ANTI-C-MET ANTIBODY-DRUG CONJUGATE AND APPLICATIONS THEREOF

20240165253 ยท 2024-05-23

    Inventors

    Cpc classification

    International classification

    Abstract

    The present disclosure relates to the technical field of c-Met antibody drugs, specifically to a c-Met-targeted antibody-drug conjugate and applications thereof. The antibody-drug conjugate of the present disclosure comprises an antibody conjugated with one or more therapeutic agents or antigen-binding fragments of the antibody, is able to effectively inhibit the growth of a tumor tissue, provides a significant inhibitory effect with respect to c-Met-positive cancer, and has excellent safety.

    Claims

    1. A humanized antibody targeting c-Met or antigen-binding fragment thereof, comprising a heavy chain variable region and a light chain variable region, wherein: (1) the heavy chain variable region has a sequence shown in SEQ ID NO: 7, or a sequence that has the same CDRs 1-3 as SEQ ID NO: 7 and an identity of greater than 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% to SEQ ID NO: 7; and/or (2) the light chain variable region has a sequence shown in SEQ ID NO: 8, or a sequence that has the same CDRs 1-3 as SEQ ID NO: 8 and an identity of greater than 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% to SEQ ID NO: 8.

    2. The antibody or antigen-binding fragment thereof according to claim 1, wherein the humanized antibody or antigen-binding fragment thereof is selected from the group consisting of monoclonal antibody, bispecific antibody, multispecific antibody, recombinant protein comprising the antigen-binding fragment, Fab fragment, F(ab) fragment, F(ab)2 fragment, Fv fragment, dAb, Fd, and single chain antibody (scFv).

    3. The antibody or antigen-binding fragment thereof according to claim 1, further comprising a constant region of an immunoglobulin, wherein the immunoglobulin is selected from the group consisting of IgG1, IgG2, IgG3 and IgG4.

    4. The antibody or antigen-binding fragment thereof according to claim 1, wherein: (1) the heavy chain variable region has an amino acid sequence shown in SEQ ID NO: 7; and/or (2) the light chain variable region has an amino acid sequence shown in SEQ ID NO: 8.

    5. The antibody or antigen-binding fragment thereof according to claim 4, wherein the humanized antibody targeting c-Met comprises a heavy chain and a light chain, and (1) the heavy chain has an amino acid sequence shown in SEQ ID NO: 9; and/or (2) the light chain has an amino acid sequence shown in SEQ ID NO:10.

    6. An isolated polynucleotide encoding the antibody or antigen-binding fragment thereof according to claim 1.

    7. A nucleic acid construct comprising the polynucleotide according to claim 6.

    8. The nucleic acid construct according to claim 7, wherein the nucleic acid construct is an expression vector, and the polynucleotide is operably linked to a regulatory sequence that permits expression of a polypeptide encoded by the polynucleotide in a host cell or cell-free expression system.

    9. A host cell comprising the polynucleotide according to claim 6 or the nucleic acid construct according to claim 7 or 8, wherein the host cell is preferably selected from the group consisting of a prokaryotic cell, eukaryotic cell, yeast cell, mammalian cell and E. coli cell; and more preferably, the host cell is selected from the group consisting of a CHO cell, NS0 cell, Sp2/0 cell and BHK cell.

    10. (canceled)

    11. An antibody-drug conjugate targeting c-Met, comprising the antibody or antigen-binding fragment thereof according to claim 1 coupled with one or more therapeutic agents.

    12. The antibody-drug conjugate according to claim 11, wherein the therapeutic agent is selected from the group consisting of a cytotoxic molecule, immunoenhancer and radioisotope, the cytotoxic molecule includes but is not limited to a tubulin inhibitor or DNA damage agent; further preferably, the tubulin inhibitor includes but is not limited to a cytotoxic molecule of dolastatins and auristatins and a cytotoxic molecule of maytansines; the DNA damaging agent includes but is not limited to calicheamicins, duocarmycins, pyrrolobenzodiazepine derivatives (PBD), camptothecins and derivatives thereof, SN-38 and Dxd; more preferably, the cytotoxic molecule of auristatins includes but is not limited to MMAE, MMAF, and a derivative thereof, and the cytotoxic molecule of maytansines includes but is not limited to DM1, DM4, and a derivative thereof.

    13. The antibody-drug conjugate according to claim 12, wherein the antibody-drug conjugate has a structural formula of A-(L-U)n, wherein A represents the antibody or antigen-binding fragment thereof according to any one of claims 1 to 5; U is an active drug unit; L is any linking group, and L is covalently linked to A and U, respectively; n is an integer selected from 1, 2, 3, 4, 5, 6, 7 or 8; and A is linked to 1, 2, 3, 4, 5, 6, 7 or 8 of U through one or more L.

    14. The antibody-drug conjugate according to claim 13, wherein L is covalently linked to the amino residue or thiol residue on A; preferably, L is covalently linked to the thiol residue on A; more preferably, L is covalently linked to the thiol residue formed after the interchain disulfide bond on A is opened.

    15. The antibody-drug conjugate according to claim 14, wherein L comprises a cleavable linker and a non-cleavable linker.

    16. The antibody-drug conjugate according to claim 15, wherein the cleavable linker comprises a peptide unit comprising 2-20 amino acids, and preferably, the peptide unit is selected from the group consisting of -valine-citrulline- (-Val-Cit-), -glycine-glycine-phenylalanine-glycine-(-Gly-Gly-Phe-Gly-), -valine-alanine- (-Val-Ala-), -valine-lysine- (-Val-Lys-), -valine-arginine- (-Val-Arg-), -phenylalanine-citrulline- (-Phe-Cit-), -phenylalanine-lysine-(-Phe-Lys-), -phenylalanine-arginine- (-Phe-Arg-) and a combination thereof.

    17. The antibody-drug conjugate according to claim 15, wherein L comprises a structure selected from the group consisting of: ##STR00023## ##STR00024## ##STR00025## ##STR00026## ##STR00027## ##STR00028## ##STR00029##

    18. The antibody-drug conjugate according to claim 13 or claim 17, wherein U has a structure selected from the group consisting of: ##STR00030## ##STR00031## ##STR00032## ##STR00033##

    19. The antibody-drug conjugate according to claim 13, wherein the antibody-drug conjugate has a structure selected from the group consisting of: ##STR00034## wherein, n in ADC-1 is an integer selected from 1, 2, 3, 4, 5, 6, 7 and 8; or ##STR00035## wherein, n in ADC-2 is an integer selected from 1, 2, 3 and 4; or ##STR00036## wherein, n in ADC-3 is an integer selected from 1, 2, 3 and 4; or ##STR00037## wherein, n in ADC-4 is an integer selected from 1 and 2; or ##STR00038## wherein, n in ADC-5 is an integer selected from 1, 2, 3, 4, 5, 6, 7 and 8; or ##STR00039## wherein, n in ADC-6 is an integer selected from 1, 2, 3, 4, 5, 6, 7 and 8; or ##STR00040## wherein, n in ADC-7 is an integer selected from 1, 2, 3, 4, 5, 6, 7 and 8.

    20. A pharmaceutical composition comprising the antibody or antigen-binding fragment thereof according to claim 1, and a pharmaceutically acceptable carrier.

    21-23. (canceled)

    24. A method for treating a disease comprising administering a therapeutically effective amount of the antibody or antigen-binding fragment thereof according to claim 1 to a patient in need thereof, wherein the disease is a c-Met positive cancer, preferably lung cancer and gastric cancer.

    25. A kit comprising a container, a preparation placed in the container and an optional instruction; wherein the preparation comprises the antibody or antigen-binding fragment thereof according to claim 1.

    26-27. (canceled)

    28. A recombinant protein comprising the antibody or antigen-binding fragment according to claim 1.

    29. The recombinant protein according to claim 28, wherein the recombinant protein is a bispecific antibody or a multispecific antibody.

    30. A method of manufacturing a recombinant protein, comprising using the antibody or antigen-binding fragment according to claim 1.

    31. A pharmaceutical composition comprising the antibody-drug conjugate according to claim 11, and a pharmaceutically acceptable carrier.

    32. A method for treating a disease comprising administering a therapeutically effective amount of the antibody-drug conjugate according to claim 11 to a patient in need thereof, wherein the disease is a c-Met positive cancer, preferably lung cancer and gastric cancer.

    33. A method for treating a disease comprising administering a therapeutically effective amount of the pharmaceutical composition according to claim 20 to a patient in need thereof, wherein the disease is a c-Met positive cancer, preferably lung cancer and gastric cancer.

    34. A kit comprising a container, a preparation placed in the container and an optional instruction; wherein the preparation comprises the antibody-drug conjugate according to claim 11 or a pharmaceutically acceptable salt or solvate thereof.

    35. A kit comprising a container, a preparation placed in the container and an optional instruction; wherein the preparation comprises the pharmaceutical composition according to claim 20.

    Description

    BRIEF DESCRIPTION OF DRAWINGS

    [0043] FIG. 1 shows the comparison of affinities of humanized antibody AAJ8D6 and chimeric antibody cAAJ8D8;

    [0044] FIG. 2 shows the comparison of the binding ability of humanized antibody AAJ8D6 and ABT-700;

    [0045] FIG. 3 shows the endocytosis effect of humanized antibody AAJ8D6, AAJ8D6-Mc-Val-Cit-MMAE, AAJ8D6-PY-Val-Cit-MMAE, and AAJ8D6-D07-Val-Cit-MMAE;

    [0046] FIGS. 4A-4D show the comparison of the cytotoxic activity of humanized antibody AAJ8D6, its antibody-drug conjugate AAJ8D6-Mc-Val-Cit-MMAE and the control group, among which the representative cell line in FIG. 4A is MKN-45, the representative cell line in FIG. 4B is SNU-620, the representative cell line in FIG. 4C is HT29, and the representative cell line in FIG. 4D is BXPC-3;

    [0047] FIG. 5 shows the comparison of the maximum inhibition rate of antibody-drug conjugate AAJ8D6-Mc-Val-Cit-MMAE and antibody-drug conjugate ABT-700-Mc-Val-Cit-MMAE;

    [0048] FIG. 6 shows the comparison of the therapeutic effects of antibody-drug conjugate AAJ8D6-Mc-Val-Cit-MMAE and the control group on MKN-45 tumor-bearing nude mice;

    [0049] FIG. 7 shows the comparison of the efficacy of antibody-drug conjugate AAJ8D6-Mc-Val-Cit-MMAE and the control group on a PDX model of mice (gastric cancer GA0046); and

    [0050] FIG. 8 shows the comparison of the efficacy of antibody-drug conjugate AAJ8D6-Mc-Val-Cit-MMAE and the control group on a PDX model of mice (lung cancer LU2503).

    DETAILED DESCRIPTION

    Definitions

    [0051] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as understood by those of ordinary skill in the art. For definitions and terms in the art, those skilled in the art can specifically refer to Current Protocols in Molecular Biology (Ausubel). The abbreviations for amino acid residues are the standard 3-letter and/or 1-letter codes used in the art to refer to one of the 20 commonly used L-amino acids.

    Definitions

    [0052] Although the numerical ranges and parameter approximations are shown in the broad scope of the present disclosure, the numerical values shown in the specific examples are recorded as accurately as possible. However, any numerical value must inherently include an error, which is caused by the standard deviation in their respective measurements. In addition, all ranges disclosed herein should be understood as covering any and all subranges therein. For example, a recorded range of 1 to 10 should be considered to include any and all sub-ranges between a minimum of 1 and a maximum of 10 (inclusive); that is, all sub-ranges beginning with a minimum of 1 or greater, such as 1 to 6.1, and sub-ranges ending with a maximum of 10 or less, such as 5.5 to 10. In addition, any reference referred to as incorporated herein should be understood as being incorporated in its entirety.

    [0053] It should also be noted that, as used in this specification, the singular form includes the plural form of the object to which it refers, unless clearly and explicitly limited to one object to which it refers. The term or may be used interchangeably with the term and/or unless the context clearly indicates otherwise.

    [0054] As used herein, the terms pharmaceutical composition, combined drug, or pharmaceutical combination are used interchangeably, and means a combination of at least one drug and may have a pharmaceutically acceptable carrier or adjuvant material combined together to achieve a particular purpose. In one embodiment, the pharmaceutical composition comprises a combination that is separated in time and/or space as long as it can work together to achieve embodiments of the present disclosure. For example, the components contained in the pharmaceutical composition (for example, the antibody, nucleic acid molecule, nucleic acid molecule combination, and/or antibody-drug conjugate according to the present disclosure) may be administered to a subject as a whole or separately. When the ingredients contained in the pharmaceutical composition are separately administered to a subject, the ingredients can be administered to the subject simultaneously or sequentially. In one embodiment, the pharmaceutically acceptable carrier is water, a buffered aqueous solution, an isotonic saline solution such as PBS (phosphate buffer), glucose, mannitol, dextrose, lactose, starch, magnesium stearate, cellulose, magnesium carbonate, 0.3% glycerol, hyaluronic acid, ethanol or polyalkylene glycol such as polypropylene glycol, triglyceride and the like. The type of the pharmaceutically acceptable carrier used depends, inter alia, on whether the composition according to the present disclosure is formulated for oral, nasal, intradermal, subcutaneous, intramuscular or intravenous administration. The composition according to the present disclosure may contain a wetting agent, an emulsifier or a buffer substance as an additive.

    [0055] The pharmaceutical composition, vaccine or pharmaceutical formulation according to the present disclosure can be administered by any suitable route, for example, orally, nasally, intradermally, subcutaneously, intramuscularly or intravenously.

    [0056] The term therapeutic agent as used herein refers to any substance or entity plays a therapeutic role (e.g., treating, preventing, relieving or inhibiting any disease and/or condition), including but not limited to a chemotherapeutic agent, radiotherapy agent, immunotherapeutic agent, thermally therapeutic agent.

    [0057] As used herein, CDR region or CDR refers to the hypervariable region of the heavy and light chain of an immunoglobulin, as defined by Kabat et al. (Kabat et al., Sequences of proteins of immunological interest, 5th Ed., U.S. Department of Health and Human Services, NIH, 1991, and later editions). There are three heavy chain CDRs and three light chain CDRs. Depending on the circumstances, the term CDR or CDRs used herein is used to indicate one of these regions, or several or even all of these regions, which region contains most of the amino acid residues responsible for binding based on the affinity of an antibody for an antigen or its recognition epitope.

    [0058] For the present disclosure, consistency, identity or similarity between two nucleic acid or amino acid sequences refers to the percentage of the same nucleotide or amino acid residues between the two sequences to be compared obtained after the optimal alignment. The percentage is purely statistical and the differences between the two sequences are randomly distributed and cover their full length. Comparisons between two nucleic acid or amino acid sequences are usually performed by comparing these sequences after aligning them in an optimal manner, and can be performed over a segment or over a comparison window. In addition to manual implementation, the optimal alignment used for comparing sequences can also be performed by the local homology algorithm of Smith and Waterman (1981) [Ad. App. Math. 2:482], by the local homology algorithm of Neddleman and Wunsch (1970) [J. MoI. Biol. 48:443], by the similarity search method of Pearson and Lipman (1988) [Proc. Natl. Acad. Sci. USA 85:2444), or by a computer software using these algorithms (GAP, BESTFIT, FASTA and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI, or by a comparison software BLAST N or BLAST P).

    [0059] As used herein, therapeutically effective amount or effective amount refers to a dose sufficient to demonstrate a benefit when administered to a subject. The actual amount administered, as well as the frequency and time course of administration will depend on the condition and severity of the subject to be treated. General practitioners and other doctors are ultimately responsible for the treatment prescription (for example, decision on the dose) and usually make decisions based on the disease being treated, the condition of the individual patient, the delivery site, the mode of administration, and other factors known to the doctor.

    [0060] The term subject as used herein refers to a mammal, such as human, but may also refer to other animals, such as wild animals (such as heron, stork, crane), domestic animals (such as duck, goose) or experimental animals (such as orangutan, monkey, rat, mouse, rabbit, guinea pig, marmot, ground squirrel).

    [0061] The term antibody includes monoclonal antibody, bispecific antibody, multispecific antibody or recombinant protein including antigen-binding fragment; the term antigen-binding fragment includes Fab fragment, F(ab) fragment, F(ab)2 fragment, Fv fragment, dAb, Fd, single chain antibody (scFv), scFv-Fc fragment or diabody, or any fragment that should be able to increase half-life by chemical modification or by incorporation into liposomes, such chemical modifications as the addition of poly(alkylene) glycols such as polyethylene glycol (PEGylation) (PEGylated fragments known as Fv-PEG, scFv-PEG, Fab-PEG, F(ab)2-PEG or Fab-PEG) (PEG refers to polyethylene glycol), and such fragment has EGFR binding activity. In one embodiment, the functional fragment will consist of or comprise partial sequences of the heavy or light variable chain of the antibody from which it is derived, which partial sequence is sufficient to retain the same binding specificity and sufficient affinity as the antibody from which it is derived, preferably for EGFR at least equal to 1/100 of the affinity of the antibody from which it is derived, more preferably at least equal to 1/10. Such a functional fragment comprises a minimum of 5 amino acids, preferably 10, 15, 25, 50 and 100 contiguous amino acids of the antibody sequence from which it is derived.

    [0062] The term humanized antibody refers to an antibody including a CDR region derived from a non-human antibody, and the other portion of the antibody is derived from one (or several) human antibody (antibodies). Moreover, in order to retain binding affinity, some residues of the backbone (referred to as FR) segment may be modified (Jones et al., Nature, 321:522-525, 1986; Verhoeyen et al., Science, 239: 1534-1536, 1988; Riechmann et al., Nature, 332: 323-327, 1988). A humanized antibody or fragment thereof according to the present disclosure can be prepared by known techniques;

    [0063] The term chimeric antibody refers to an antibody in which the variable region sequence is derived from one species and the constant region sequence is derived from another species, for example, the variable region sequence is derived from a mouse antibody and the constant region sequence is derived from a human antibody. The chimeric antibody or fragment thereof according to the present disclosure can be prepared by using genetic recombination technology. For example, the chimeric antibody can be produced by cloning recombinant DNA including a promoter and a sequence encoding the variable region of the non-human and especially murine monoclonal antibody according to the present disclosure, and a sequence encoding the constant region of a human antibody. The chimeric antibody of the present disclosure encoded by this recombinant gene will be, for example, a murine-human chimera, and the specificity of the antibody is determined by the variable region derived from murine DNA, and its isotype is determined by the constant region derived from human DNA. Method for preparing chimeric antibodies can be found in, for example, Verhoeyn et al. (BioEssays, 8:74, 1988).

    [0064] The term monoclonal antibody refers to a preparation of antibody molecules having a single molecular composition. The monoclonal antibody composition shows a single binding specificity and affinity for a specific epitope.

    [0065] The term AAJ8D6 antibody used herein, unless otherwise specified, refers to the humanized monoclonal antibody AAJ8D6 targeting c-Met obtained by the present disclosure.

    [0066] The cAAJ8D6 antibody used herein refers to a human-murine chimeric antibody including a murine variable region and a human constant region. The difference between the cAAJ8D6 antibody and the AAJ8D6 antibody is only in the framework region in the variable region that the framework region of cAAJ8D6 is of murine origin, and the framework region of AAJ8D6 is of human origin.

    [0067] In general, in order to prepare a monoclonal antibody or functional fragment thereof, especially of murine origin, reference may be made to the techniques described in particular in the manual Antibodies (Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor NY, pp. 726, 1988) or to the techniques for preparation from hybridoma cells described by Kohler and Milstein (Nature, 256:495-497, 1975).

    [0068] The monoclonal antibody according to the present disclosure can be purified, for example, on an affinity column on which c-Met antigen has been immobilized in advance or which comprises one of the fragments of the epitope that can be specifically recognized by the monoclonal antibody according to the present disclosure. More specifically, the monoclonal antibody can be purified by protein A and/or G chromatography, in the presence or absence of ion exchange chromatography aimed at eliminating residual protein contaminants as well as DNA and LPS with or without size exclusion chromatography on Sepharose gels aimed at eliminating potential aggregates due to the presence of dimers or other multimers. More preferable, all of these techniques can be used simultaneously or sequentially.

    [0069] The term dolastatin as used herein refers to a polypeptide isolated from a marine organism, Dollabella auricularia, which includes, but is not limited to, dolastatin 10 and dolastatin 15. Dolastatin is a mitotic inhibitor that exhibits strong anticancer activity, and is therefore a candidate for anticancer drugs. The researchers further discovered and synthesized many derivatives of dolastatin, such as MMAE and MMAF.

    [0070] The term linker or linking group as used herein refers to the moiety of an antibody-drug conjugate (i.e. ADC) that links an antibody to a drug, which may or may not be cleavable. Cleavable linkers (i.e., breakable linkers or biodegradable linkers) can be cleaved in or on target cells to release the drug. In one embodiment, the linker of the present disclosure has very good stability, greatly reducing the release of the drug before delivery to the target (e.g., in the blood), to reduce side effects and toxicity. In some specific embodiments, the linker of the present disclosure is selected from cleavable linkers, such as disulfide-based linkers (which are selectively cleaved in tumor cells with higher thiol concentrations), peptide linkers (which are cleaved by enzymes in tumor cells) and hydrazone linker. In other specific embodiments, the linker of the present disclosure is selected from non-cleavable linkers, such as thioether linkers. In one embodiment, the linker of the present disclosure is selected from the group consisting of cleavable mc-vc-PAB linker and non-cleavable mc linker.

    [Specific Examples]

    Example 1. Preparation of Humanized c-Met Antibody and Determination of Amino Acid Sequence Thereof

    [0071] Based on the c-Met murine antibody mAAJ8D6, a variety of chimeric antibodies and humanized antibodies were further designed and compared for affinity, and the candidate chimeric c-Met antibody cAAJ8D6 and humanized anti-antibody AAJ8D6 were finally determined.

    TABLE-US-00006 TABLE2 CDRs1-3ofheavychainvariableregionandlight chainvariableregionofAAJ8D6(Kabatmethod) Heavy HCDR1 SEQIDNO:1 SYWMH chain HCDR2 SEQIDNO:2 MIDPSDSESRLNQKFKD HCDR3 SEQIDNO:3 SGYHGTSYWYFDV Light LCDR1 SEQIDNO:4 RSSKSLLHSDGITYLY chain LCDR2 SEQIDNO:5 QMSNLAS LCDR3 SEQIDNO:6 AQNLELPPT

    [0072] Amino acid sequence of the heavy chain variable region of anti-c-Met humanized antibody AAJ8D6 (SEQ ID NO: 7):

    TABLE-US-00007 QVQLEQSGPEVVKPGASVKVSCKASGYSFTSYWMHWVRQAPGQGLEWMGMIDPSDSESRL 60 NQKFKDRVTMTVDTPTSTVYMELSSPRSEDTAVYYCARSGYHGTSYWYFDVWGQGTLVTV 120 SS 122

    [0073] Amino acid sequence of the light chain variable region of anti-c-Met humanized antibody AAJ8D6 (SEQ ID NO: 8):

    TABLE-US-00008 DIVMTQSPLSLPVTPGEPASISCRSSKSLLHSDGITYLYWYLQKPGQSPQLLIYQMSNLA 60 SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCAQNLELPPTFGGGTKVEIKRTV 115

    [0074] Amino acid sequence of the heavy chain of anti-c-Met humanized antibody AAJ8D6 (SEQ ID NO: 9):

    TABLE-US-00009 QVQLEQSGPEVVKPGASVKVSCKASGYSFTSYWMHWVRQAPGQGLEWMGMIDPSDSESRL 60 NQKFKDRVTMTVDTPTSTVYMELSSPRSEDTAVYYCARSGYHGTSYWYFDVWGQGTLVTV 120 SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ 180 SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELL 240 GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ 300 YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR 360 EEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS 420 RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 452

    [0075] Amino acid sequence of the light chain of anti-c-Met humanized antibody AAJ8D6 (SEQ ID NO: 10):

    TABLE-US-00010 DIVMTQSPLSLPVTPGEPASISCRSSKSLLHSDGITYLYWYLQKPGQSPQLLIYQMSNLA 60 SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCAQNLELPPTFGGGTKVEIKRTVAAPSV 120 FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL 180 SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 219

    Example 2 Affinity Comparison of Chimeric cAAJ8D6 and Humanized Antibody AAJ8D6

    [0076] The affinities of chimeric cAAJ8D6 and the humanized antibody AAJ8D6 were determined by ELISA. A 96-well plate was coated with soluble ED protein and then incubated with diluted antibodies. ED-related antibodies were detected with an HRP-conjugated goat F(ab)2 anti-human IgG Fc-specific secondary antibody. The GraphPaD Prism software was used and X was changed to logX to fit a dose-response curve, which is shown in FIG. 1.

    [0077] From the experimental results shown in FIG. 1, the comparison of AAJ8D6 with cAAJ8D6 show that the humanized antibody AAJ8D6 not only did not have a reduced binding affinity, but had a more significant improvement, and the required amount of antibody was reduced by more than half under the same binding strength compared to the chimeric antibody cAAJ8D6. The specific results are shown in Table 3:

    TABLE-US-00011 TABLE 3 Comparison of average affinity constants between humanized antibody and chimeric antibody Name EC50 (ng/mL) R.sup.2 AAJ8D6 3.529 0.9923 cAAJ8D6 7.830 0.9988

    Example 3 Comparison of Binding Abilities of Humanized Antibody AAJ8D6 and Competitor ABT-700

    [0078] The c-Met protein was prepared with a diluent to a final concentration of 2 ?g/ml, and added to a microplate at 100 ?l per well, overnight at 4? C. The solution in the well was discarded, and the plate was washed three times with PBST. The plate was added with a blocking solution at 300 ?l/well and incubated at 37? C. for 2 h. The solution in the well was discarded, and the plate was washed three times with PBST. AAJ8D6 antibody and ABT-700 (i.e., telisotuzumab, its sequence information can be found at https://extranet.who.int/soinn/mod/page/view.php?id=137&inn n=10366, the same below) were diluted to 9 concentrations, added to the 96-well plate and incubated for 2 h. The solution in the well was discarded, and the plate was washed three times with PBST. HRP detection antibody was prepared by adding diluent at a dilution of 1:5000, added at 100 ?l per well, and incubated at 37? C. for 1 h. The solution in the well was discarded, and the plate was washed three times with PB ST. The plate was added with TMB color developing solution, incubated at room temperature for 2 min, and then added with Elisa stop solution. The plate was put on a reader to obtain the results, which are shown in Table 4 and FIG. 2.

    [0079] It can be seen from Table 4 and FIG. 2 that the EC50 value of AAJ8D6 was 0.54 ng/ml, and the EC50 value of ABT-700 was 1.33 ng/ml. The results show that the binding ability of AAJ8D6 antibody to c-Met antigen was significantly better than ABT-700.

    TABLE-US-00012 TABLE 4 Comparison of the binding abilities of AAJ8D6 and ABT-700 to c-Met antigen AAJ8D6 ABT-700 EC50 (ng/ml) 0.54 1.33

    Example 4 Preparation of Antibody-Drug Conjugates

    [0080] The preparation of antibody-drug conjugates was performed according to a general conjugation method: a reducing agent and a protecting agent were prepared with purified water as follows: 1-20 mM TCEP (Tris-2-carboxyethyl-phosphine) and 1-20 mM DTPA (Diethylene triamine pentacetate acid) mother liquor, where the amount of reducing agent can be added within a concentration range according to the required coupling rate, were mixed with a concentration of monoclonal antibody (such as: 5-30 mg/mL) according to a volume ratio (1:1), and the final concentration molar ratio of TCEP to antibody was 0.5-6.0:1. The reaction was performed by stirring at 25? C. for 1 h. The TCEP-reduced antibody can be directly conjugated.

    [0081] A concentration (5 mM) of a linker-active drug unit compound was prepared and dissolved in 25% DMSO (dimethyl sulfoxide). According to the molar ratio of drug to thio group of 0.32.8:1, the drug was slowly added, and the reaction was performed by stirring at 25? C. for 1-4 h. After the reaction, centrifugal ultrafiltration was performed 3 times with PBS buffer to purify and remove residual unreacted drugs and free small molecules such as DMSO, and SDS-PAGE electrophoresis and hydrophobic high performance liquid chromatography (HIC-HPLC) were used to detect the conjugation.

    [0082] The linker-active drug unit compounds used in this example are Mc-Val-Cit-PAB-MMAE, D07-Val-Cit-PAB-MMAE and Py-MAA-Val-Cit-PAB-MMAE, whose structural formula are respectively as follows (for the synthesis methods, reference can be made to patent applications CN108853514A (page 14 of the specification), CN111433188A (page 53 of the specification), and WO2019223579A1 (pages 25-27 of the specification)).

    ##STR00019##

    [0083] The following ADCs were prepared by the above method (p was an integer selected from 1, 2, 3, 4, 5, 6, 7 and 8, q was an integer selected from 1, 2, 3 and 4, and Ab was the AAJ8D6 antibody provided by the present disclosure). The average DAR of these ADCs was 4.

    ##STR00020##

    [0084] In addition, this example also prepared an antibody-drug conjugate whose antibody part was ABT-700 antibody, the linking group was Mc-Val-Cit-PAB, and the active drug unit was MMAE, where p is an integer selected from 1, 2, 3, 4, 5, 6, 7 and 8, and the average DAR was 4.

    ##STR00021##

    [0085] In addition, this example also prepared an antibody-drug conjugate of human immunoglobulin IgG1, Mc-Val-Cit-PAB and MMAE (i.e., IgG1-Mc-Val-Cit-PAB), where p was an integer selected from 1, 2, 3, 4, 5, 6, 7 and 8, and the average DAR was 4.

    ##STR00022##

    Example 5 Endocytosis Experiment

    [0086] HT29 cells were resuspended in 6-well plates at approximately 1?10.sup.5 cells per well. AAJ8D6 antibody, AAJ8D6-Mc-Val-Cit-MMAE, AAJ8D6-PY-Val-Cit-MMAE and AAJ8D6-D07-Val-Cit-MMAE were conjugated to pHAb amine-reactive dyes, respectively, and then diluted with cell culture medium to 10 ?g/ml. 100 ?l of AAJ8D6 antibody, AAJ8D6-Mc-Val-Cit-MMAE, AAJ8D6-PY-Val-Cit-MMAE and AAJ8D6-D07-Val-Cit-MMAE dye complexes were added to cells and incubated at 37? C. for indicated times (0 h, 1 h, 3 h, 5 h, 21 h and 24 h). The endocytosis effects of AAJ8D6 antibody, AAJ8D6-Mc-Val-Cit-MMAE, AAJ8D6-PY-Val-Cit-MMAE and AAJ8D6-D07-Val-Cit-MMAE were measured by flow cytometry. After 24 h, the samples were significantly endocytosed in HT29 cells; after 3 h, the endocytosis effects were all about 90%. It can be seen that the humanized antibody provided by the present disclosure and the prepared ADCs had good endocytosis effects, which will be able to efficiently deliver the drug into the target cells. The results are shown in FIG. 3.

    Example 6 Cytotoxic Activities of Humanized Antibody AAJ8D6 and its Antibody-Drug Conjugate (AAJ8D6-Mc-Val-Cit-MMAE)

    [0087] Cells MKN-45, SNU-620, HT29, and BXPC-3 with different c-Met expression levels in exponential doubling phase were seeded in 96-well plates, respectively, and incubated overnight in a 37? C., 5% CO.sub.2 incubator. AAJ8D6, AAJ8D6-Mc-Val-Cit-MMAE and IgG1-Mc-Val-Cit-PAB were prepared in complete medium to a concentration of 1.25-2000 ng/mL, and MMAE was prepared in complete medium to a concentration of 0.0021-80 ng/mL. They were added to the plate at 100 ?L per well with triplicate wells set up for each concentration, and a blank control group was set as well. After 72?2 h of drug action, the plate was added with CCK-8 reagent, incubated at 37? C., 5% CO.sub.2 incubator for 1 to 4 h, and detected for OD value of each well at 450 nm of a microplate reader. The inhibition rate (IR) was calculated as: IR %=(OD of blank-OD of drug)?100/OD of blank. Four-parameter fitting was performed on the inhibition rate and drug concentration to calculate IC.sub.50.

    [0088] Results and conclusions: As shown in FIGS. 4A, 4B, 4C and 4D, the cytotoxic activity of AAJ8D6-Mc-Val-Cit-MMAE was positively correlated with the expression of c-Met in the cell line, while AAJ8D6 had no cytotoxic effect on target cells. The cytotoxicity of AAJ8D6-Mc-Val-Cit-MMAE mainly came from MMAE, which had targeting ability compared with IgG1-Mc-Val-Cit-PAB.

    [0089] Example 7 In vitro efficacy differences between antibody-drug conjugate AAJ8D6-Mc-Val-Cit-MMAE and antibody-drug conjugate ABT-700-Mc-Val-Cit-MMAE

    [0090] The suspension of human colon cancer cell line HT29 was added to a 96-well plate at a density of 100 ?L/well and 5000 cells/well, and placed in a water-saturated 37? C., CO.sub.2 incubator overnight. The antibody-drug conjugate AAJ8D6-Mc-Val-Cit-MMAE and the antibody-drug conjugate ABT-700-Mc-Val-Cit-MMAE were serially diluted and added to a 96-well plate containing cells at 100 ?L/well. The plate was placed in a 37? C. incubator to culture for another 72 h. The OD values at 450 nm were read with the microplate reader, and the inhibition rate (IR) was calculated as: IR %=(OD of blank-OD of drug)?100/OD of blank. The curve fitting software Softmax Pro7.0.3 Gxp was used to calculate IC.sub.50.

    [0091] The results are shown in Table 5 and FIG. 5. The experimental results showed that the IC.sub.50 maximum inhibition rate of AAJ8D6-Mc-Val-Cit-MMAE was significantly better than that of the antibody-drug conjugate ABT-700-Mc-Val-Cit-MMAE, indicating that the in vitro efficacy of AAJ8D6-Mc-Val-Cit-MMAE was better than that of the antibody-drug conjugate ABT-700-Mc-Val-Cit-MMAE.

    TABLE-US-00013 TABLE 5 Results of maximum inhibition rate of antibody- drug conjugates on cells in vitro ADC Inhibition rate (%) AAJ8D6-Mc-Val-Cit-MMAE 93.62 ABT-700-Mc-Val-Cit-MMAE 66.28

    Example 8 Efficacy of Antibody-Drug Conjugate AAJ8D6-Mc-Val-Cit-MMAE on Human Gastric Cancer Cell MKN-45Subcutaneously Transplanted Tumors in Balb/c Nude Mice

    [0092] 42 Balb/c nude mice aged 6-7 weeks were taken, and 0.1 mL of MKN-45 cell suspension (2.4?10.sup.6 cells/mouse) was subcutaneously implanted in the back of the right armpit of the mice. When the tumor grew to about 100-300 mm.sup.3, according to the tumor volume, mice were randomly divided into the Vehicle (PBS) group, IgG1-Mc-Val-Cit-PAB (3 mg/kg) group, antibody-drug conjugate AAJ8D6-Mc-Val-Cit-MMAE (0.75 mg/kg) group, antibody-drug conjugate AAJ8D6-Mc-Val-Cit-MMAE (1.5 mg/kg) group, antibody-drug conjugate AAJ8D6-Mc-Val-Cit-MMAE (3 mg/kg) and humanized antibody AAJ8D6 (3 mg/kg) group, 6 tumor-bearing mice in each group. Each group was administered intravenously, once a week, for a total of 3 times, and measured for long diameter and short diameter of tumor and body weight twice a week during the administration. On Day 21 after administration, the tumor inhibition rate (TGI.sub.RTV) was calculated for efficacy evaluation.

    [0093] Calculation formula:

    [0094] Tumor volume: TV=D1?D2.sup.2/2, where D1 and D2 represent the long diameter and

    [0095] the short diameter of the tumor, respectively;

    [0096] Relative tumor volume: RTV=TV.sub.n/TV.sub.0, where TV? is the tumor volume before administration, and TV.sub.n is the tumor volume at each measurement;

    [0097] Relative tumor inhibition rate: TGI.sub.RTV(%)=(1-T.sub.RTV/C.sub.RTV) 100%, T.sub.RTV means RTV of drug administration group or positive control group, and C.sub.RTV means RTV of negative control group.

    TABLE-US-00014 TABLE 6 Tumor volume and inhibition rate of each experimental group and control group on MKN-45 subcutaneously transplanted tumor in nude mice Dose (mg/ TV (mm.sup.3) TGI.sub.RTV Group kg) D 0 D 21 % Vehicle (PBS) 201 ? 25 1509 ? 276 AAJ8D6 3 200 ? 24 1633 ? 77 ?15 IgG1-Mc-Val-Cit-PAB 3 201 ? 23 1314 ? 177 11 AAJ8D6-Mc-Val-Cit-MMAE 0.75 200 ? 22 1135 ? 74 22 1.5 203 ? 23 415 ? 50 70 3 201 ? 22 36 ? 9 99

    [0098] Result and conclusion: The inhibitory effect of each experimental group and control group on MKN-45 subcutaneously transplanted tumor in nude mice is shown in Table 6 and FIG. 6, and Table 6 shows tumor volume and inhibition rate of each experimental group and control group on MKN-45 subcutaneously transplanted tumor in nude mice, and FIG. 6 shows the tumor growth curve after administration. The experimental results showed that the antibody-drug conjugate AAJ8D6-Mc-Val-Cit-MMAE had a significant inhibitory effect on the MKN-45 subcutaneously transplanted tumor in nude mice.

    Example 9 Efficacy of Antibody-Drug Conjugate AAJ8D6-Mc-Val-Cit-MMAE on Mouse PDX Model (Gastric Cancer GA0046)

    [0099] The mouse PDX (patient-derived xenograft) model of gastric cancer GA0046 was constructed by transplanting tumor tissue from human patients with gastric cancer into severely immunodeficient mice, in which the gastric cancer tissue grew to form a transplanted tumor.

    [0100] The tumor-bearing mice with good tumor growth were picked and euthanized, and the tumors were removed and cut into small pieces (2-3 mm in diameter), which were then inoculated on the right shoulder of the mice to establish a subcutaneous gastric cancer model. The tumor growth was regularly observed, and when the tumor grew to an average volume of about 100-150 mm 3, according to the tumor size and the weight of mice, mice were randomly divided into Vehicle (PBS) group, antibody-drug conjugate AAJ8D6-Mc-Val-Cit-MMAE (10 mg/kg) group, and IgG1-Mc-Val-Cit-PAB (10 mg/kg) group, 6 tumor-bearing mice in each group. Each group was administered intravenously, once a week, for a total of 2 times, for a total of 21 times. The long diameter and short diameter of tumor and body weight were measured twice a week during the administration. On Day 21 after administration, the tumor inhibition rate (TGI.sub.RTV) was calculated for efficacy evaluation.

    [0101] Calculation formula:

    [0102] Tumor volume: TV=D1?D2.sup.2/2, where D1 and D2 represent the long diameter and the short diameter of the tumor, respectively;

    [0103] Relative tumor volume: RTV=TV.sub.n/TV.sub.0, where TV? is the tumor volume before administration, and TV.sub.n is the tumor volume at each measurement;

    [0104] Relative tumor inhibition rate: TGI.sub.RTV(%)=(1-T.sub.RTV/C.sub.RTV) 100%, T.sub.RTV means RTV of drug administration group or positive control group, and C.sub.RTV means RTV of negative control group.

    [0105] Results and conclusions: The tumor inhibitory effects of each experimental group and control group on the mouse gastric cancer PDX model (GA0046) are shown in Table 7 and FIG. 7, in which Table 7 shows the tumor volume of and inhibition rate on the mouse gastric cancer PDX model (GA0046), and FIG. 7 shows the tumor growth curve after administration. The results showed that the antibody-drug conjugate AAJ8D6-Mc-Val-Cit-MMAE had a significant anti-tumor effect on the gastric cancer GA0046PDX tumor model at a dose of 10 mg/kg.

    TABLE-US-00015 TABLE 7 Tumor volume and inhibition rate of antibody- drug conjugate AAJ8D6-Mc-Val-Cit-MMAE on mouse PDX model of gastric cancer GA0046 Tumor volume (mm.sup.3) Inhibition Group TV.sub.D 0 TV.sub.D 21 rate (%) Vehicle(PBS) 133.90 ? 18.34 1048.57 ? 112.90 IgG1-Mc-Val-Cit-PAB 134.55 ? 26.59 609.72 ? 114.26 42.13 AAJ8D6-Mc-Val-Cit- 131.38 ? 17.85 0.00 ? 0.00 100.00 MMAE

    Example 10 Efficacy of Antibody-Drug Conjugate AAJ8D6-Mc-Val-Cit-MMAE on Mouse PDX Model (Lung Cancer LU2503)

    [0106] The mouse PDX (patient-derived xenograft) model of lung cancer LU2503 was constructed by transplanting tumor tissue from human patients with lung cancer into severely immunodeficient mice, in which the gastric cancer tissue grew to form a transplanted tumor.

    [0107] The tumor-bearing mice with good tumor growth were picked and euthanized, and the tumors were removed and cut into small pieces (2-3 mm in diameter), which were then inoculated on the right shoulder of the mice to establish a subcutaneous lung cancer model. The tumor growth was regularly observed, and when the tumor grew to an average volume of about 150 mm.sup.3, according to the tumor size and the body weight of mice, mice were randomly divided into Vehicle (PBS) group, humanized antibody AAJ8D6 (10 mg/kg) group, and low, medium and high concentrations of antibody-drug conjugate AAJ8D6-Mc-Val-Cit-MMAE (1.1 mg/kg, 3.3 mg/kg, 10 mg/kg) groups, 6 tumor-bearing mice in each group. Mice in the antibody-drug conjugate AAJ8D6-Mc-Val-Cit-MMAE and humanized antibody AAJ8D6 groups were administered intravenously, once a week, for a total of 2 times. The long diameter and short diameter of tumor and body weight were measured twice a week during the administration. On Day 21 after administration, the tumor inhibition rate (TGI.sub.RTV) was calculated for efficacy evaluation.

    [0108] Calculation formula: [0109] Tumor volume: TV=D1?D2.sup.2/2, where D1 and D2 represent the long diameter and the short diameter of the tumor, respectively; [0110] Relative tumor volume: RTV=TV.sub.n/TV.sub.0, where TV? is the tumor volume before administration, and TV.sub.n is the tumor volume at each measurement; [0111] Relative tumor inhibition rate: TGI.sub.RTV(%)=(1-T.sub.RTV/C.sub.RTV) 100%, T.sub.RTV means RTV of drug administration group or positive control group, and C.sub.RTV means RTV of negative control group.

    [0112] Results and conclusions: The tumor inhibitory effects of each experimental group and control group on the mouse lung cancer PDX model (LU2503) are shown in Table 8 and FIG. 8, in which Table 8 shows the tumor volume of and inhibition rate on the mouse lung cancer PDX model (LU2503), and FIG. 8 shows the tumor growth curve after administration. The results showed that the antibody-drug conjugate AAJ8D6-Mc-Val-Cit-MMAE had a significant anti-tumor effect on the LU2503 tumor model when used alone at doses of 1.1 mg/kg, 3.3 mg/kg and 10 mg/kg, and especially at 3.3 mg/kg and 10 mg/kg, the tumors of mice completely disappeared.

    TABLE-US-00016 TABLE 8 Tumor volume and inhibition rate of ADC on mouse PDX model (LU2503) Dose (mg/ Tumor volume (mm.sup.3) Inhibition Group kg) TV.sub.D 0 TV.sub.D 21 rate (%) Vehicle (PBS) 150.43 ? 6.69 1864.30 ? 228.19 AAJ8D6 10 157.05 ? 9.21 1165.02 ? 163.71 37.60 AAJ8D6-Mc- 1.1 150.47 ? 8.46 270.61 ? 116.64 85.49 Val-Cit- 3.3 150.53 ? 8.21 0.00 ? 0.00 100.00 MMAE 10 150.33 ? 6.47 0.00 ? 0.00 100.00

    [0113] The above examples show that the antibody-drug conjugate AAJ8D6-Mc-Val-Cit-MMAE provided by the present disclosure has a very significant therapeutic effect on c-Met positive tumors.

    [0114] The principles and implementations of the present disclosure are illustrated by specific examples herein, and the descriptions of the above examples are only used to help understand the method and the central idea of the present disclosure. Several improvements and modifications can also be made to the present disclosure without departing from the principles of the present disclosure, and these improvements and modifications also fall within the protection of the claims of the present disclosure.