtgacatgtgttgttgtagacgtttcccacgaggacccag aggttaagttcaactggtac 841 gttgatggagtcgaagtacataatgctaagaccaagccta gagaggagcagtataatagt 901 acataccgtgtagtcagtgttctcacagtgctgcaccaag actggctcaacggcaaagaa 961 tacaaatgcaaagtgtccaacaaagcactcccagccccta tcgagaagactattagtaag 1021 gcaaaggggcagcctcgtgaaccacaggtgtacactctgc cacccagtagagaggaaatg 1081 acaaagaaccaagtctcattgacctgcctggtgaaaggct tctaccccagcgacatcgcc 1141 gttgagtgggagagtaacggtcagcctgagaacaattaca agacaacccccccagtgctg 1201 gatagtgacgggtctttctttctgtacagtaagctgactg tggacaagtcccgctggcag 1261 cagggtaacgtcttcagctgttccgtgatgcacgaggcat tgcacaaccactacacccag 1321 aagtcactgagcctgagcccagggaag

    [0471] Protein Sequence Defining the Full Length Ch14F11 Chimeric Heavy Chain (Mouse Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:198)

    TABLE-US-00181 1 qvtlkesgpgilqpsqtlsltcsfsgfslstygmgvgwir qpsgkglewladiwwdddky 61 ynpslksrltiskdtssnevflkiaivdtadtatyycarr ghysamdywgqgtsvtvssa 121 stkgpsvfplapsskstsggtaalgclvkdyfpepvtvsw nsgaltsgvhtfpavlqssg 181 lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepk scdkthtcppcpapellggp 241 svflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwy vdgvevhnaktkpreeqyns 301 tyrvvsvltvlhqdwlngkeykckvsnkalpapiektisk akgqprepqvytlppsreem 361 tknqvsltclvkgfypsdiavewesngqpennykttppvl dsdgsfflyskltvdksrwq 421 qgnvfscsvmhealhnhytqkslslspgk

    [0472] Nucleic Acid Sequence Encoding the Full Length Sh14F11 IGHV2-5 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:199)

    TABLE-US-00182 1 cagatcactttgaaagaaagcggaccgaccttggtcaagc ccacacaaaccctcacgctc 61 acgtgtacattttcggggttctcgctttcaacttacggga tgggagtagggtggattcgc 121 cagccgcctggtaaagcgttggagtggcttgcagacatct ggtgggacgacgataagtac 181 tataatccctcgctcaagtccagactgaccatcacgaaag atacgagcaagaaccaggtc 241 gtgctgacaatgactaacatggacccagtggatacggcta catattactgcgccaggcgg 301 ggtcactactcagcgatggattattggggccagggaacac tggtaacggtgtcgtccgcc 361 tcaacaaaaggaccaagtgtgttcccactcgcccctagca gcaagagtacatccgggggc 421 actgcagcactcggctgcctcgtcaaggattattttccag agccagtaaccgtgagctgg 481 aacagtggagcactcacttctggtgtccatacttttcctg ctgtcctgcaaagctctggc 541 ctgtactcactcagctccgtcgtgaccgtgccatcttcat ctctgggcactcagacctac 601 atctgtaatgtaaaccacaagcctagcaatactaaggtcg ataagcgggtggaacccaag 661 agctgcgacaagactcacacttgtcccccatgccctgccc ctgaacttctgggcggtccc 721 agcgtctttttgttcccaccaaagcctaaagatactctga tgataagtagaacacccgag 781 gtgacatgtgttgttgtagacgtttcccacgaggacccag aggttaagttcaactggtac 841 gttgatggagtcgaagtacataatgctaagaccaagccta gagaggagcagtataatagt 901 acataccgtgtagtcagtgttctcacagtgctgcaccaag actggctcaacggcaaagaa 961 tacaaatgcaaagtgtccaacaaagcactcccagccccta tcgagaagactattagtaag 1021 gcaaaggggcagcctcgtgaaccacaggtgtacactctgc cacccagtagagaggaaatg 1081 acaaagaaccaagtctcattgacctgcctggtgaaaggct tctaccccagcgacatcgcc 1141 gttgagtgggagagtaacggtcagcctgagaacaattaca agacaacccccccagtgctg 1201 gatagtgacgggtctttctttctgtacagtaagctgactg tggacaagtcccgctggcag 1261 cagggtaacgtcttcagctgttccgtgatgcacgaggcat tgcacaaccactacacccag 1321 aagtcactgagcctgagcccagggaag

    [0473] Protein Sequence Defining the Full Length Sh14F11 IGHV2-5 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:200)

    TABLE-US-00183 1 qitlkesgptlvkptqtltltctfsgfslstygmgvgwir qppgkalewladiwwdddky 61 ynpslksrltitkdtsknqvvltmtnmdpvdtatyycarr ghysamdywgqgtlvtvssa 121 stkgpsvfplapsskstsggtaalgclvkdyfpepvtvsw nsgaltsgvhtfpavlqssg 181 lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepk scdkthtcppcpapellggp 241 svflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwy vdgvevhnaktkpreeqyns 301 tyrvvsvltvlhqdwlngkeykckvsnkalpapiektisk akgqprepqvytlppsreem 361 tknqvsltclvkgfypsdiavewesngqpennykttppvl dsdgsfflyskltvdksrwq 421 qgnvfscsvmhealhnhytqkslslspgk

    [0474] Nucleic Acid Sequence Encoding the Full Length Sh14F11 IGHV2-70 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:201)

    TABLE-US-00184 1 caagtgactctcaaggagtccggacccgccctggtcaaac caacgcagacactgacgctc 61 acatgcaccttcagcggattttcgttgtcaacgtacggca tgggtgtggggtggattcgc 121 cagcctccggggaaagcccttgaatggttggcggacatct ggtgggatgatgacaagtac 181 tataatccctcacttaagtcacggttgacgatctcgaaag acaccagcaagaaccaggta 241 gtgctgacaatgactaacatggacccggtcgatacagcgg tctactattgtgctagaagg 301 ggacactactccgcaatggattattggggtcaggggacgc tcgtaaccgtgtcgtcggcc 361 tcaacaaaaggaccaagtgtgttcccactcgcccctagca gcaagagtacatccgggggc 421 actgcagcactcggctgcctcgtcaaggattattttccag agccagtaaccgtgagctgg 481 aacagtggagcactcacttctggtgtccatacttttcctg ctgtcctgcaaagctctggc 541 ctgtactcactcagctccgtcgtgaccgtgccatcttcat ctctgggcactcagacctac 601 atctgtaatgtaaaccacaagcctagcaatactaaggtcg ataagcgggtggaacccaag 661 agctgcgacaagactcacacttgtcccccatgccctgccc ctgaacttctgggcggtccc 721 agcgtctttttgttcccaccaaagcctaaagatactctga tgataagtagaacacccgag 781 gtgacatgtgttgttgtagacgtttcccacgaggacccag aggttaagttcaactggtac 841 gttgatggagtcgaagtacataatgctaagaccaagccta gagaggagcagtataatagt 901 acataccgtgtagtcagtgttctcacagtgctgcaccaag actggctcaacggcaaagaa 961 tacaaatgcaaagtgtccaacaaagcactcccagccccta tcgagaagactattagtaag 1021 gcaaaggggcagcctcgtgaaccacaggtgtacactctgc cacccagtagagaggaaatg 1081 acaaagaaccaagtctcattgacctgcctggtgaaaggct tctaccccagcgacatcgcc 1141 gttgagtgggagagtaacggtcagcctgagaacaattaca agacaacccccccagtgctg 1201 gatagtgacgggtctttctttctgtacagtaagctgactg tggacaagtcccgctggcag 1261 cagggtaacgtcttcagctgttccgtgatgcacgaggcat tgcacaaccactacacccag 1321 aagtcactgagcctgagcccagggaag

    [0475] Protein Sequence Defining the Full Length Sh14F11 IGHV2-70 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:202)

    TABLE-US-00185 1 qvtlkesgpalvkptqtltltctfsgfslstygmgvgwir qppgkalewladiwwdddky 61 ynpslksrltiskdtsknqvvltmtnmdpvdtavyycarr ghysamdywgqgtlvtvssa 121 stkgpsvfplapsskstsggtaalgclvkdyfpepvtvsw nsgaltsgvhtfpavlqssg 181 lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepk scdkthtcppcpapellggp 241 svflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwy vdgvevhnaktkpreeqyns 301 tyrvvsvltvlhqdwlngkeykckvsnkalpapiektisk akgqprepqvytlppsreem 361 tknqvsltclvkgfypsdiavewesngqpennykttppvl dsdgsfflyskltvdksrwq 421 qgnvfscsvmhealhnhytqkslslspgk

    [0476] Nucleic Acid Sequence Encoding the Full Length Ch01G06 Chimeric Light Chain (Mouse Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:203)

    TABLE-US-00186 1 gacatccaaatgacccagtcacccgcgagcctttcggcgt cggtcggagaaacggtcacg 61 atcacgtgccggacatcagagaatctccataactacctcg cgtggtatcaacagaagcag 121 gggaagtcgccccagttgcttgtatacgatgcgaaaacgt tggcggatggggtgccgtcc 181 agattctcgggatcgggctcggggacgcagtactcgctca agatcaattcgctgcagccg 241 gaggactttgggtcgtactattgtcagcatttttggtcat caccgtatacatttggaggt 301 ggaacgaaacttgagattaagcgcacagttgctgccccca gcgtgttcattttcccacct 361 agcgatgagcagctgaaaagcggtactgcctctgtcgtat gcttgctcaacaacttttac 421 ccacgtgaggctaaggtgcagtggaaagtggataatgcac ttcaatctggaaacagtcaa 481 gagtccgtgacagaacaggacagcaaagactcaacttatt cactctcttccaccctgact 541 ctgtccaaggcagactatgaaaaacacaaggtatacgcct gcgaggttacacaccagggt 601 ttgtctagtcctgtcaccaagtccttcaataggggcgaatgt

    [0477] Protein Sequence Defining the Full Length Ch01G06 Chimeric Light Chain (Mouse Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:204)

    TABLE-US-00187 1 diqmtqspaslsasvgetvtitcrtsenlhnylawyqqkq gkspqllvydaktladgvps 61 rfsgsgsgtqyslkinslqpedfgsyycqhfwsspytfgg gtkleikrtvaapsvfifpp 121 sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsq esvteqdskdstyslsstlt 181 lskadyekhkvyacevthqglsspvtksfnrgec

    [0478] Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGKV1-39 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:205)

    TABLE-US-00188 1 gacatccaaatgacccagtcgccgtcgtcgctttcagcgt cggtaggggatcgggtcaca 61 attacgtgccgaacgtcagagaatttgcataactacctcg cgtggtatcagcagaagccc 121 gggaagtcaccgaaactccttgtctacgatgcgaaaacgc tggcggatggagtgccgtcg 181 agattctcgggaagcggatccggtacggactatacgctta cgatctcatcgctccagccc 241 gaggactttgcgacgtactattgtcagcatttttggtcgt cgccctacacatttgggcag 301 gggaccaagttggaaatcaagcgcacagttgctgccccca gcgtgttcattttcccacct 361 agcgatgagcagctgaaaagcggtactgcctctgtcgtat gcttgctcaacaacttttac 421 ccacgtgaggctaaggtgcagtggaaagtggataatgcac ttcaatctggaaacagtcaa 481 gagtccgtgacagaacaggacagcaaagactcaacttatt cactctcttccaccctgact 541 ctgtccaaggcagactatgaaaaacacaaggtatacgcct gcgaggttacacaccagggt 601 ttgtctagtcctgtcaccaagtccttcaataggggcgaatgt

    [0479] Protein Sequence Defining the Full Length Hu01G06 IGKV1-39 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:206)

    TABLE-US-00189 1 diqmtqspsslsasvgdrvtitcrtsenlhnylawyqqkp gkspkllvydaktladgvps 61 rfsgsgsgtdytltisslqpedfatyycqhfwsspytfgq gtkleikrtvaapsvfifpp 121 sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsq esvteqdskdstyslsstlt 181 lskadyekhkvyacevthqglsspvtksfnrgec

    [0480] Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGKV1-39 S43A V48I Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (Also Referred to Herein as the Full Length Hu01G06 IGFV1-39 F1 Light Chain; SEQ ID NO:207)

    TABLE-US-00190 1 gacatccaaatgacccagtcgccgtcgtcgctttcagcgt cggtaggggatcgggtcaca 61 attacgtgccgaacgtcagagaatttgcataactacctcg cgtggtatcagcagaagccc 121 gggaaggccccgaaactccttatctacgatgcgaaaacgc tggcggatggagtgccgtcg 181 agattctcgggaagcggatccggtacggactatacgctta cgatctcatcgctccagccc 241 gaggactttgcgacgtactattgtcagcatttttggtcgt cgccctacacatttgggcag 301 gggaccaagttggaaatcaagcgcacagttgctgccccca gcgtgttcattttcccacct 361 agcgatgagcagctgaaaagcggtactgcctctgtcgtat gcttgctcaacaacttttac 421 ccacgtgaggctaaggtgcagtggaaagtggataatgcac ttcaatctggaaacagtcaa 481 gagtccgtgacagaacaggacagcaaagactcaacttatt cactctcttccaccctgact 541 ctgtccaaggcagactatgaaaaacacaaggtatacgcct gcgaggttacacaccagggt 601 ttgtctagtcctgtcaccaagtccttcaataggggcgaatgt

    [0481] Protein Sequence Defining the Full Length Hu01G06 IGKV1-39 S43A V48I Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (Also Referred to Herein as the Full Length Hu01G06 IGFV1-39 F1 Light Chain; SEQ ID NO:208)

    TABLE-US-00191 1 diqmtqspsslsasvgdrvtitcrtsenlhnylawyqqkpgkapklliydaktladgvps 61 rfsgsgsgtdytltisslqpedfatyycqhfwsspytfgqgtkleikrtvaapsvfifpp 121 sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt 181 lskadyekhkvyacevthqglsspvtksfnrgec

    [0482] Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGKV1-39 V48I Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:209)

    TABLE-US-00192 1 gacatccaaatgacccagtcgccgtcgtcgctttcagcgtcggtaggggatcgggtcaca 61 attacgtgccgaacgtcagagaatttgcataactacctcgcgtggtatcagcagaagccc 121 gggaagtcaccgaaactccttatctacgatgcgaaaacgctggcggatggagtgccgtcg 181 agattctcgggaagcggatccggtacggactatacgcttacgatctcatcgctccagccc 241 gaggactttgcgacgtactattgtcagcatttttggtcgtcgccctacacatttgggcag 301 gggaccaagttggaaatcaagcgcacagttgctgcccccagcgtgttcattttcccacct 361 agcgatgagcagctgaaaagcggtactgcctctgtcgtatgcttgctcaacaacttttac 421 ccacgtgaggctaaggtgcagtggaaagtggataatgcacttcaatctggaaacagtcaa 481 gagtccgtgacagaacaggacagcaaagactcaacttattcactctcttccaccctgact 541 ctgtccaaggcagactatgaaaaacacaaggtatacgcctgcgaggttacacaccagggt 601 ttgtctagtcctgtcaccaagtccttcaataggggcgaatgt

    [0483] Protein Sequence Defining the Full Length Hu01G06 IGKV1-39 V48I Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:210)

    TABLE-US-00193 1 diqmtqspsslsasvgdrvtitcrtsenlhnylawyqqkpgkspklliydaktladgvps 61 rfsgsgsgtdytltisslqpedfatyycqhfwsspytfgqgtkleikrtvaapsvfifpp 121 sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt 181 lskadyekhkvyacevthqglsspvtksfnrgec

    [0484] Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGKV1-39 F1 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (Also Referred to Herein as the Full Length Hu01G06 IGKV1-39 S43A V48I Light Chain; SEQ ID NO:207)

    TABLE-US-00194 1 gacatccaaatgacccagtcgccgtcgtcgctttcagcgtcggtaggggatcgggtcaca 61 attacgtgccgaacgtcagagaatttgcataactacctcgcgtggtatcagcagaagccc 121 gggaaggccccgaaactccttatctacgatgcgaaaacgctggcggatggagtgccgtcg 181 agattctcgggaagcggatccggtacggactatacgcttacgatctcatcgctccagccc 241 gaggactttgcgacgtactattgtcagcatttttggtcgtcgccctacacatttgggcag 301 gggaccaagttggaaatcaagcgcacagttgctgcccccagcgtgttcattttcccacct 361 agcgatgagcagctgaaaagcggtactgcctctgtcgtatgcttgctcaacaacttttac 421 ccacgtgaggctaaggtgcagtggaaagtggataatgcacttcaatctggaaacagtcaa 481 gagtccgtgacagaacaggacagcaaagactcaacttattcactctcttccaccctgact 541 ctgtccaaggcagactatgaaaaacacaaggtatacgcctgcgaggttacacaccagggt 601 ttgtctagtcctgtcaccaagtccttcaataggggcgaatgt

    [0485] Protein Sequence Defining the Full Length Hu01G06 IGKV1-39 F1 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (Also Referred to Herein as the Full Length Hu01G06 IGKV1-39 S43A V48I Light Chain; SEQ ID NO:208)

    TABLE-US-00195 1 diqmtqspsslsasvgdrvtitcrtsenlhnylawyqqkpgkapklliydaktladgvps 61 rfsgsgsgtdytltisslqpedfatyycqhfwsspytfgqgtkleikrtvaapsvfifpp 121 sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt 181 lskadyekhkvyacevthqglsspvtksfnrgec

    [0486] Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGKV1-39 F2 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:263)

    TABLE-US-00196 1 gacatccaaatgacccagtcgccgtcgtcgctttcagcgtcggtaggggatcgggtcaca 61 attacgtgccgaacgtcagagaatttgcataactacctcgcgtggtatcagcagaagccc 121 gggaagtcaccgaaactccttatctacgatgcgaaaacgctggcggatggagtgccgtcg 181 agattctcgggaagcggatccggtacggactatacgcttacgatctcatcgctccagccc 241 gaggactttgcgacgtactattgtcagcatttttggtcggacccctacacatttgggcag 301 gggaccaagttggaaatcaagcgcacagttgctgcccccagcgtgttcattttcccacct 361 agcgatgagcagctgaaaagcggtactgcctctgtcgtatgcttgctcaacaacttttac 421 ccacgtgaggctaaggtgcagtggaaagtggataatgcacttcaatctggaaacagtcaa 481 gagtccgtgacagaacaggacagcaaagactcaacttattcactctcttccaccctgact 541 ctgtccaaggcagactatgaaaaacacaaggtatacgcctgcgaggttacacaccagggt 601 ttgtctagtcctgtcaccaagtccttcaataggggcgaatgt

    [0487] Protein Sequence Defining the Full Length Hu01G06 IGKV1-39 F2 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:264)

    TABLE-US-00197 1 diqmtqspsslsasvgdrvtitcrtsenlhnylawyqqkpgkspklliydaktladgvps 61 rfsgsgsgtdytltisslqpedfatyycqhfwsdpytfgqgtkleikrtvaapsvfifpp 121 sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt 181 lskadyekhkvyacevthqglsspvtksfnrgec

    [0488] Nucleic Acid Sequence Encoding the Full Length Ch06C11 Chimeric Light Chain (Mouse Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:211)

    TABLE-US-00198 1 gatatcgtcatgacccagtcccagaagttcatgtcaacttcagtgggagacagagtgtcc 61 gtcacatgtaaagcctcgcaaaatgtgggaaccaacgtagcgtggttccagcagaaacct 121 ggccaatcaccgaaggcactgatctactcggccagctataggtactcgggagtaccagat 181 cggtttacggggtcggggagcgggacggactttatcctcactatttccaatgtccagtcg 241 gaggaccttgcggaatacttctgccagcagtataacaactatcccctcacgtttggtgct 301 ggtacaaaattggagttgaagcgcacagttgctgcccccagcgtgttcattttcccacct 361 agcgatgagcagctgaaaagcggtactgcctctgtcgtatgcttgctcaacaacttttac 421 ccacgtgaggctaaggtgcagtggaaagtggataatgcacttcaatctggaaacagtcaa 481 gagtccgtgacagaacaggacagcaaagactcaacttattcactctcttccaccctgact 541 ctgtccaaggcagactatgaaaaacacaaggtatacgcctgcgaggttacacaccagggt 601 ttgtctagtcctgtcaccaagtccttcaataggggcgaatgt

    [0489] Protein Sequence Defining the Full Length Ch06C11 Chimeric Light Chain (Mouse Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:212)

    TABLE-US-00199 1 divmtqsqkfmstsvgdrvsvtckasqnvgtnvawfqqkpgqspkaliysasyrysgvpd 61 rftgsgsgtdfiltisnvqsedlaeyfcqqynnypltfgagtklelkrtvaapsvfifpp 121 sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt 181 lskadyekhkvyacevthqglsspvtksfnrgec

    [0490] Nucleic Acid Sequence Encoding the Full Length Sh06C11 IGKV1-16 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:213)

    TABLE-US-00200 1 gacatccaaatgacccaatcgccctcctccctctccgcatcagtaggggaccgcgtcaca 61 attacttgcaaagcgtcgcagaacgtcggaacgaatgtggcgtggtttcagcagaagccc 121 ggaaaagctccgaagagcttgatctactcggcctcatataggtattcgggtgtgccgagc 181 cggtttagcgggtcggggtcaggtactgatttcacgctcacaatttcatcgttgcagcca 241 gaagatttcgccacatattactgtcagcagtacaacaattaccctctgacgttcggccag 301 ggaaccaaacttgagatcaagcgcacagttgctgcccccagcgtgttcattttcccacct 361 agcgatgagcagctgaaaagcggtactgcctctgtcgtatgcttgctcaacaacttttac 421 ccacgtgaggctaaggtgcagtggaaagtggataatgcacttcaatctggaaacagtcaa 481 gagtccgtgacagaacaggacagcaaagactcaacttattcactctcttccaccctgact 541 ctgtccaaggcagactatgaaaaacacaaggtatacgcctgcgaggttacacaccagggt 601 ttgtctagtcctgtcaccaagtccttcaataggggcgaatgt

    [0491] Protein Sequence Defining the Full Length Sh06C11 IGKV1-16 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:214)

    TABLE-US-00201 1 diqmtqspsslsasvgdrvtitckasqnvgtnvawfqqkpgkapksliysasyrysgvps 61 rfsgsgsgtdftltisslqpedfatyycqqynnypltfgqgtkleikrtvaapsvfifpp 121 sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt 181 lskadyekhkvyacevthqglsspvtksfnrgec

    [0492] Nucleic Acid Sequence Encoding the Full Length Ch14F11 Chimeric Light Chain (Mouse Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:215)

    TABLE-US-00202 1 gacatcgtgatgacacagtcacagaaattcatgtccacatccgtcggtgatagagtatcc 61 gtcacgtgtaaggcctcgcaaaacgtaggaactaatgtggcgtggtatcaacagaagcca 121 ggacagtcacccaaagcactcatctacagcccctcatatcggtacagcggggtgccggac 181 aggttcacgggatcggggagcgggaccgattttacactgaccatttcgaatgtccagtcg 241 gaggaccttgcggaatacttctgccagcagtataactcgtaccctcacacgtttggaggt 301 ggcactaagttggagatgaaacgcacagttgctgcccccagcgtgttcattttcccacct 361 agcgatgagcagctgaaaagcggtactgcctctgtcgtatgcttgctcaacaacttttac 421 ccacgtgaggctaaggtgcagtggaaagtggataatgcacttcaatctggaaacagtcaa 481 gagtccgtgacagaacaggacagcaaagactcaacttattcactctcttccaccctgact 541 ctgtccaaggcagactatgaaaaacacaaggtatacgcctgcgaggttacacaccagggt 601 ttgtctagtcctgtcaccaagtccttcaataggggcgaatgt

    [0493] Protein Sequence Defining the Full Length Ch14F11 Chimeric Light Chain (Mouse Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:216)

    TABLE-US-00203 1 divmtqsqkfmstsvgdrvsvtckasqnvgtnvawyqqkpgqspkaliyspsyrysgvpd 61 rftgsgsgtdftltisnvqsedlaeyfcqqynsyphtfgggtklemkrtvaapsvfifpp 121 sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt 181 lskadyekhkvyacevthqglsspvtksfnrgec

    [0494] Nucleic Acid Sequence Encoding the Full Length Hu14F11 IGKV1-16 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:217)

    TABLE-US-00204 1 gatatccagatgacacagtcaccctcgtcgctctcagcttccgtaggcgacagggtcact 61 attacgtgtaaagcatcacagaacgtcggaacgaatgtggcgtggtttcagcagaagccc 121 gggaagagccccaaagcgcttatctactccccgtcgtatcggtattccggtgtgccaagc 181 agattttcggggtcaggttcgggaactgactttaccctgaccatctcgtccctccaaccg 241 gaagatttcgccacgtacttctgccagcagtacaacagctatcctcacacattcggacaa 301 gggacaaagttggagattaaacgcacagttgctgcccccagcgtgttcattttcccacct 361 agcgatgagcagctgaaaagcggtactgcctctgtcgtatgcttgctcaacaacttttac 421 ccacgtgaggctaaggtgcagtggaaagtggataatgcacttcaatctggaaacagtcaa 481 gagtccgtgacagaacaggacagcaaagactcaacttattcactctcttccaccctgact 541 ctgtccaaggcagactatgaaaaacacaaggtatacgcctgcgaggttacacaccagggt 601 ttgtctagtcctgtcaccaagtccttcaataggggcgaatgt

    [0495] Protein Sequence Defining the Full Length Hu14F11 IGKV1-16 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:218)

    TABLE-US-00205 1 diqmtqspsslsasvgdrvtitckasqnvgtnvawfqqkpgkspkaliyspsyrysgvps 61 rfsgsgsgtdftltisslqpedfatyfcqqynsyphtfgqgtkleikrtvaapsvfifpp 121 sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt 181 lskadyekhkvyacevthqglsspvtksfnrgec

    [0496] Table 22 is a concordance chart showing the SEQ ID NO. of each sequence discussed in this Example.

    TABLE-US-00206 TABLE 22 SEQ ID NO. Nucleic Acid or Protein 171 Human IgG1 constant-nucleic acid 172 Human IgG1 constant-protein 173 Human Kappa constant-nucleic acid 174 Human Kappa constant-protein 175 Humanized Ch01G06 Chimeric Heavy Human Variable + Human IgG1 constant-nucleic acid 176 Humanized Ch01G06 Chimeric Heavy Human Variable + Human IgG1 constant-protein 177 Humanized Hu01G06 IGHV1-18 Heavy Human Variable + Human IgG1 constant-nucleic acid 178 Humanized Hu01G06 IGHV1-18 Heavy Human Variable + Human IgG1 constant-protein 179 Humanized Hu01G06 IGHV1-69 Heavy Human Variable + Human IgG1 constant-nucleic acid 180 Humanized Hu01G06 IGHV1-69 Heavy Human Variable + Human IgG1 constant-protein 181 Humanized Sh01G06 IGHV1-18 M69L Heavy Human Variable + Human IgG1 constant-nucleic acid 182 Humanized Sh01G06 IGHV1-18 M69L Heavy Human Variable + Human IgG1 constant-protein 183 Humanized Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Human Variable + Human IgG1 constant-nucleic acid 184 Humanized Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Human Variable + Human IgG1 constant-protein 185 Humanized Sh01G06 IGHV1-18 M69L K64Q Heavy Human Variable + Human IgG1 constant-nucleic acid 186 Humanized Sh01G06 IGHV1-18 M69L K64Q Heavy Human Variable + Human IgG1 constant-protein 187 Humanized Sh01G06 IGHV1-69 T30S I69L Heavy Human Variable + Human IgG1 constant-nucleic acid 188 Humanized Sh01G06 IGHV1-69 T30S I69L Heavy Human Variable + Human IgG1 constant-protein 189 Humanized Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Human Variable + Human IgG1 constant-nucleic acid 190 Humanized Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Human Variable + Human IgG1 constant-protein 255 Humanized Hu01G06 IGHV1-18 F1 Heavy Human Variable + Human IgG1 constant-nucleic acid 256 Humanized Hu01G06 IGHV1-18 F1 Heavy Human Variable + Human IgG1 constant-protein 257 Humanized Hu01G06 IGHV1-18 F2 Heavy Human Variable + Human IgG1 constant-nucleic acid 258 Humanized Hu01G06 IGHV1-18 F2 Heavy Human Variable + Human IgG1 constant-protein 259 Humanized Hu01G06 IGHV1-69 F1 Heavy Human Variable + Human IgG1 constant-nucleic acid 260 Humanized Hu01G06 IGHV1-69 F1 Heavy Human Variable + Human IgG1 constant-protein 261 Humanized Hu01G06 IGHV1-69 F2 Heavy Human Variable + Human IgG1 constant-nucleic acid 262 Humanized Hu01G06 IGHV1-69 F2 Heavy Human Variable + Human IgG1 constant-protein 191 Humanized Ch06C11 Chimeric Heavy Human Variable + Human IgG1 constant-nucleic acid 192 Humanized Ch06C11 Chimeric Heavy Human Variable + Human IgG1 constant-protein 193 Humanized HE LM 06C11 IGHV2-70 Heavy Human Variable + Human IgG1 constant-nucleic acid 194 Humanized HE LM 06C11 IGHV2-70 Heavy Human Variable + Human IgG1 constant-protein 195 Humanized Hu06C11 IGHV2-5 Heavy Human Variable + Human IgG1 constant-nucleic acid 196 Humanized Hu06C11 IGHV2-5 Heavy Human Variable + Human IgG1 constant-protein 197 Humanized Ch14F11 Chimeric Heavy Human Variable + Human IgG1 constant-nucleic acid 198 Humanized Ch14F11 Chimeric Heavy Human Variable + Human IgG1 constant-protein 199 Humanized Sh14F11 IGHV2-5 Heavy Human Variable + Human IgG1 constant-nucleic acid 200 Humanized Sh14F11 IGHV2-5 Heavy Human Variable + Human IgG1 constant-protein 201 Humanized Sh14F11-IGHV2-70 Heavy Human Variable + Human IgG1 constant-nucleic acid 202 Humanized Sh14F11-IGHV2-70 Heavy Human Variable + Human IgG1 constant-protein 203 Humanized Ch01G06 Chimeric Human Variable + Human Kappa constant-nucleic acid 204 Humanized Ch01G06 Chimeric Human Variable + Human Kappa constant-protein 205 Humanized Hu01G06 IGKV1-39 Human Variable + Human Kappa constant-nucleic acid 206 Humanized Hu01G06 IGKV1-39 Human Variable + Human Kappa constant-protein 207 Humanized Hu01G06 IGKV1-39 S43A V48I Human Variable + Human Kappa constant-nucleic acid 208 Humanized Hu01G06 IGKV1-39 S43A V48I Human Variable + Human Kappa constant-protein 209 Humanized Hu01G06 IGKV1-39 V48I Human Variable + Human Kappa constant-nucleic acid 210 Humanized Hu01G06 IGKV1-39 V48I Human Variable + Human Kappa constant-protein 207 Humanized Hu01G06 IGKV1-39 F1 Human Variable + Human Kappa constant-nucleic acid 208 Humanized Hu01G06 IGKV1-39 F1 Human Variable + Human Kappa constant-protein 263 Humanized Hu01G06 IGKV1-39 F2 Human Variable + Human Kappa constant-nucleic acid 264 Humanized Hu01G06 IGKV1-39 F2 Human Variable + Human Kappa constant-protein 211 Humanized Ch06C11 Chimeric Human Variable + Human Kappa constant-nucleic acid 212 Humanized Ch06C11 Chimeric Human Variable + Human Kappa constant-protein 213 Humanized Sh06C11 IGKV1-16 Human Variable + Human Kappa constant-nucleic acid 214 Humanized Sh06C11 IGKV1-16 Human Variable + Human Kappa constant-protein 215 Humanized Ch14F11 Chimeric Human Variable + Human Kappa constant-nucleic acid 216 Humanized Ch14F11 Chimeric Human Variable + Human Kappa constant-protein 217 Humanized Hu14F11 IGKV1-16 Human Variable + Human Kappa constant-nucleic acid 218 Humanized Hu14F11 IGKV1-16 Human Variable + Human Kappa constant-protein

    [0497] Table 23 below shows antibodies containing chimeric immunoglobulin heavy and light chains and exemplary combinations of the full-length chimeric or humanized immunoglobulin heavy and light chains.

    TABLE-US-00207 TABLE 23 Antibody Name Light Chain Heavy Chain Hu01G06-1 Humanized Ch01G06 Chimeric Humanized Ch01G06 Chimeric Heavy Human Variable + Human Kappa Human Variable + Human IgG1 constant (SEQ ID NO: 204) constant (SEQ ID NO: 176) Hu01G06-46 Humanized Hu01G06 IGKV1-39 Humanized Hu01G06 IGHV1-18 Heavy Human Variable + Human Kappa Human Variable + Human IgG1 constant (SEQ ID NO: 206) constant (SEQ ID NO: 178) Hu01G06-52 Humanized Hu01G06 IGKV1-39 Humanized Hu01G06 IGHV1-69 Heavy Human Variable + Human Kappa Human Variable + Human IgG1 constant (SEQ ID NO: 206) constant (SEQ ID NO: 180) Hu01G06-100 Humanized Hu01G06 IGKV1-39 Humanized Sh01G06 IGHV1-18 M69L Human Variable + Human Kappa Heavy Human Variable + Human IgG1 constant (SEQ ID NO: 206) constant (SEQ ID NO: 182) Hu01G06-101 Humanized Hu01G06 IGKV1-39 Humanized Sh01G06 IGHV1-18 M69L Human Variable + Human Kappa K64Q Heavy Human Variable + Human constant (SEQ ID NO: 206) IgG1 constant (SEQ ID NO: 186) Hu01G06-102 Humanized Hu01G06 IGKV1-39 Humanized Sh01G06 IGHV1-18 M69L K64Q Human Variable + Human Kappa G44S Heavy Human Variable + Human constant (SEQ ID NO: 206) IgG1 constant (SEQ ID NO: 184) Hu01G06-103 Humanized Hu01G06 IGKV1-39 Humanized Sh01G06 IGHV1-69 T30S Human Variable + Human Kappa I69L Heavy Human Variable + Human constant (SEQ ID NO: 206) IgG1 constant (SEQ ID NO: 188) Hu01G06-104 Humanized Hu01G06 IGKV1-39 Humanized Sh01G06 IGHV1-69 T30S K64Q Human Variable + Human Kappa I69L Heavy Human Variable + Human constant (SEQ ID NO: 206) IgG1 constant (SEQ ID NO: 190) Hu01G06-105 Humanized Hu01G06 IGKV1-39 V48I Humanized Sh01G06 IGHV1-18 M69L Human Variable + Human Kappa Heavy Human Variable + Human IgG1 constant (SEQ ID NO: 210) constant (SEQ ID NO: 182) Hu01G06-106 Humanized Hu01G06 IGKV1-39 V48I Humanized Sh01G06 IGHV1-18 M69L Human Variable + Human Kappa K64Q Heavy Human Variable + Human constant (SEQ ID NO: 210) IgG1 constant (SEQ ID NO: 186) Hu01G06-107 Humanized Hu01G06 IGKV1-39 V48I Humanized Sh01G06 IGHV1-18 M69L K64Q Human Variable + Human Kappa G44S Heavy Human Variable + Human constant (SEQ ID NO: 210) IgG1 constant (SEQ ID NO: 184) Hu01G06-108 Humanized Hu01G06 IGKV1-39 V48I Humanized Sh01G06 IGHV1-69 T30S Human Variable + Human Kappa I69L Heavy Human Variable + Human constant (SEQ ID NO: 210) IgG1 constant (SEQ ID NO: 188) Hu01G06-109 Humanized Hu01G06 IGKV1-39 V48I Humanized Sh01G06 IGHV1-69 T30S K64Q Human Variable + Human Kappa I69L Heavy Human Variable + Human constant (SEQ ID NO: 210) IgG1 constant (SEQ ID NO: 190) Hu01G06-110 Humanized Hu01G06 IGKV1-39 S43A Humanized Sh01G06 IGHV1-18 M69L V48I Human Variable + Human Kappa Heavy Human Variable + Human constant (SEQ ID NO: 208) IgG1 constant (SEQ ID NO: 182) Hu01G06-111 Humanized Hu01G06 IGKV1-39 S43A Humanized Sh01G06 IGHV1-18 M69L V48I Human Variable + Human Kappa K64Q Heavy Human Variable + Human constant (SEQ ID NO: 208) IgG1 constant (SEQ ID NO: 186) Hu01G06-112 Humanized Hu01G06 IGKV1-39 S43A Humanized Sh01G06 IGHV1-18 M69L V48I Human Variable + Human Kappa K64Q G44S Heavy Human Variable + constant (SEQ ID NO: 208) Human IgG1 constant (SEQ ID NO: 184) Hu01G06-113 Humanized Hu01G06 IGKV1-39 S43A Humanized Sh01G06 IGHV1-69 T30S V48I Human Variable + Human Kappa I69L Heavy Human Variable + Human constant (SEQ ID NO: 208) IgG1 constant (SEQ ID NO: 188) Hu01G06-114 Humanized Hu01G06 IGKV1-39 S43A Humanized Sh01G06 IGHV1-69 T30S K64Q V48I Human Variable + Human Kappa I69L Heavy Human Variable + Human constant (SEQ ID NO: 208) IgG1 constant (SEQ ID NO: 190) Hu01G06-122 Humanized Hu01G06 IGKV1-39 F1 Humanized Hu01G06 IGHV1-18 F1 Human Variable + Human Kappa Heavy Human Variable + Human IgG1 constant (SEQ ID NO: 208) constant (SEQ ID NO: 256) Hu01G06-127 Humanized Hu01G06 IGKV1-39 F2 Humanized Hu01G06 IGHV1-18 F2 Human Variable + Human Kappa Heavy Human Variable + Human IgG1 constant (SEQ ID NO: 264) constant (SEQ ID NO: 258) Hu01G06-135 Humanized Hu01G06 IGKV1-39 F1 Humanized Hu01G06 IGHV1-69 F1 Human Variable + Human Kappa Heavy Human Variable + Human IgG1 constant (SEQ ID NO: 208) constant (SEQ ID NO: 260) Hu01G06-138 Humanized Hu01G06 IGKV1-39 F1 Humanized Hu01G06 IGHV1-69 F2 Human Variable + Human Kappa Heavy Human Variable + Human IgG1 constant (SEQ ID NO: 208) constant (SEQ ID NO: 262) Hu01G06-146 Humanized Hu01G06 IGKV1-39 F2 Humanized Hu01G06 IGHV1-69 F2 Human Variable + Human Kappa Heavy Human Variable + Human IgG1 constant (SEQ ID NO: 264) constant (SEQ ID NO: 262) Hu06C11-1 Humanized Ch06C11 Chimeric Humanized Ch06C11 Chimeric Heavy Human Variable + Human Kappa Human Variable + Human IgG1 constant (SEQ ID NO: 212) constant (SEQ ID NO: 176) Hu06C11-27 Humanized Sh06C11 IGKV1-16 Humanized HE LM 06C11 IGHV2-70 Human Variable + Human Kappa Heavy Human Variable + Human IgG1 constant (SEQ ID NO: 214) constant (SEQ ID NO: 194) Hu06C11-30 Humanized Sh06C11 IGKV1-16 Humanized Hu06C11 IGHV2-5 Heavy Human Variable + Human Kappa Human Variable + Human IgG1 constant (SEQ ID NO: 214) constant (SEQ ID NO: 196) Hu14F11-1 Humanized Ch14F11 Chimeric Humanized Ch14F11 Chimeric Heavy Human Variable + Human Kappa Human Variable + Human IgG1 constant (SEQ ID NO: 216) constant (SEQ ID NO: 198) Hu14F11-23 Humanized Ch14F11 Chimeric Humanized Ch06C11 Chimeric Heavy Human Variable + Human Kappa Human Variable + Human IgG1 constant (SEQ ID NO: 216) constant (SEQ ID NO: 192) Hu14F11-24 Humanized Ch06C11 Chimeric Humanized Ch14F11 Chimeric Heavy Human Variable + Human Kappa Human Variable + Human IgG1 constant (SEQ ID NO: 212) constant (SEQ ID NO: 198) Hu14F11-39 Humanized Hu14F11 IGKV1-16 Humanized Sh14F11 IGHV2-5 Heavy Human Variable + Human Kappa Human Variable + Human IgG1 constant (SEQ ID NO: 218) constant (SEQ ID NO: 200) Hu14F11-47 Humanized Hu14F11 IGKV1-16 Humanized Sh14F11-IGHV2-70 Heavy Human Variable + Human Kappa Human Variable + Human IgG1 constant (SEQ ID NO: 218) constant (SEQ ID NO: 202)

    [0498] The antibody constructs containing the full length chimeric heavy and light chains are designated below: [0499] Chimeric 01G06 (Hu01G06-1)=Full Length Ch01G06 Chimeric Heavy Chain (Mouse Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:176) plus Full Length Ch01G06 Chimeric Light Chain (Mouse Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:204) [0500] Chimeric 06C11 (Hu06C11-1)=Full Length Ch06C11 Chimeric Heavy Chain (Mouse Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:192) plus Full Length Ch06C11 Chimeric Light Chain (Mouse Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:212) [0501] Chimeric 14F11 (Hu14F11-1)=Full Length Ch14F11 Chimeric Heavy Chain (Mouse Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:198) plus Full Length Ch14F11 Chimeric Light Chain (Mouse Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:216)

    [0502] Fifteen of the possible antibody constructs containing the full length immunoglobulin heavy and light chains containing humanized variable regions are designated below: [0503] Hu01G06-46=Full Length Hu01G06 IGHV1-18 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:178) plus Full Length Hu01G06 IGKV1-39 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:206) [0504] Hu01G06-52=Full Length Hu01G06 IGHV1-69 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:180) plus Full Length Hu01G06 IGKV1-39 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:206) [0505] Hu01G06-107=Full Length Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:184) plus Full Length Hu01G06 IGKV1-39 V48I Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:210) [0506] Hu01G06-108=Full Length Sh01G06 IGHV1-69 T30S I69L Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:188) plus Full Length Hu01G06 IGKV1-39 V48I Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:210) [0507] Hu01G06-112=Full Length Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:184) plus Full Length Hu01G06 IGKV1-39 S43A V48I Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:208) [0508] Hu01G06-113=Full Length Sh01G06 IGHV1-69 T30S I69L Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:188) plus Full Length Hu01G06 IGKV1-39 S43A V48I Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:208) [0509] Hu01G06-122=Full Length Hu01G06 IGHV1-18 F1 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:256) plus Full Length Hu01G06 IGKV1-39 F1 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:208) [0510] Hu01G06-127=Full Length Hu01G06 IGHV1-18 F2 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:258) plus Full Length Hu01G06 IGKV1-39 F2 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:264) [0511] Hu01G06-135=Full Length Hu01G06 IGHV1-69 F1 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:260) plus Full Length Hu01G06 IGKV1-39 F1 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:208) [0512] Hu01G06-138=Full Length Hu01G06 IGHV1-69 F2 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:262) plus Full Length Hu01G06 IGKV1-39 F1 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:208) [0513] Hu01G06-146=Full Length Hu01G06 IGHV1-69 F2 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:262) plus Full Length Hu01G06 IGKV1-39 F2 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:264) [0514] Hu06C11-27=Full Length HE LM 06C11 IGHV2-70 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:194) plus Full Length Sh06C11 IGKV1-16 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:214) [0515] Hu06C11-30=Full Length Hu06C11 IGHV2-5 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:196) plus Full Length Sh06C11 IGKV1-16 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:214) [0516] Hu14F11-39=Full Length Sh14F11 IGHV2-5 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:200) plus Full Length Hu14F11 IGKV1-16 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:218) [0517] Hu14F11-47=Full Length Sh14F11-IGHV2-70 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:202) plus Full Length Hu14F11 IGKV1-16 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:218)

    Example 15: Binding Affinities of Humanized and Chimeric Anti-GDF15 Monoclonal Antibodies

    [0518] The binding affinities and kinetics of binding of chimeric and humanized antibodies to mFc-rhGDF15 were measured by surface plasmon resonance, using a BIAcore? T100 instrument (GE Healthcare, Piscataway, NJ).

    [0519] Goat anti-human IgGs (Fc fragment specific, Jackson ImmunoResearch, West Grove, PA) were immobilized on carboxymethylated dextran CM4 sensor chips by amine coupling, according to a standard protocol. Analyses were performed at 37? C. using PBS containing 0.05% surfactant P20 as running buffer. The antibodies were captured in individual flow cells at a flow rate of 10 ?L/minute. Injection time was varied for each antibody to yield an Rmax between 30 and 60 RU. Buffer or mFc-rhGDF15 diluted in running buffer was injected sequentially over a reference surface (no antibody captured) and the active surface (antibody to be tested) for 240 seconds at 60 ?L/minute. The dissociation phase was monitored for up to 1200 seconds. The surface was then regenerated with two 60-second injections of 10 mM Glycine-HCl, pH 2.25, at a flow rate of 30 ?L/minute. The GDF15 concentration range tested was 20 nM to 0.625 nM.

    [0520] Kinetic parameters were determined using the kinetic function of the BIAevaluation software (GE Healthcare) with double reference subtraction. Kinetic parameters for each antibody, k.sub.a (association rate constant), k.sub.d (dissociation rate constant), and K.sub.D (equilibrium dissociation constant) were determined. Kinetic values of purified monoclonal antibodies on mFc-rhGDF15 are summarized in Table 24.

    TABLE-US-00208 TABLE 24 Antibody k.sub.a (1/Ms) k.sub.d (1/s) K.sub.D (M) n Hu01G06-1 4.2E+06 6.4E?04 1.6E?10 8 Hu01G06-46 3.6E+06 3.8E?04 1.1E?10 11 Hu01G06-52 3.6E+06 3.6E?04 9.9E?11 10 Hu06C11-1 5.3E+06 8.4E?04 1.8E?10 2 Hu06C11-27 4.7E+06 8.2E?04 1.8E?10 2 Hu06C11-30 4.8E+06 8.7E?04 1.8E?10 2 Hu14F11-1 3.0E+06 4.6E?04 1.6E?10 2 Hu14F11-39 3.0E+06 1.9E?04 6.6E?11 2 Hu14F11-47 3.3E+06 1.8E?04 6.5E?11 2

    [0521] The results in Table 24 demonstrate that the chimeric and each of the humanized antibodies, have fast association rates (k.sub.a), very slow disassociation rates (k.sub.d) and very high affinities (K.sub.D). In particular, the antibodies have affinities ranging from about 65 pM to about 200 pM.

    [0522] Kinetic values of chimeric 01G06 (Hu01G06-1), two initial lead humanized 01G06 monoclonal antibodies (Hu01G06-46 and -52), and sequence optimized humanized 01G06 monoclonal antibody variants Hu01G06-100 through -114 (in supernatant) on mFc-rhGDF15 are summarized in Table 25.

    TABLE-US-00209 TABLE 25 Antibody k.sub.a (1/Ms) k.sub.d (1/s) K.sub.D (M) n Hu01G06-1 4.9E+06 7.1E?04 1.4E?10 3 Hu01G06-46 4.1E+06 4.3E?04 1.0E?10 3 Hu01G06-52 5.0E+06 4.4E?04 8.9E?11 3 Hu01G06-100 4.1E+06 6.2E?04 1.5E?10 3 Hu01G06-101 4.4E+06 6.3E?04 1.4E?10 3 Hu01G06-102 4.4E+06 4.6E?04 1.1E?10 3 Hu01G06-103 4.4E+06 4.7E?04 1.1E?10 3 Hu01G06-104 4.5E+06 5.2E?04 1.2E?10 3 Hu01G06-105 4.3E+06 5.6E?04 1.3E?10 3 Hu01G06-106 4.3E+06 7.0E?04 1.6E?10 3 Hu01G06-107 4.1E+06 4.7E?04 1.2E?10 3 Hu01G06-108 4.2E+06 4.6E?04 1.2E?10 3 Hu01G06-109 4.6E+06 5.6E?04 1.3E?10 4 Hu01G06-110 4.3E+06 5.8E?04 1.4E?10 4 Hu01G06-111 4.3E+06 6.6E?04 1.6E?10 3 Hu01G06-112 4.7E+06 5.3E?04 1.2E?10 3 Hu01G06-113 4.5E+06 4.8E?04 1.1E?10 3 Hu01G06-114 4.5E+06 5.4E?04 1.3E?10 3

    [0523] The results in Table 25 demonstrate that the sequence optimized antibodies, Hu01G06-100 through -114, have binding affinities ranging from about 89 pM to about 160 pM.

    [0524] Binding affinities and binding kinetics of mFc-rhGDF15 with chimeric 14F11 (Hu14F11-1), chimeric light 14F11 with chimeric heavy 06C11 (Hu14F11-23), and chimeric light 06C11 with chimeric heavy 14F11 (Hu14F11-24) heavy monoclonal antibody variants (in supernatant) were measured using biolayer interferometry (BLI) on an Octet? QK instrument (ForteBio, Inc., Menlo Park, CA). The Octet analysis was performed at 30? C. using 1? Kinetics Buffer (ForteBio, Inc.) as assay buffer. Anti-human IgG Fc Capture (AHC) biosensors (ForteBio, Inc.) were used to capture human antibodies onto the sensors. Sensors were saturated in assay buffer for at 300 seconds before the assay. Antibodies were loaded onto sensors by dipping the sensors into antibody supernatant solution for 220 seconds, which typically resulted in capture levels of 1.5-2 nm. Baseline was established by dipping the sensors into 1? assay buffer for 200 seconds. Next, association was monitored for 220 seconds in 400 nM mFc-rhGDF15 protein, and dissociation was followed for 600 seconds in buffer alone.

    [0525] Kinetic parameters for Hu14F11-1, Hu14F11-23, and Hu14F11-24 were determined using the kinetic function of the ForteBio Analysis Software Version 7.0. Kinetic parameters of the antibody, k.sub.a, k.sub.d, and K.sub.D were determined.

    [0526] Kinetic values of Hu14F11-1, Hu14F11-23, and Hu14F11-24 heavy monoclonal antibody variants (in supernatant) on mFc-rhGDF15 are summarized in Table 26.

    TABLE-US-00210 TABLE 26 Antibody k.sub.a (1/Ms) k.sub.d (1/s) K.sub.D (M) n Hu14F11-1 6.3E+05 1.9E?05 3.2E?11 3 Hu14F11-23 3.4E+05 6.2E?05 1.8E?10 1 Hu14F11-24 7.1E+05 2.2E?04 3.1E?10 1

    [0527] The results in Table 26 demonstrate that Hu14F11-23 and Hu14F11-24, (i.e., antibodies that consist of one chimeric 06C11 chain (heavy or light) mixed with one chimeric 14F11 chain (heavy or light)), retain binding to GDF15. In particular, these antibodies have high affinities ranging from about 180 pM to about 310 pM.

    Example 16: Binding Affinities of Affinity Matured Humanized Anti-GDF15 Monoclonal Antibodies

    [0528] The binding affinities and kinetics of binding of chimeric and humanized antibodies to mFc-rhGDF15, cleaved-rhGDF15, rabbit Fc mature recombinant mouse GDF15 (rFc-rmGDF15), and mouse Fc mature recombinant cynomolgus monkey GDF15 (mFc-rcGDF15) were measured by surface plasmon resonance, using a BIAcore? T100 instrument (GE Healthcare, Piscataway, NJ).

    [0529] Goat anti-human IgGs (Fc fragment specific, Jackson ImmunoResearch, West Grove, PA) were immobilized on carboxymethylated dextran CM4 sensor chips by amine coupling, according to a standard protocol. Analyses were performed at 37? C. using PBS containing 0.05% surfactant P20 as running buffer. The antibodies were captured in individual flow cells at a flow rate of 10 ?L/minute. Injection time was varied for each antibody to yield an Rmax between 30 and 60 RU. Buffer, mFc-rhGDF15, cleaved-rhGDF15, rFc-rmGDF15, or mFc-rcGDF15 diluted in running buffer was injected sequentially over a reference surface (no antibody captured) and the active surface (antibody to be tested) for 240 seconds at 60 ?L/minute. The dissociation phase was monitored for up to 1500 seconds. The surface was then regenerated with two 60-second injections of 10 mM Glycine-HCl, pH 2.25, at a flow rate of 30 ?L/minute. The GDF15 concentration range tested for each GDF15 protein was 5 nM to 0.3125 nM (two-fold dilutions).

    [0530] Kinetic parameters were determined using the kinetic function of the BIAevaluation software (GE Healthcare) with double reference subtraction. Kinetic parameters for each antibody, k.sub.a (association rate constant), k.sub.d (dissociation rate constant), and K.sub.D (equilibrium dissociation constant) were determined. Kinetic values of purified monoclonal antibodies on mFc-rhGDF15, mature human GDF15, rFc-rmGDF15, and mFc-rcGDF15 are summarized in Table 27.

    TABLE-US-00211 TABLE 27 Protein Antibody k.sub.a (1/Ms) k.sub.d (1/s) K.sub.D (M) n mFc- Hu01G06-122 5.9E+06 2.1E?05 6.5E?12 5 rhGDF15 Hu01G06-127 4.6E+06 4.2E?05 1.8E?11 4 Hu01G06-135 5.3E+06 4.4E?05 1.4E?11 5 Hu01G06-138 5.9E+06 4.1E?05 1.1E?11 5 Hu01G06-146 5.3E+06 2.6E?05 9.3E?12 5 Cleaved- Hu01G06-122 7.9E+06 3.4E?05 7.9E?12 4 rhGDF15 Hu01G06-127 6.1E+06 3.6E?05 1.0E?11 4 Hu01G06-135 7.3E+06 6.2E?05 1.0E?11 4 Hu01G06-138 7.9E+06 2.5E?05 4.5E?12 4 Hu01G06-146 6.5E+06 5.2E?05 1.1E?11 4 mFc- Hu01G06-122 2.3E+06 2.4E?05 1.0E?11 4 rcGDF15 Hu01G06-127 1.8E+06 1.6E?05 9.5E?12 4 Hu01G06-135 2.2E+06 7.9E?05 3.8E?11 4 Hu01G06-138 2.3E+06 5.3E?05 2.5E?11 4 Hu01G06-146 2.0E+06 1.5E?05 8.0E?12 4 rFc- Hu01G06-122 2.2E+07 1.4E?03 6.3E?11 2 rmGDF15 Hu01G06-127 3.9E+07 2.1E?03 5.1E?11 2 Hu01G06-135 3.7E+07 1.9E?03 5.5E?11 2 Hu01G06-138 1.9E+07 8.0E?04 4.4E?11 2 Hu01G06-146 1.1E+07 7.2E?04 6.3E?11 2

    [0531] The results in Table 27 demonstrate that the chimeric and each of the humanized antibodies, have fast association rates (k.sub.a), very slow disassociation rates (k.sub.d) and very high affinities (K.sub.D). In particular, the antibodies have affinities ranging from less than 5 pM (e.g., about 4.5 pM) to about 65 pM.

    Example 17: Reversal of Cachexia in an HT-1080 Fibroscarcoma Xenograft Model

    [0532] This Example demonstrates the reversal of cachexia (as indicated by body weight loss) by humanized 01G06, 06C11, 14F11 antibodies in an HT-1080 fibrosarcoma xenograft model. HT-1080 cells were grown in culture at 37? C. and inoculated subcutaneously into the flank of 8-week old female ICR-SCID mice as described above in Example 10. Body weight was measured daily. When body weight reached 93%, the mice were randomly divided into groups of ten mice each. Each group received one of the following treatments: murine IgG control, 01G06, 06C11, 14F11, and their respective humanized versions at 2 mg/kg. Treatment was administered once a day by intra-peritoneal injection. Antibody treatment with 01G06, Hu01G06-46 and Hu01G06-52 resulted in body weight increase to initial weight or 100% (p<0.001) (FIG. 23). Statistical analysis was performed using ANOVA. Results for reversal of body weight on day in the HT-1080 model are shown in FIG. 23 and Table 28, respectively.

    TABLE-US-00212 TABLE 28 Treatment % Body ANOVA Analysis Gr. Agent mg/kg weight (compared to mIgG) 1 mIgG 2 79.5 NA 2 01G06 2 87.6 p < 0.001 3 Hu01G06-46 2 95.4 p < 0.001 4 Hu01G06-52 2 87.8 p < 0.001

    [0533] The data in FIG. 23 and Table 28 indicated that antibodies 01G06, Hu01G06-46 and Hu01G06-52 can reverse cachexia in an HT-1080 fibrosarcoma xenograft model.

    [0534] Antibody treatment with 06C11, Hu06C11-27, and Hu06C11-30 resulted in body weight increase relative to initial weight or about 100% (p<0.001) (FIG. 24). Statistical analysis was performed using ANOVA. Results for reversal of body weight in the HT-1080 model are shown in FIG. 24 and Table 29.

    TABLE-US-00213 TABLE 29 Treatment % Body ANOVA Analysis Gr. Agent mg/kg weight (compared to mIgG) 1 mIgG 2 87.7 NA 2 01G06 2 93.6 p < 0.001 3 Hu06C11-27 2 93.2 p < 0.001 4 Hu06C11-30 2 89.8 p < 0.001

    [0535] The data in FIG. 24 and Table 29 indicate that antibodies 06C11, Hu06C11-27, and Hu06C11-30 can reverse cachexia in an HT-1080 fibrosarcoma xenograft model.

    [0536] Antibody treatment with 14F11, Hu14F11-39, and Hu14F11-47 resulted in body weight increase relative to initial weight or about 100% (p<0.001) (FIG. 25). Statistical analysis was performed using ANOVA. Results for reversal of body weight in the HT-1080 model are shown in FIG. 25 and Table 30.

    TABLE-US-00214 TABLE 30 Treatment % Body ANOVA Analysis Gr. Agent mg/kg weight (compared to mIgG) 1 mIgG 2 87.7 NA 2 14F11 2 96.6 p < 0.001 3 Hu14F11-39 2 90.5 p < 0.001 4 Hu14F11-47 2 90.7 p < 0.001

    [0537] The data in FIG. 25 and Table 30 indicated that antibodies 14F11, Hu14F11-39, and Hu14F11-47 can reverse cachexia in an HT-1080 fibrosarcoma xenograft model.

    [0538] Antibody treatment with humanized 01G06 antibodies (i.e., antibodies Hu01G06-122, Hu01G06-127, Hu01G06-135, Hu01G06-138 and Hu01G06-146) resulted in body weight increase relative to initial weight or about 100% (p<0.001) (FIG. 26). Statistical analysis was performed using ANOVA. Treatment with human IgG (hIgG) was used as a control. Results for reversal of body weights in the HT-1080 model are shown in FIG. 26 and Table 31.

    TABLE-US-00215 TABLE 31 Treatment % Body ANOVA Analysis Gr. Agent mg/kg weight (compared to mIgG) 1 mIgG 2 84.2 NA 2 Hu01G06-122 2 96.3 p < 0.001 3 Hu01G06-127 2 96.1 p < 0.001 4 Hu01G06-135 2 93.5 p < 0.001 5 Hu01G06-138 2 91.9 p < 0.001 6 Hu01G06-146 2 92.7 p < 0.001

    [0539] The data in FIG. 26 and Table 31 indicated that humanized anti-GDF15 antibodies Hu01G06-122, Hu01G06-127, Hu01G06-135, Hu01G06-138 and Hu01G06-146 can reverse cachexia in an HT-1080 fibrosarcoma xenograft model.

    Example 18: Reversal of Cachexia in an mFc-rhGDF15-Induced Model

    [0540] This Example demonstrates the reversal of cachexia (as indicated by body weight loss) by humanized 01G06 antibodies (i.e., antibody Hu01G06-122, Hu01G06-127, Hu01G06-135, Hu01G06-138, or Hu01G06-146) in an mFc-rhGDF15-induced cachexia model. mFc-rhGDF15 (1 ?g/g) was administered subcutaneously into the flank of 8-week old female ICR-SCID mice. Body weight was measured daily. When body weight reached 93%, the mice were randomly divided into six groups of ten mice each. Each group received one of the following treatments: human IgG control (hIgG), Hu01G06-122, Hu01G06-127, Hu01G06-135, Hu01G06-138 or Hu01G06-146 at 2 mg/kg. Treatment was administered once by intra-peritoneal injection. Treatment with antibody Hu01G06-122, Hu01G06-127, Hu01G06-135, Hu01G06-138 or Hu01G06-146 resulted in body weight increase relative to initial weight or about 100% (p<0.001) (FIG. 27 and Table 32).

    TABLE-US-00216 TABLE 32 Treatment % Body ANOVA Analysis Gr. Agent mg/kg weight (compared to mIgG) 1 mIgG 2 70.6 NA 2 Hu01G06-122 2 101.7 p < 0.001 3 Hu01G06-127 2 103.2 p < 0.001 4 Hu01G06-135 2 102.5 p < 0.001 5 Hu01G06-138 2 101.8 p < 0.001 6 Hu01G06-146 2 102.5 p < 0.001

    [0541] The data in FIG. 27 and Table 32 indicate that the disclosed anti-GDF15 antibodies can reverse cachexia in an mFc-rhGDF15-induced mouse model (i.e., a non-tumor bearing mouse model).

    [0542] These results indicate that humanized anti-GDF15 antibodies can reverse cachexia in an mFc-rhGDF15-induced cachexia model.

    Example 19: Dose Response Reversal of Cachexia in an HT-1080 Fibroscarcoma Xenograft Model

    [0543] This Example demonstrates the dose response reversal of cachexia (as indicated by body weight loss) by humanized Hu01G06-127 and Hu01G06-135 antibodies in an HT-1080 fibrosarcoma xenograft model. HT-1080 cells were grown in culture at 37? C. and inoculated subcutaneously into the flank of 8-week old female ICR-SCID mice as described above in Example 10. Body weight was measured daily. When body weight reached 93%, the mice were randomly divided into groups of ten mice each. Each group received one of the following treatments: human IgG control (hIgG; 20 mg/kg), Hu01G06-127 (20 mg/kg, 2 mg/kg, or 0.2 mg/kg) and Hu01G06-135 (20 mg/kg, 2 mg/kg, or 0.2 mg/kg). Treatment was administered once a day by intravenous injection. Antibody treatment with Hu01G06-127 and Hu01G06-135 at 20 mg/kg resulted in body weight increase above the initial weight or 108% (p<0.001) (FIG. 28). Antibody treatment with Hu01G06-127 and Hu01G06-135 at 2 mg/kg resulted in limited body weight decrease compare to control (hIgG) from the initial weight or 88-85% (p<0.001) (FIG. 28). Statistical analysis was performed using ANOVA. Results for changes of body weight at the end of the study in the HT-1080 model are shown in FIG. 28 and Table 33.

    TABLE-US-00217 TABLE 33 Treatment % Body ANOVA Analysis Gr. Agent mg/kg weight (compared to mIgG) 1 mIgG 20 75.2 NA 2 Hu01G06-127 20 108.9 p < 0.001 3 Hu01G06-127 2.0 88.1 p < 0.001 4 Hu01G06-127 0.2 80.0 NS 5 Hu01G06-135 20 108.6 p < 0.001 6 Hu01G06-135 2.0 85.2 p < 0.001 7 Hu01G06-135 0.2 77.3 NS

    [0544] The data in FIG. 28 and Table 33 indicated that antibodies Hu01G06-127 and Hu01G06-135 can reverse cachexia in an HT-1080 fibrosarcoma xenograft model in a dose-dependent manner.

    Example 20: Reversal of Muscle and Fat Loss in an HT-1080 Xenograft Tumor Model

    [0545] This Example demonstrates the reversal of cachexia (as indicated by body weight loss, muscle mass loss and fat mass loss) by antibody 01G06 in an HT-1080 fibrosarcoma xenograft model. HT-1080 cells were grown in culture at 37? C. in an atmosphere containing 5% CO.sub.2, using Eagle's Minimum Essential Medium (ATCC, Catalog No. 30-2003) containing 10% FBS. Cells were inoculated subcutaneously into the flank of 8-week old female ICR SCID mice with 5?10.sup.6 cells per mouse in 50% matrigel. A cohort of ten 8-week old female ICR SCID mice with the same body weight was selected for subcutaneous inoculation into the flank with matrigel, as a non tumor (SHAM) control arm. Body weight was measured daily. When body weight reached 91% in the tumor bearing mice, the mice were randomly divided into two groups of ten mice each. Each group received one of the following treatments: human IgG control (hIgG) or Hu01G06-127 10 mg/kg on day 1, day 3 and day 6. Treatment was administered by intra-peritoneal injection. Treatment with antibody Hu01G06-127 resulted in body weight increase to 105% of initial weight compared to non-tumor bearing control mice (SHAM; p<0.001) (FIG. 29A and Table 34).

    TABLE-US-00218 TABLE 34 Treatment % Body ANOVA Analysis Gr. Agent mg/kg weight (compared to hIgG) 1 hIgG 10 84.3 NA 2 Hu01G06-127 10 105.4 p < 0.001 2 SHAM no tumor control none 101.9 p < 0.001

    [0546] The data in FIG. 29A and Table 34 indicate that the disclosed anti-GDF15 antibody can completely reverse cachexia in an HT-1080 fibrosarcoma xenograft model.

    [0547] In this experiment, a group of ten mice were sacrificed at the time of dosing (baseline or 91% body weight loss, without treatment) and at the end of the study (eight days post dose, either hIgG or Hu01G06-127 as well SHAM non tumor control mice). Gonadal fat and the gastrocnemius muscles were removed surgically and weighed. As shown in FIG. 29B, significant gonadal fat mass loss was observed seven days post dose with hIgG, but not in the group treated with antibody Hu01G06-127 compared to baseline control (91% body weight loss). Moreover, treatment with Hu01G06-127 not only prevented further fat loss (compared to baseline group), but also, was able to restore the normal levels of gonadal fat (compared to SHAM non-tumor control) (FIG. 29B). In addition, significant gastrocnemius muscle mass loss was observed seven days post dose with hIgG, but not in the group treated with antibody Hu01G06-127 compared to baseline control (91% body weight loss) (FIG. 29C). Treatment with Hu01G06-127 not only prevented further muscle loss (compare to baseline group), but also was able to restore the normal levels of gastrocnemius muscle (compared to SHAM non tumor control) (FIG. 29C).

    [0548] These results indicate that the disclosed anti-GDF15 antibodies can completely reverse cachexia measured by the loss of muscle mass, loss of fat and involuntary weight loss in an HT-1080 xenograft tumor model.

    INCORPORATION BY REFERENCE

    [0549] The entire disclosure of each of the patent documents and scientific articles referred to herein is incorporated by reference for all purposes.

    EQUIVALENTS

    [0550] The invention may be embodied in other specific forms without departing from the spirit or essential characteristics thereof. The foregoing embodiments are therefore to be considered in all respects illustrative rather than limiting on the invention described herein. Scope of the invention is thus indicated by the appended claims rather than by the foregoing description, and all changes that come within the meaning and the range of equivalency of the claims are intended to be embraced therein.