PEPTIDIC POSITIVE ALLOSTERIC MODULATORS TARGETING TRPV1
20240166695 ยท 2024-05-23
Assignee
Inventors
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
C12N2740/16052
CHEMISTRY; METALLURGY
C07K2319/75
CHEMISTRY; METALLURGY
A61K45/06
HUMAN NECESSITIES
C12N2740/16022
CHEMISTRY; METALLURGY
International classification
A61K45/06
HUMAN NECESSITIES
C07K14/00
CHEMISTRY; METALLURGY
A61K38/16
HUMAN NECESSITIES
Abstract
Peptidic positive allosteric modulators of TRPV1 are provided. Methods for the design of TPRV1 allosteric modulators are also described, as well as methods for the treatment of conditions such as pain, pruritus, and cancer.
Claims
1. A vanilloid receptor 1 (TRPV1) allosteric modulator comprising a peptide containing two hotspot amino acid residues, wherein the hotspot amino acid residues are aromatic amino acid residues that interact with a TRPV1 ankyrin repeat domain (ARD), and wherein alpha carbon atoms in the two hotspot amino acid residues are within 5-10 ? of each other upon folding of the peptide under physiological conditions.
2. The TRPV1 allosteric modulator of claim 1, wherein the hotspot amino residues are phenylalanine residues.
3. The TRPV1 allosteric modulator of claim 1, comprising a polypeptide sequence having at least 70% identity to positions 64-94 of SEQ ID NO:9, provided that the amino acid residues at position 72 and position 76 are hotspot amino acid residues.
4. The TRPV1 allosteric modulator of claim 3, comprising a polypeptide sequence having at least 95% identity to positions 64-94 of SEQ ID NO:9, provided that the amino acid residues at position 72 and position 76 are hotspot phenylalanine residues.
5. The TRPV1 allosteric modulator of claim 3, comprising a polypeptide sequence having at least 70% identity to SEQ ID NO:9 provided that the amino acid residues at position 72 and position 76 are hotspot amino acid residues.
6. The TRPV1 allosteric modulator of claim 5, wherein the hotspot amino residues are phenylalanine residues.
7. The TRPV1 allosteric modulator of claim 6, comprising a polypeptide sequence having at least 90% identity to SEQ ID NO:9 provided that the amino acid residues at position 72 and position 76 are hotspot phenylalanine residues.
8. The TRPV1 allosteric modulator of claim 7, wherein: the peptide comprises a helix.sup.1-loop-helix.sup.2-loop-helix.sup.3 architecture, helix.sup.1, helix.sup.2, and helix.sup.3 are folded in a three-helix bundle, and the hotspot amino acid residues are phenylalanine residues located in helix.sup.3.
9. The TRPV1 allosteric modulator of claim 1, comprising a polypeptide sequence having at least 70% identity to positions 35-89 of SEQ ID NO:8, provided that the amino acid residues at position 36 and position 83 are hotspot amino acid residues.
10. The TRPV1 allosteric modulator of claim 9, wherein the hotspot amino residues are phenylalanine residues.
11. The TRPV1 allosteric modulator of claim 9, comprising a polypeptide sequence having at least 95% identity to positions 35-89 of SEQ ID NO:8 provided that the amino acid residues at position 36 and position 83 are hotspot phenylalanine residues.
12. The TRPV1 allosteric modulator of claim 11, comprising a polypeptide sequence having at least 70% identity to SEQ ID NO:8 provided that the amino acid residues at position 36 and position 83 are hotspot amino acid residues.
13. The TRPV1 allosteric modulator of claim 12, comprising a polypeptide sequence having at least 90% identity to SEQ ID NO:8 provided that the amino acid residues at position 36 and position 83 are hotspot phenylalanine residues.
14. The TRPV1 allosteric modulator of claim 13, wherein: the peptide comprises a helix.sup.1-loop-strand.sup.1-helix.sup.2-turn-helix.sup.3-strand.sup.2-helix.sup.4 architecture, strand.sup.1 and strand.sup.2 and folded in a parallel ? sheet, and the hotspot amino acid residues are phenylalanine residues located in helix.sup.2 and helix.sup.4.
15. The TRPV1 allosteric modulator of claim 1, further comprising a cell penetration peptide sequence.
16. The TRPV1 allosteric modulator of claim 15, wherein the cell penetration peptide sequence is an HIV-1 tat protein sequence.
17. A nucleic acid comprising a polynucleotide sequence encoding a TRPV1 allosteric modulator according to any one of claims 1-16.
18. An expression cassette comprising the nucleic acid of claim 17.
19. A recombinant cell comprising the nucleic acid of claim 17 or the expression cassette of claim 18.
20. A pharmaceutical composition comprising a TRPV1 allosteric modulator according to any one of claims 1-16 or the nucleic acid of claim 17 and a pharmaceutically acceptable excipient.
21. A method for treating a condition associated with TRPV1 activity, the method comprising administering an effective amount of a TRPV1 allosteric modulator according to any one of claims 1-16 to a subject in need thereof.
22. The method of claim 21, wherein the condition is selected from the group consisting of pain, pruritus, and cancer.
23. The method of claim 22, wherein the pain comprises chronic pain or acute pain.
24. The method of claim 22, wherein the pain comprises neuropathic pain, inflammatory pain, cancer pain, or a combination thereof.
25. The method of claim 24, further comprising administering a non-steroidal anti-inflammatory agent, an opioid analgesic, acetaminophen, or a combination thereof to the subject.
26. The method of claim 22, wherein the pruritus comprises histamine-induced itching, lymphoma-induced itching, allergic itching, infection-induced itching, liver- or kidney-induced itching, diabetes-induced itching, skin disorder-induced itching, opioid-induced itching, or a combination thereof.
27. The method of claim 22, further comprising administering an antihistamine, a steroid, an anesthetic, or a combination thereof to the subject.
28. The method of claim 22, wherein the cancer is breast cancer, squamous cell carcinoma, hepatocellular carcinoma, or carcinoma of the bladder.
29. The method of claim 22, further comprising administering an anti-cancer agent to the subject.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
DETAILED DESCRIPTION OF THE INVENTION
[0056] Transient Receptor Potential Vanilloid 1 (TRPV1) ion channel is a nociceptor critically involved in pain sensation. Direct blockade of TRPV1 exhibits significant analgesic effects but also incurs severe side-effects such as hyperthermia, causing failures of TRPV1 inhibitors in clinical trials. In order to selectively target TRPV1 channels that are involved in pain-sensing, we de novo designed peptidic positive allosteric modulators (PAMs) based on the high-resolution structure of the TRPV1 intracellular ankyrin-repeat like domain. Our improved computational design method increased the success rate in protein binder design as compared to previous methods. We demonstrated experimentally, with a combination of FRET imaging, surface plasma resonance and patch-clamp recording, that the designed PAMs bind to TRPV1 with nanomolar affinity and allosterically enhance its response to ligand activation as we designed. We further demonstrated that the designed PAM exhibits long-lasting in vivo analgesic effects in rats without changing their body temperature, suggesting that they have potentials for developing into novel analgesics.
I. Definitions
[0057] The terms peptide, polypeptide, and protein are used interchangeably herein to refer to a polymer of amino acid residues linked by covalent peptide bonds. All three terms apply to naturally occurring amino acid polymers and non-natural amino acid polymers, as well as to amino acid polymers in which one (or more) amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid. Unless otherwise specified, the terms encompass amino acid chains of any length, including full-length proteins.
[0058] The term amino acid refers to any monomeric unit that can be incorporated into a peptide, polypeptide, or protein. Amino acids include naturally-occurring ?-amino acids and their stereoisomers, as well as unnatural (non-naturally occurring) amino acids and their stereoisomers. Stereoisomers of a given amino acid refer to isomers having the same molecular formula and intramolecular bonds but different three-dimensional arrangements of bonds and atoms (e.g., an L-amino acid and the corresponding D-amino acid).
[0059] Naturally-occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g. hydroxyproline, ?-carboxyglutamate and 0-phosphoserine. Naturally-occurring ?-amino acids include, without limitation, alanine (Ala), cysteine (Cys), aspartic acid (Asp), glutamic acid (Gln), phenylalanine (Phe), glycine (Gly), histidine (His), isoleucine (Ile), arginine (Arg), lysine (Lys), leucine (Leu), methionine (Met), asparagine (Asn), proline (Pro), glutamine (Gin), serine (Ser), threonine (Thr), valine (Val), tryptophan (Trp), tyrosine (Tyr), and combinations thereof. Stereoisomers of a naturally-occurring ?-amino acids include, without limitation, D-alanine (D-Ala), D-cysteine (D-Cys), D-aspartic acid (D-Asp), D-glutamic acid (D-Glu), D-phenylalanine (D-Phe), D-histidine (D-His), D-isoleucine (D-Ile), D-arginine (D-Arg), D-lysine (D-Lys), D-leucine (D-Leu), D-methionine (D)-Met), D-asparagine (D-Asn), D-proline (D-Pro), D-glutamine (D-Gln), D-serine (D-Ser), D-threonine (D-Thr), D-valine (D-Val), D-tryptophan (D-Trp), D-tyrosine (D-Tyr), and combinations thereof.
[0060] Unnatural (non-naturally occurring) amino acids include, without limitation, amino acid analogs, amino acid mimetics, synthetic amino acids, N-substituted glycines, and N-methyl amino acids in either the L- or D-configuration that function in a manner similar to the naturally-occurring amino acids. For example, amino acid analogs can be unnatural amino acids that have the same basic chemical structure as naturally-occurring amino acids (i.e., a carbon that is bonded to a hydrogen, a carboxyl group, an amino group) but have modified side-chain groups or modified peptide backbones, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Amino acid mimetics refer to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally-occurring amino acid.
[0061] A hotspot amino acid residue refers to a residue characterized by energetically favorable interactions (including but not limited to hydrogen bonding, tight van der Waals packing, and complementary electrostatics) with a target region of a binding partner such as an TRPV1 ankyrin repeat domain.
[0062] The terms nucleic acid, nucleotide, and polynucleotide refer to deoxyribonucleic acids (DNA) or ribonucleic acids (RNA) and polymers. The term includes, but is not limited to, single-, double-, or multi-stranded DNA or RNA, genomic DNA, cDNA, and DNA-RNA hybrids, as well as other polymers comprising purine and/or pyrimidine bases or other natural, chemically modified, biochemically modified, non-natural, synthetic, or derivatized nucleotide bases. Unless specifically limited, the term encompasses nucleic acids containing known analogs of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), orthologs, and complementary sequences as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); and Rossolini et al, Mol. Cell. Probes 8:91-98 (1994)).
[0063] Percentage of sequence identity is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the sequence (e.g., a peptide of the invention) in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence which does not comprise additions or deletions, for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
[0064] Identical and identity, in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same. Sequences are substantially identical to each other if they have a specified percentage of nucleotides or amino acid residues that are the same (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. These definitions also refer to the complement of a nucleic acid test sequence.
[0065] Similarity and percent similarity, in the context of two or more polypeptide sequences, refer to two or more sequences or subsequences that have a specified percentage of amino acid residues that are either the same or similar as defined by a conservative amino acid substitutions (e.g., at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% similar over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. Sequences are substantially similar to each other if, for example, they are at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, or at least 55% similar to each other.
[0066] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters. Examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., (1990) J. Mol. Biol. 215: 403-410 and Altschul et al. (1977) Nucleic Acids Res. 25: 3389-3402, respectively. Software for performing BLAST analyses is publicly available at the National Center for Biotechnology Information website, ncbi.nlm.nih.gov. The algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al., supra). These initial neighborhood word hits acts as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a word size (W) of 28, an expectation (E) of 10, M=1, N=?2, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a word size (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see, e.g., Henikoff and Hetnikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)).
[0067] The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul, Proc. Nat'l. Acad. Sci. USA, 90: 5873-5787 (1993)). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.
[0068] As used herein the term physiological conditions refers to conditions that substantially replicate or otherwise approximate conditions inside an animal (e.g., a human). Exemplary physiological conditions include, but are not limited to, one or more parameters selected from 35-40? C., pH 7.35 to 7.45, osmolarity 250-350 mosM (e.g., 280-295 mosM), atmospheric pressure.
[0069] As used herein, the term cell penetration peptide refers to an amino acid sequence that, when linked to a second peptide (e.g., a TRPV1 modulator), causes or enhances the ability of the second peptide to cross the cell membrane of a cell when the cell is contacted by the cell penetration peptide linked to the second peptide.
[0070] As used herein, the term pain refers to the basic bodily sensation induced by a noxious stimulus, received by naked nerve endings, characterized by physical discomfort (e.g., pricking, throbbing, aching, etc.) and typically leading to an evasive action by the individual. As used herein, the term pain also includes chronic and acute neuropathic pain. Also included within the definition of pain include inflammatory pain (pain as the result of the inflammation, e.g., inflammatory hyperalgesia such as arthritis) and other pain (e.g., cancer pain, muscle pain, and headache).
[0071] As used herein, the terms pruritus and itch refer to an unpleasant sensation that evokes the desire or reflex to scratch. Itches are a common problem and can be localized (limited to one area of the body) or generalized (occurring all over the body or in several different areas). The medical term for itching is pruritus. Generalized itch, for obvious reasons, is more difficult to treat than localized itch. Itches can also occur with or without skin lesions (for example, bumps, blisters, or psoriasis).
[0072] As used herein, the term cancer refers to a neoplasm or tumor resulting from abnormal uncontrolled growth of cells. The term cancer encompasses disease states involving pre-malignant and/or malignant cancer cells. The cancer may be a localized overgrowth of cells that has not spread to other parts of a subject (e.g., a benign tumor), or the cancer may be have reached varying stages of invasion/destruction of neighboring body structures and spreading to distant sites (e.g., a malignant tumor).
[0073] As used herein, the terms treat, treatment, and treating refer to any indicia of success in the treatment or amelioration of an injury, pathology, condition, or symptom (e.g., lung cancer), including any objective or subjective parameter such as abatement; remission; diminishing of symptoms or making the symptom, injury, pathology or condition more tolerable to the patient; reduction in the rate of symptom progression; decreasing the frequency or duration of the symptom or condition; or, in some situations, preventing the onset of the symptom. The treatment or amelioration of symptoms can be based on any objective or subjective parameter, including, e.g., the result of a physical examination.
[0074] As used herein, the terms effective amount and therapeutically effective amount refer to a dose of a compound such as a cyclic dinucleotide that produces therapeutic effects for which it is administered. The exact dose will depend on the purpose of the treatment, and will be ascertainable by one skilled in the art using known techniques (see, e.g., Lieberman, Pharmaceutical Dosage Forms (vols. 1-3, 1992); Lloyd, The Art, Science and Technology of Pharmaceutical Compounding (1999); Pickar, Dosage Calculations (1999); Goodman & Gillman's The Pharmacological Basis of Therapeutics, 11.sup.th Edition, 2006, Brunton, Ed., McGraw-Hill; and Remington: the Science and Practice of Pharmacy, 21.sup.st Edition, 2005, Hendrickson, Ed., Lippincott, Williams & Wilkins).
[0075] As used herein, the term subject refers to animals such as mammals, including, but not limited to, primates (e.g., humans), cows, sheep, goats, horses, dogs, cats, rabbits, rats, mice and the like.
[0076] As used herein, the term pharmaceutically acceptable excipient refers to a substance that aids the administration of an active agent to a subject. By pharmaceutically acceptable, it is meant that the excipient is compatible with the other ingredients of the formulation and is not deleterious to the recipient thereof. Pharmaceutical excipients useful in the compositions include, but are not limited to, binders, fillers, disintegrants, lubricants, glidants, coatings, sweeteners, flavors and colors.
[0077] As used herein, the terms about and around indicate a close range around a numerical value when used to modify that specific value. If X were the value, for example, about X or around K would indicate a value from 0.9X to 1.1X, e.g., a value from 0.95X to 1.05X, or a value from 0.98X to 1.02X, or a value from 0.99X to 1.01X. Any reference to about X or around K specifically indicates at least the values X, 0.9X, 0.91X, 0.92X, 0.93X, 0.94X, 0.95X, 0.96X, 0.97X, 0.98X, 0.99X, 1.01X, 1.02X, 1.03X, 1.04X, 1.05X, 1.06X, 1.07X, 1.08X, 1.09X, and 1.1X, and values within this range.
II. Peptidic Allosteric Modulators of TRPV1
[0078] The present invention was developed, in part, with the hypothesis that instead of using agonists or antagonists to modulate TRPV1 activity universally, positive allosteric modulators (PAMs) that selectively modulate high-activity population of TRPV1 is a promising alternative. TRPV1 channel is a calcium permeable channel highly expressed in nociceptive nerve termini (2). Previous studies have established that positive allosteric modulation of TRPV1 activities leads to local calcium overload in nociceptive afferent nerve terminus, causing functional and reversible inactivation of the nerve terminus to exert analgesic effects. For instance, the small molecule PAM of TRPV1 MRS1477, which was discovered in structure-activity relationship studies (10), enhances TRPV1 activation in the presence of orthosteric agonists such as capsaicin and exerts analgesic effects (11, 12).
[0079] To develop effective PAMs of TRPV1, instead of performing resource-consuming screening campaigns, we used a peptidic PAM design approach. Our method took advantage of the rich information from structural and functional investigations in TRPV1 (13-15) and rapidly evolving computational protein design using Rosetta (16, 17). Specifically, we chose the hotspot centric Rosetta computational approach which has been employed for the rational design of protein binders to specific domains of targets where three-dimensional structures have been resolved (18). Using this approach, previous studies reported successful de novo design of proteins bound to the stem region of hemaglutinin and the Fe domain of IgG (17, 19). Previous electrophysiological studies have shown that the ankyrin repeat-like domain (ARID) is critically involved in ligand induced desensitization of TRPV1 channel (13, 20, 21). We first established an improved protein design strategy to increase the success rate of obtaining robust designed binders. We then applied the improved Rosetta protein design approach to precisely target the ARD of TRPV1 to achieve positive allosteric modulation. Moreover, both the crystal structure of the ARD) and the cryo-EM structures of TRPV1 have been determined (13-15, 22). With a combination of our design method, FRET imaging, protein chemistry, surface plasma resonance, patch-clamp recordings and animal behavioral tests, we observed that two out of three of our designed PAMs bind to the ARD of TRPV1 with about 30 nano-molar affinity to positively modulate this channel in cells. Furthermore, we demonstrated that in rats our PAM exerts longer lasting analgesics effects as compared to MRS1477 without inducing hyperthemia.
[0080] Accordingly, some embodiments of the present disclosure provide A TRPV1 allosteric modulator comprising a peptide containing two hotspot amino acid residues, [0081] wherein the hotspot amino acid residues are aromatic amino acid residues that interact with a TRPV1 ankyrin repeat domain (ARD), and [0082] wherein alpha carbon atoms in the two hotspot amino acid residues are within 5-10 ? of each other upon folding of the peptide (e.g., under physiological conditions).
[0083] In some embodiments, the TRPV1 allosteric modulators prepared by process comprising: [0084] i) assessing shape complementarity, binding energy, and solvent accessible surface area of a candidate peptide upon docking to a surface of a TRPV1 ankyrin repeat domain (ARD) in silico; [0085] ii) assessing ab initio refolding of the candidate peptide; [0086] iii) evolving the candidate peptide via in silico affinity maturation to define a mature allosteric modulator; [0087] iv) expressing or synthesizing the mature allosteric modulator, thereby preparing the TRPV1 allosteric modulator.
[0088] In some embodiments, the process further comprises: [0089] i-a) docking a surface of a peptide scaffold to a surface of the ARD to define a surface interface; [0090] wherein the peptide scaffold comprises one or more ARD-binding hotspot amino acid residues and a plurality of non-hotspot amino acid residues; [0091] i-b) fixing the hotspot amino acid residues to a target location on the surface of the TRPV1 ARD; [0092] i-c) substituting at least one non-hotspot residue with another amino acid residue to define the candidate peptide.
[0093] In some embodiments, the target location on the surface of the TRPV1 ARD is located between two fingers of the ARD. For example, the target location on the surface of the TRPV1 ARD is located on the concave surface formed by the 2nd and 3rd fingers of the ARD. In some embodiments, the target location is located within the pocket formed by residues Y195, L206, I208, E211, F236, F246, and F248. For reference, the sequence of ARD domain (residues 112-359 of TRPV1) is set forth in SEQ TD NO:40.
[0094] Scaffold sequences can be designed and assessed for positioning of hotspot residues so as to promote or prevent particular interactions (e.g., binding events) with the target locations. For example, two phenylalanine hotspot residues may be positioned in an allosteric modulator such that the two alpha carbon atoms are within 5-10 ? of each other (e.g., about 7.98 ? in the case of De1 described below, or 6.27 ? in the case of De3 described below) as assessed in silico.
[0095] In some embodiments, the peptide scaffold is characterized by one or more properties selected from the group consisting of: [0096] an X-ray crystal structure determined at a resolution of at least 2.5 ?; [0097] an absence of DNA, RNA, or disulfide bonds in the X-ray crystal structure; [0098] an absence of ligands or cofactors in the X-ray crystal structure; [0099] no more than 200 amino acid residues in the primary amino acid sequence (e.g., no more than 150 amino acids, no more than 100 amino acids, or no more than 75 amino acids); [0100] no more than one polypeptide chain; [0101] monomeric stoichiometry; and [0102] previous expression in E. coli reported.
[0103] Examples of peptide scaffolds include, but are not limited to, those listed in Table 1 below.
TABLE-US-00001 TABLE1 PDBID Wild-typeProtein Sequence SEQIDNO: 1QZM AlphadomainofLonprotease SGYTEDEKLNIAKRHLLPKQIERN 1 ALKKGELTVDDSALIGURYYTRE AGVRGLEREISKLCRKAVKQLLL DKSLKHIEINGDNLHDYLGVQRF 3ONJ HabcdomainofSNAREs SLLISYESDFKTTLEQAKASLAEA 2 PSQPLSQRNTTLKHVEQQQDELF DLLDQMDVEVNNSIGDASERATY KAKLREWKKTIQSDIKRPLQSLV DSGD 1XWC ReducedThioredoxin MVYQVKDKADLDGQLTKASGKL 3 VVLDFFATWCGPCKMISPKLVEL STQFADNVVVLKVDVDECEDIA MEYNISSMPTFVFLKNGVKVEEF AGANAKRLEDVIKANI 2YXY HypotheticalDUF1811-family GHMIKGEQKRYSEMTKEELQQEI 4 protein AMLTEKARKAEQMGMVNEYAV YERKIAMAKAYMLNPADFHPGEI YEIEGAPGEYFKVRYLKGVFAWG WRLKGNGEEEALPISLLRKPNLPQS 1GYV gama-AdaptinAppendage MIPSITAYSKNGLKIEFTFERSNTN 5 Domain PSVTVITIQASNSTELDMTDFVFQ AAVPKTFQLQELSPSSSVVPAFNT GTITQVIKVLNPQKQQLRMRIKLT YNHKGSAMQDLAEVNNFPPQSWQ 3NGP Redesignedalpha-spectrinSH- MDETGKELVLVLYDYQEKSPREL 6 3domain TVKKGDILTLLNSTNKDWWKIEV NGRQGFVPAAYLKKLD 2HDZ UpstreambindingfactorHMG MGKLPESPKRAEEIWQQSVIGDY 7 box5 LARFKNDRVKALKAMEMTWNN MEKKEKLMWIKKAAEDQKRYER ELSEMRAPPAATNSSKKLE
[0104] In some embodiments: [0105] the peptide scaffold and/or the TRPV1 allosteric modulator comprises a helix.sup.1-loop-strand.sup.1-helix.sup.2-turn-helix.sup.3-strand.sup.2-helix.sup.4 architecture, [0106] strand.sup.1 and strand.sup.2 and folded in a parallel ? sheet, and [0107] the hotspot amino acid residues are phenylalanine residues located in helix.sup.2 and helix.sup.4. The hotspot residues may be located, for example, at position 36 and position 83 of SEQ ID NO:8.
[0108] In some embodiments, the TRPV1 allosteric modulator includes a polypeptide sequence having at least 70% identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity) to positions 36-83 of SEQ ID NO:8, or 36-85 of SEQ ID NO:8, or positions 36-87 of SEQ ID NO 8, or 35-89 of SEQ ID NO:8, provided that the amino acid residues at position 36 and position 83 are aromatic amino acid residues.
[0109] In some embodiments, the TRPV1 allosteric modulator includes a polypeptide sequence having at least 70% identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity) to positions 35-89 SEQ ID NO:8 provided that the amino acid residues at position 36 and position 83 are aromatic amino acid residues (e.g., phenylalanine residues).
[0110] In some embodiments, the TRPV1 allosteric modulator includes a polypeptide sequence having at least 70% identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity) to SEQ ID NO:8. In some embodiments, the TRPV1 allosteric modulator includes a polypeptide sequence having at least 70% identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity) to SEQ ID NO:8 provided that the amino acid residues at position 36 and position 83 are phenylalanine residues.
[0111] In some embodiments: [0112] the peptide scaffold and/or the TRPV1 allosteric modulator comprises a helix.sup.1-loop-helix.sup.2-loop-helix.sup.3 architecture, [0113] helix.sup.1, helix.sup.2, and helix.sup.3 are folded in a three-helix bundle, and [0114] the hotspot amino acid residues are phenylalanine residues located in helix.sup.3. The hotspot residues may be located, for example, at position 72 and position 76 of SEQ ID NO:9.
[0115] In some embodiments, the TRPV1 allosteric modulator includes a polypeptide sequence having at least 70% identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity) to positions 70-78 of SEQ ID NO:9, or positions 68-80 of SEQ ID NO:9, or positions 66-82 of SEQ ID NO:9, or positions 64-84 of SEQ ID NO:9, or positions 64-86 of SEQ ID NO:9, or positions 64-90 of SEQ ID NO:9, positions 64-94 of SEQ ID NO-9, provided that the amino acid residues at position 72 and position 76 are aromatic amino acid residues (e.g., phenylalanine residues).
[0116] In some embodiments, the TRPV1 allosteric modulator includes a polypeptide sequence having at least 70% identity (e.g., at least 70%, 75%, 80%, 85%, 90%. 95%, or 99% identity) to positions 64-94 of SEQ ID NO:9. In some embodiments, the TRPV1 allosteric modulator includes a polypeptide sequence having at least 70% identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity) to positions 64-94 of SEQ ID NO:9 provided that the amino acid residues at position 72 and position 76 are aromatic amino acid residues (e.g., phenylalanine residues).
[0117] In some embodiments, the TRPV1 allosteric modulator includes a polypeptide sequence having at least 70% identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity) to SEQ ID NO:9. In some embodiments, the TRPV1 allosteric modulator includes a polypeptide sequence having at least 70% identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity) to SEQ ID NO:9 provided that the amino acid residues at position 72 and position 76 are phenylalanine residues.
[0118] Examples of designed peptides using, the scaffolds described herein include, but are not limited to, those set forth in fable 2.
TABLE-US-00002 TABLE 2 Muta- tions from Design No. wild- candidate Scaf- of type Shape (SEQ ID fold Wild-type Resi- Scaffold Total comple- NO) PDB function dues sequence score Ddg SASA mentarity 15237 1QZM Alpha 93 23 ?497.304 ?27.703 1929.842 0.6743 (SEQ domain of ID NO: Lon 10) protease 15237_ 3ONJ Habc 96 27 ?531.014 ?31.511 2757.631 0.5324 2nd_0086 domain of (SEQ SNAREs ID NO: 11) 5132 3ONJ Habc 96 20 ?480.546 ?24.915 2450.968 (SEQ ID domain of NO: 12) SNAREs 11577 1XWC Reduced 105 32 ?494.240 ?31.551 2512.314 0.6044 SEQ ID Thiore- NO: 13) doxin 2824 2YXY Hypo- 103 31 ?560.978 ?30.506 3086.675 0.6102 (SEQ ID thetical NO: 14) 926 1GYV gama- 119 32 ?560.790 ?26.620 2352.198 0.6016 (SEQ ID Adaptin NO: 15) Appendage Domain 15080 3NGP Redesigned 56 23 ?397.464 ?27.201 1772.034 0.6287 SEQ ID SH-3 NO: 16) domain 15080_cst 3NGP 56 21 ?402.347 ?22.370 1909.638 SEQ ID NO: 17) 8320_ 2HDZ upstream 65 12 ?444.04 ?15.870 1527.721 2nd_0141 binding (SEQ ID factor NO: 18) HMG box 5
[0119] In some embodiments, the TRPV1 allosteric modulator may contain one or more amino acid substitutions, deletions, or additions with respect to a given sequence (e.g., a scaffold sequence used as a starting point for modulator development, or an intermediate sequence obtained during computation design as described herein). Certain substitutions will be recognized as conservative modification where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Chemically similar amino acids may include, without limitation, genetically-encoded amino acids such as an L-amino acids, stereoisomers of genetically-encoded amino acids such as a D-amino acids, N-substituted amino acids (e.g., n-methylglycine), amino acid analogs, amino acid mimetics, and synthetic amino acids. Conservative substitution tables providing functionally similar amino acids are well known in the art. For example, substitutions may be made wherein an aliphatic amino acid (e.g., G, A, I, L, or V) is substituted with another member of the group. Similarly, an aliphatic polar-uncharged group such as C, S, T, M, N. or Q, may be substituted with another member of the group; and basic residues, e.g., K, R, or H, may be substituted for one another. In some embodiments, an amino acid with an acidic side chain, e.g., E or D, may be substituted with its uncharged counterpart, e.g., Q or N, respectively; or vice versa. Each of the following eight groups contains other exemplary amino acids that are conservative substitutions for one another (see, e.g., Creighton, Proteins, 1993): [0120] 1) Alanine (A), Glycine (G); [0121] 2) Aspartic acid (D), Glutamic acid (E); [0122] 3) Asparagine (N), Glutamine (Q); [0123] 4) Arginine (R), Lysine (K); [0124] 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); [0125] 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); [0126] 7) Serine (S), Threonine (T); and [0127] 8) Cysteine (C), Methionine (M)
[0128] ARD target peptides and modulator scaffold peptides, with or without amino acid mutations, may be assessed using on or modeling steps as described herein. ARD target peptides may be relaxed, for example, by executing a script such as Script 1 as set forth below.
TABLE-US-00003 Script 1 #!/bin/bash #$ -S /bin/bash #$ -e /home/fanyang/work/constrained_relax_2PNN-2PNN-_/$TASK_ID/ #$ -o /home/fanyang/work/constrained_relax_2PNN-2PNN-_/$TASK_ID/ /home/fanyang/rosetta_source/bin/relax. 1inuxgccrelease \ -in:path:database /home/fanyang/rosetta_database \ -in:file:s /home/fanyang/projects/input_files/2PNN/2PNN_cleaned_fy. pdb \ -ignore_unrecognized_res \ -relax:fast \ -relax:constrain_relax_to_start_coords \ -relax:coord_constrain_sidechains \ -relax:ramp_constraints false \ -ex1 \ -ex2 \ -use_input_sc \ -correct \ -nstruct 100 \ -out:prefix constrained-relax- \ -out:file:silent /home/fanyang/work/constrained_relax_2PNN-2PNN- _/${SGE_TASK_ID} /constrained-relax-_2PNN_${SGE_TASK_ID}.silent \ -out:file:silent_struct_type binary \ -mute all
[0129] Inverse rotamer libraries of candidate hotspot residues may be constructed by executing a script such as Script 2 as shown below.
TABLE-US-00004 Script 2 -database /home/fan/rosetta_source/rosetta_database -ignore_unrecognized_res -in:file:fullatom -ex1 -ex2 -in:file:s /media/Data2/Academic/Rosetta/Project_Ank/HS_Candidates/PheHS2_PheHS1_0510/Rosetta Dock_Phe_ini_Phe_HS1_2PNN_CCR_0077_3730. pdb -parser:protocol /media/Data2/Academic/Rosetta/Rosetta_script/xml_scripts_Fan/InverseRotamers_fy. xm l -nstruct 1000 -overwrite InverseRotamers_fy. xml : <dock_design> <SCOREFXNS> <stub_dock weights=talaris2014 /> </SCOREFXNS> <FILTERS> <EnergyPerResidue name=energy scorefxn=stub_dock pdb_num=1B energy_cutoff=1/> <Ddg name=ddg scorefxn=stub_dock threshold =?1 repack=0/> </FILTERS> <MOVERS> <TryRotamers name=try pdb_num=1B /> list residues the backbones of which are to be ignored in energy evaluations under the shove flag RepackMinimize name=rpk repack_partner1=1 repack_partner2=0 design_partner1=0 design_partner2=0 minimize bb=0 minimize_rb=0 minimize sc=1 </MOVERS> <APPLY_TO_POSE> </APPLY_TO_POSE> <PROTOCOLS> <Add mover_name=try/> add mover_name=rpk <Add filter_name=energy/> <Add filter_name=ddg/> </PROTOCOLS> </dock_design>
[0130] Scaffold candidate structures may be cleaned by executing a script such as Script 3 as shown below.
TABLE-US-00005 Script 3 #!/bin/bash FOLDER_A=/media/Data_Ubuntu/PatchDock/scaffold_0402 FOLDER_B=/media/Data_Ubuntu/PatchDock/scaffold_cleaned_0402 for file_a in ${FOLDER_A}/*; do file_a_prefix=${file_a%. *} file_prefix=${file_a_prefix#${FOLDER_A} /*} echo $file_prefix sudo cleanPdb. p1 -pdbfile ${FOLDER_A} /$file_prefix. pdb > $ {FOLDER_B}/$file_prefix. pdb done
[0131] Cleaned scaffold candidate structures may be pre-packed by executing a script such as Script 4 as shown below.
TABLE-US-00006 Script 4 #!/bin/bash FOLDER_A=/media/Data_Ubuntu/PatchDock/scaffold_0405_cleaned for file_a in ${FOLDER_A}/*; do file_a_prefix=${file_a%.*} file_prefix=${file_a_prefix#${FOLDER_A}/*) echo $file_prefix /home/fan/rosetta_source/bin/rosetta_scripts. 1inuxgccrelease -ex1 -ex2aro - database /home/fan/rosetta_source/rosetta_database -ignore_unrecognized_res - in:file:fullatom -in:file:s /home/fan/PatchDock/PDB/scaffold_PDB_1/$file_prefix. pdb -parser:protocol /home/fan/rosetta_source/input_files/prepack_2PNN/ppk. xml -overwrite -out:output sudo my $file_prefix*. pdb $file_prefix. pdb sudo cp $file_prefix.pdb /media/Data_Ubuntu/PatchDock/scaffold_0405_cleaned_prepacked/ rm -r $file_prefix. pdb done
[0132] Scaffold proteins may be fused with hotspots by executing a script such as Script 5 as shown below.
TABLE-US-00007 Script 5 #!/bin/bash #$ -S /bin/bash #$ -e /home/fanyang/work/Placestub_PheHS2_PheHS1_2PNN_0511-2PNN-_/$TASK_ID/ #$ -o /home/fanyang/work/Placestub_PheHS2_PheHS1_2PNN_0511-2PNN-_/$TASK_ID/ n=(${SGE_TASK_ID}-1)*100+1 for ((i=1; i<101; i=i+1)) do /home/fanyang/rosetta_source/bin/rosetta_scripts. static. 1inuxgccrelease \ -in:path:database /home/fanyang/rosetta_database \ -in:file:fullatom \ -ex1 \ -ex2 \ -in:file:s /home/fanyang/projects/input_files/2PNN/Docked_0510/$[${i} +${n}]. pdb \ -out:file:scorefile mscore_$[${i} +${n}].fsc \ -nstruct 50 \ -out:file:silent /home/fanyang/work/Placestub_PheHS2_PheHS1_2PNN_0511-2PNN- _/${SGE_TASK_ID}/twoHS_placestubs_2PNN_${SGE_TASK_ID} . silent \ -out:file:silent_struct_type binary \ -mute all \ -parser:protocol /home/fanyang/projects/input_files/2PNN/TwoResidueHotspot_fy_0511. xml done TwoResidueHotspot_fy_0511. xml: <ROSETTASCRIPTS> <TASKOPERATIONS> <PreventRepacking name=prevent_repacking_Y84 resnum=84/> <PreventRepacking name=prevent_repacking_Y89 resnum=89/> </TASKOPERATIONS> <SCOREFXNS> <stub_docking_low weights=interchain_cen hs_hash=10. 0/> <ddg_scorefxn weights=standard patch=score12 hs_hash=0. 0/> <score12_coordest weights=standard patch=score12 hs_hash=0. 0> <Reweight scoretype=coordinate_constraint weight=1. 0/> </score12_coordest> </SCOREFXNS> <FILTERS> <Ddg name=ddg threshold=-10 scorefxn=ddg_scorefxn repeats=3/> <Sasa name=sasa threshold=1200/> <CompoundStatement name=ddg_sasa> for the loop over filter <AND filter_name=ddg/> <AND filter_name=sasa/> </CompoundStatement> <TerminusDistance name=termini distance=3/> <AtomicContact name=touch_125 residue1=125A distance=5/> <AtomicContact name=touch 89 residue1=89A distance=5/> <AtomicContact name=touch 84 residue1=84A distance=5/> <AtomicContact name=touch_53 residue1=53A distance=5/> <AtomicContact name=touch_97 residue1=97A distance=5/> <CompoundStatement name=touch_Trp> <AND filter_name=touch_125/> <AND filter_name=touch_89/> <AND filter_name=touch_97/> </CompoundStatement> <CompoundStatement name=touch_Leu> <AND filter_name=touch_84/> <AND filter_name=touch_53/> </CompoundStatement> </FILTERS) <MOVERS> <Docking name=dock fullatom=0 local_refine=0 score_low=stub_docking_low/> <RepackMinimize name=des1 minimize_bb=0 minimize_rb=1 scorefxn_repack=soft_rep scorefxn_minimize=score_docking interface_cutoff_distance=10. 0/> <RepackMinimize name=des2 minimize_bb=0 minimize_rb=1 interface_cutoff_distance=10. 0/> <RepackMinimize name=des3 minimize_bb=1 minimize_rb=1 interface_cutoff_distance=10. 0/> <SaveAndRetrieveSidechains name=srsc/> <BackrubDD name=br partner1=0 partner2=1 interface_distance_cutoff=10. 0/> <PlaceStub name=place top minimize_rb=1 triage_positions=1 stubfile= /home/fanyang/projects/input_files/2PNN/HS_lib/PheHS2_IR. pdb stub_energy_threshold=10 final_filter=ddg_sasa hurry=1 max_cb dist=4.0 task_operations=prevent_repacking_Y84> <StubMinimize> <Add mover_name=br/> </StubMinimize> <DesignMovers> <Add mover_name=srsc/> <Add mover_name=des1 coord_est_std=1. 0/> <Add mover_name=des2 coord_est_std=1. 5/> <Add mover_name=br/> <Add mover_name=des3/> </DesignMovers> </PlaceStub> <PlaceStub name=place_trp place_scaffold=1 triage_positions=0 stubfile= /home/fanyang/projects/input_files/2PNN/HS_lib/PheHS1_IR. pdb task_operations=prevent_repacking_Y89 add_constraints=1 minimize_rb=1 hurry=1 score_threshold=10. 0 stub_energy_threshold=3. 0 max_cb_dist=4. 0 leave_coord_csts=1 task_operations=prevent_repacking_Y84> PlaceStub's task operations will be fed down to all movers that are mentioned as task aware. leave_coord_ests lets downstream movers use the coordinate ests that placestub found to be useful <StubMinimize> <Add mover_name=br/> </StubMinimize> <DesignMovers> <Add mover_name=place_top coord_cst_std=1. 0/> </DesignMovers> </PlaceStub> </MOVERS> <APPLY_TO_POSE> <SetupHotspotConstraints stubfile= /home/fanyang/projects/input_files/2PNN/HS_lib/PheHS2_PheHS1_IR. pdb cb_force=0. 5/> </APPLY_TO_POSE> <PROTOCOLS> <Add mover_name=dock filter_name=termini/> <Add mover_name=place_trp/> <Add filter_name=ddg/> <Add filter_name=sasa/> </PROTOCOLS> </ROSETTASCRIPTS>
[0133] In silico affinity maturation nay be conducted by executing a script such as Script 6 as shown below.
TABLE-US-00008 Script 6 -database /home/fan/rosetta_source/rosetta_database -ignore_unrecognized_res -in:file:fullatom -ex1 -ex2 -in:file:s /media/Data2/Academic/Rosetta/candidate. pdb -parser:protocol /media/Data2/Academic/Rosetta/Rosetta_script/xml_scripts_Fan/MulticriterionOptimiz ation. xml -nstruct 100 -overwrite MulticriterionOptimization. xml: <dock_design> <TASKOPERATIONS> <InitializeFromCommandline name=init/> <ProteinInterfaceDesign name=pido/> <RestrictResiduesToRepacking name=restrict_all/> <RestrictAbsentCanonicalAAS name=nohis keep_aas= ACDEFGIKLMNPQRSTVWY /> </TASKOPERATIONS> <SCOREFXNS> </SCOREFXNS> <FILTERS> <Sasa name=hydrophobic_sasa hydrophobic=1 confidence=0/> <Sasa name=sasa confidence=0/> <Ddg name=ddg confidence=0 repeats=3/> <ScoreType name=total_score score_type=total_score threshold=0/> </FILTERS> <MOVERS> <AtomTree name=docking_tree docking_ft=1/> <RandomMutation name=random_mutation task_operations=init, pido, restrict_all, nohis/> <MinMover name=min bb=1 chi=1 jump=1> <MoveMap> <Chain number=1 chi=1 bb=0/> </MoveMap> </MinMover> <ParsedProtocol name=agg_mover> <Add mover=random_mutation/> <Add mover=min/> </ParsedProtocol> <GenericMonteCarlo name=genericMC mover_name=agg_mover filter_name=ddg temperature=0. 1 trials=1000> <Filters> <AND filter_name=total score temperature=1/> </Filters> </GenericMonteCarlo> </MOVERS> <APPLY_TO_POSE> </APPLY_TO_POSE> <PROTOCOLS> <Add mover=docking_tree/> <Add mover=genericMC/> <Add filter=ddg/> <Add filter=sasa/> </PROTOCOLS> </dock_design>
[0134] Any design candidate can be assessed for the ability to bind TRPV1 using techniques including, but not limited to, the FRET protocols and SPR protocols described herein. For example, complementary fluorescent proteins (including, but not limited to, GFP CFP, YFP, and the like) may be fused recombinantly to a designed peptide and to TRPV1 for assessment of TRPV1 binding via FRET. In some non-limiting embodiments, binding of a candidate modulator to TRPV1 can be confirmed by observing a FRET ratio max of at least 1.25 when YFP is fused to the C-terminus of TRPV1, CFP is fused to the C-termini of a candidate peptide. In some embodiments, binding of a candidate modulator to TRPV1 can be confirmed by observing a FRET efficiency greater than about 4% (e.g., at least 5%, or at least 7%) when YFP is fused to the C-terminus of TRPV1, CFP is fused to the C-termini of a candidate peptide. FRET measurements can be made by co-expressing the FRET-labeled constructs in host cells, exciting the CFP construct in the host cells at 458 inn, and observing YFP emission at 530 nm. CFP emission can be separated from YFP emission by fitting of standard spectra acquired from cells expressing YFP or CFP only.
[0135] FRET efficiency is defined in its usual definition; it is inversely related to the sixth power of the distance between complementary fluorescent proteins on the binding partners. FRET efficiency is quantified from measurements of the fluorescence emission spectra, using the established method. Judgement of positive FRET signals can be made by comparing them to that obtained from a mixture of complementary fluorescent proteins not expected to exhibit specific association (i.e., a negative control); signals significantly higher than that of a negative control indicate specific binding of a design candidate to TRPV1.
[0136] FRET ratios can be calculated from the increase in YFP emission due to energy transfer as described previously (Qiu, et al. J. Biol. Chem. 2005, 280, 24923, incorporated herein by reference in its entirety). CFP emission can be separated from YFP emission by fitting of standard spectra acquired from cells expressing only YFP or CFP. The fraction of YFP-tagged molecules that are associated with CFP-tagged molecules, Ab, is calculated as Ab=1/(1+K.sub.D/[Dfree]), where K.sub.D is the dissociation constant and [Dfree] is the concentration of free donor molecules. The FRET Ratio=1+Ab*(FRET Ratio.sub.max?1). Regression analysis can be used to estimate Ab in individual cells. From each cell, the FRET ratio.sub.exp is experimentally determined. The predicted Ab value is then computed by adjusting two parameters, FRET Ratio.sub.max, and apparent K.sub.D Ab was in turn used to give a predicted FRET ratio.sub.predicted. By minimizing the squared errors (FRET ratio.sub.exp. FRET ratio.sub.predicted).sup.2, K.sub.D was determined.
[0137] Apparent FRET efficiency can be calculated from the enhancement of YFP acceptor fluorescence emission due to energy transfer from the CFP donor using previously described methods. [see, e.g., Yang and Zheng, et al. Proc. Natl. Acad. Sci. U.S.A. 2010, 107 7083, which is incorporated herein by reference]. RatioA.sub.0, and RatioA.sub.1, are measured to calculate FRET efficiency. RatioA.sub.0, represents the ratio between acceptor emission intensities (in the absence of the donor) upon excitation at the donor and acceptor excitation wavelengths, and can be calculated at the YFP peak emission wavelength. A particular advantage of quantifying RatioA.sub.0 for FRET measurement is that changes in fluorescence intensity caused by many experimental factors cap be cancelled out by the ratiometric measurement:
in which F.sub.d and F.sub.a denote fluorescence intensities measured upon excitation at the donor and acceptor excitation wavelength, respectively, F.sub.d.sup.direct represents direct excitation of YFP by excitation at the donor excitation wavelength. A similar ratio, termed RatioA, is determined in the presence of CFP in the same way as RatioA.sub.0
in which F.sub.d.sup.FRET represents the fluorescence signal due to FRET.
[0138] If FRET occurs, the RatioA value should be higher than RatioA.sub.0; the difference between RatioA and RatioA.sub.0, is directly proportional to the FRET efficiency by the factor of extinction coefficient ratio of CFP and YFP. The effective FRET efficiency (E) can be calculated as:
[0139] In some embodiments, the TRPV1 allosteric modulator further comprises a cell penetration peptide sequence. The cell penetration peptide sequence may be linked, for example, to the N-terminus of the TRPV1 allosteric modulator or the C-terminus of the TRPV1 allosteric modulator). In some embodiments, the C-terminus of the cell penetration peptide is linked to the N-terminus of the TRPV1 allosteric modulator. A number of cell penetration peptides can be linked to the TRPV1 allosteric modulator so as to enhance delivery of the TRPV1 allosteric modulator to target cells in vitro and/or in vivo (see, e.g., Guidotti, et al. Trends in Pharmacological Sciences. 2017, 38(4): 406-424). In some embodiments, the cell penetration peptide is a cationic peptide having 5-25 total amino acid residues and at least 5 arginine residues, lysine residues, or a combination thereof. In some embodiments, the cell penetration peptide is a polyarginine ranging in length from 5 residues to 25 residues. In some embodiments, the cell penetration peptide comprises an amino acid sequence set forth in Table 3 or a sequence having at least 70% identity (e.g., at least 70%, 75%, 80%, 85%, 90% 95% or 99% identity) thereto.
TABLE-US-00009 TABLE3 ExemplaryCellPenetrationPeptides SEQ ID NO: Sequence Origin 19 RKKRRQRRR HIV-1Tatprotein 20 YGRKKRRQRRRA HIV-1Tatprotein 21 GRKKRRQRRRPPQ HIV-1Tatprotein 22 RQIKIWFQNRRMKWKK Antennapedia Drosophila melanogaster 23 VKRGLKLRHVRPRVTRMDV Chemically synthesized 24 GALFLGFLGAAGSTMGAWSQPKKKRKV HIVglycoprotein 41/SV40Tantigen NLS 25 KETWWETWWTEWSQPKKKRKV Tryptophan-rich cluster/SV40T antigenNLS 26 LLIILRRRIRKQAHAHSK Vascular endothelial cadherin 27 MVRRFLVTLRIRRACGPPRVRV p14ARFprotein 28 MVKSKIGSWILVLFVAMWSDVGLCKKRP Nterminusof unprocessedbovine prionprotein 29 KLALKLALKALKAALKLA Chemically synthesized 30 GWTLNSAGYLLGKINLKALAALAKKIL Chimericgalanin- mastoparan 31 LSTAADMQGVVTDGMASGLDKDYLKPDD Azurin 32 DPKGDPKGVTVTVTVTVTGKGDPKPD Synthetic 33 RRIRPRPPRLPRPRPRPLPFPRPG Bactenecinfamily ofantimicrobial peptides 34 CSIPPEVKFNKPFVYLI ?1-Antitrypsin 35 PFVYLI Derivedfrom syntheticC105Y 36 SDLWEMMMVSLACQY CHL8peptide phageclone
[0140] In some embodiments, the cell penetration peptide is an HIV-1 Tat peptide (e.g., a peptide according to SEQ ID NO: 19, 20, or 21). In some embodiments, the HIV-1 Tat peptide comprises an amino acid sequence having at least 70% identity to SEQ ID NO:19. In some embodiments, the HIV-1 Tat peptide comprises an amino acid sequence having at least 80% identity to SEQ ID NO: 19. In some embodiments, the HIV-1 Tat peptide comprises an amino acid sequence having at least 90% identity to SEQ ID NO:19. In some embodiments, the peptide construct comprises a cell penetration peptide having the amino acid sequence according to SEQ ID NO:19 and a TRPV1 allosteric modulator comprising an amino acid sequence having at least 70% identity (e.g., at least 80% identity, or at least 90% identity) to SEQ ID NO:8 or SEQ ID NO:9.
[0141] A cell penetration peptide may also be chemically modified, such as prenylated near the C-terminus of the cell penetration peptide. Prenylation is a post-translation modification resulting in the addition of a 15 (farnesyl) or 20 (geranylgeranyl) carbon isoprenoid chain on the peptide. A chemically modified cell penetration peptide can be even shorter and still possess the cell penetrating property.
[0142] Accordingly, a cell penetration peptide, pursuant to another aspect of the disclosure, is a chemically modified CPP with 2 to 35 amino acids, preferably 5 to 25 amino acids, more preferably 10 to 25 amino acids, or even more preferably 15 to 25 amino acids.
[0143] Cell penetration peptides can be linked to a protein recombinantly, covalently or non-covalently. A recombinant protein having a cell penetration peptide can be prepared in bacteria, such as E. coli, a mammalian cell such as a human HEK293 cell, or any cell suitable for protein expression. Covalent and non-covalent methods have also been developed to form CPP/protein complexes. A cell penetration peptide, Pep-1, has been shown to form a protein complex and proven effective for delivery (Kameyama et al. (2006) Bioconjugate Chem. 17:597-602).
[0144] Cell penetration peptides also include cationic conjugates which also may be used to facilitate delivery of the proteins into the cells or tissue of interest. Cationic conjugates may include a plurality of residues including amines, guanidines, amidines, N-containing heterocycles, or combinations thereof. In related embodiments, the cationic conjugate may comprise a plurality of reactive units selected from the group consisting of alpha-amino acids, beta-amino acids, gamma-amino acids, cationically functionalized monosaccharides, cationically functionalized ethylene glycols, ethylene imines, substituted ethylene imines, N-substituted spermine, N-substituted spermidine, and combinations thereof. The cationic conjugate also may be an oligomer including an oligopeptide, oligoamide, cationically functionalized oligoether, cationically functionalized oligosaccharide, oligoamine, oligoethyleneimine, and the like, as Nell as combinations thereof. The oligomers may be oligopeptides where amino acid residues of the oligopeptide are capable of forming positive charges. The oligopeptides may contain 5 to 25 amino acids; preferably 5 to 15 amino acids; more preferably 5 to 10 cationic amino acids or other cationic subunits.
[0145] In a related aspect, the present disclosure provides nucleic acids encoding peptide constructs as described herein. The nucleic acids can be generated from a nucleic acid template encoding a scaffold protein or a designed TRPV1 allosteric modulator, using any of a number of known recombinant DNA techniques. Accordingly, certain embodiments of the present disclosure provide an isolated nucleic acid comprising a polynucleotide sequence encoding a peptide construct comprising a TRPV1 allosteric modulator (including, but not limited to, peptide constructs comprising amino acid sequences having at least 70%, 80%, or 90% identity to SEQ ID NO:8 or SEQ ID NO:9 and optionally comprising cell penetration sequences such as SEQ ID NO: 19). Using these nucleic acids, a variety of expression constructs and vectors can be made. Generally, expression vectors include transcriptional and translational regulatory nucleic acid regions operably linked to the nucleic acid encoding the TRPV1 allosteric modulator. Control sequences that are suitable for prokaryotes, for example, include a promoter, optionally an operator sequence, and a ribosome binding site. In addition, the vector may contain a Positive Retroregulatory Element (PRE) to enhance the half-life of the transcribed mRNA (see, Gelfand et at. U.S. Pat. No. 4,666,848). The transcriptional and translational regulatory nucleic acid regions will generally be appropriate to the host cells used to express the peptide constructs. Numerous types of appropriate expression vectors and suitable regulatory sequences are known in the art for a variety of host cells. In general, the transcriptional and translational regulatory sequences may include, e.g. promoter sequences, ribosomal binding sites, transcriptional start and stop sequences, translational start and stop sequences, and enhancer or activator sequences. Typically, the regulatory sequences will include a promoter and/or transcriptional start and stop sequences. Vectors also typically include a polylinker region containing several restriction sites for insertion of foreign DNA. Heterologous sequences (e.g., a fusion tag such as a His tag) can be used to facilitate purification and, if desired, removed after purification. The construction of suitable vectors containing DNA encoding replication sequences, regulatory sequences, phenotypic selection genes, and TRPV1 allosteric modulators can be prepared using standard recombinant DNA procedures. Isolated plasmids, viral vectors, and DNA fragments can be cleaved, tailored, and ligated together in a specific order to generate the desired vectors, as is well-known in the art (see, e.g., Green and Sambrook, Molecular Cloning: A Laboratory Manual (Cold Spring Harbor Laboratory Press, New York, 4.sup.th ed. 2012)).
[0146] Provided in some embodiments is an expression cassette comprising a nucleic acid encoding a TRPV1 allosteric modulator as described herein operably linked to a promoter. In some embodiments, a vector comprising a nucleic acid encoding the TRPV1 allosteric modulator is provided. In certain embodiments, the expression vector contains a selectable marker gene to allow the selection of transformed host cells. Selection genes are well known in the art and will vary with the host cell used. Suitable selection genes can include, for example, genes coding for ampicillin and/or tetracycline resistance, which enables cells transformed with these vectors to grow in the presence of these antibiotics.
[0147] In some embodiments, a nucleic acid encoding a TRPV1 allosteric modulator is introduced into a cell, either alone or in combination with a vector. By introduced into, it is meant that the nucleic acids enter the cells in a manner suitable for subsequent integration, amplification, and/or expression of the nucleic acid. The method of introduction is largely dictated by the targeted cell type. Exemplary methods include CaPO.sub.4 precipitation, liposome fusion, LIPOFECTIN?, electroporation, heat shock, viral infection, and the like.
[0148] In some embodiments, prokaryotes are used as host cells for initial cloning steps. Other host cells include, but are not limited to, eukaryotic (e.g., mammalian, plant and insect cells), or prokaryotic (bacterial) cells. Exemplary host cells include, but are not limited to, Escherichia coli, Saccharomyces cerevisiae, Pichia pastoris, Sf9 insect cells, and CHO cells. They are particularly useful for rapid production of large amounts of DNA, for production of single-stranded DNA templates used for site-directed mutagenesis, for screening many constructs simultaneously, and for DNA sequencing of the constructs generated. Suitable prokaryotic host cells include E. coli K12 strain 94 (ATCC No. 31,446), E. coli strain W3110 (ATCC No. 27,325), E. coli K12 strain DG116 (ATCC No. 53,606), E. coli X1776 (ATCC No. 31,537), and E. coli B; and other strains of E. coli, such as HB101, JM101, NM522, NM538, and NM539. Many other species and genera of prokaryotes including bacilli such as Bacillus subtilis, other enterobacteriaceae such as Salmonella typhimurium or Serratia marcesans, and various Pseuaomonoas species can all be used as hosts. Prokaryotic host cells or other host cells with rigid cell walls are typically transformed using the calcium chloride method as described in Green and Sambrook et al., supra. Alternatively, electroporation can be used for transformation of these cells. Prokaryote transformation techniques are set forth in, for example Dower, in Genetic Engineering, Principles and Methods 12:275-296 (Plenum Publishing Corp., 1990); Hanahan et al., Meth. Enzymol., 204:63, 1991. Plasmids typically used for transformation of E. coli include pBR322, pUCI8, pUCI9, pUCI18, pUCI19, and Bluescript M13, all ofwhich are described by Green and Sambrook et al., supra. However, many other suitable vectors are available as well.
[0149] Accordingly, some embodiments of the present disclosure provide a host cell comprising a nucleic acid encoding a TRPV1 allosteric modulator, an expression cassette, or a vector as described herein. The host cells can be prokaryotic or eukaryotic. The host cells can be mammalian, plant, bacteria, or insect cells. In some embodiments, a TRPV1 allosteric modulator is produced by culturing a host cell transformed with an expression vector containing a nucleic acid encoding a TRPV1 allosteric modulator, under the appropriate conditions to induce or cause expression of the TRP V1 allosteric modulator. Methods of culturing transformed host cells under conditions suitable for protein expression are well-known in the art (see, e.g., Green and Sambrook et al., supra). Suitable host cells for production of the peptide constructs from lambda pL promoter-containing plasmid vectors include E. coli strain DC 16 (ATCC No. 53606) (see U.S. Pat. No. 5,079,352 and Lawyer, F. C. et al., PCR Methods and Applications 2:275-87, 1993, which are both incorporated herein by reference). Suitable host cells for production of the TRPV1 allosteric modulator from T7 promoter-containing plasmid vectors include E. coli strain BL21 (DE3) and related lysogens (see, e.g., U.S. Pat. No. 5,693,489). Following expression, a TRPV1 allosteric modulator can be harvested and isolated.
[0150] Alternatively, TRPV1 allosteric modulators as described herein may be synthesized by solid-phase peptide synthesis methods, during which N-?-protected amino acids having protected side chains are added stepwise to a growing polypeptide chain linked by its C-terminus to a solid support, e.g. polystyrene beads. Various chemistries, resins, protecting groups, protected amino acids and reagents can be employed as described, for example, by Barany and Merrifield, Solid-Phase Peptide Synthesis, in The Peptides: Analysis, Synthesis, Biology Gross and Meienhofer (eds.), Academic Press, N.Y., vol. 2, pp. 3-284 (1980); Atherton et al., Solid Phase Peptide Synthesis: A Practical Approach, IRL Press (1989); Bodanszky, Peptide Chemistry, A Practical Textbook, 2nd Ed., Springer-Verlag (1993)); and Chan et al. Fmoc Solid Phase Peptide Synthesis: A Practical Approach, Oxford University Press (2000).
[0151] Non-limiting examples of support materials for solid-phase peptide synthesis include polystyrene (e.g., microporous polystyrene resin, mesoporous polystyrene resin, macroporous polystyrene resin; including commercially-available Wang resins, Rink amide resins, and trityl resins), glass, polysaccharides (e.g., cellulose, agarose), polyacrylamide resins, polyethylene glycol, or copolymer resins (e.g., comprising polyethylene glycol, polystyrene, etc.). The solid support may have any suitable form factor. For example, the solid support can be in the form of beads, particles, fibers, or in any other suitable form factor. Non-limiting examples of protecting groups (e.g., N-terminal protecting groups) include Fmoc, Boc, allyloxycarbonyl (Alloc), benzyloxycarbonyl(Z), and photolabile protecting groups. Sidechain protecting groups include, but are not limited to, Fmoc; Boc; cyclohexyloxycarbonyl(Hoc); allyloxycarbonyl (Alloc); mesityl-2-sulfonyl(Mts); 4-(N-methylamino)butanoyl(Nmbu); 2,4-dimethylpent-3-yloxycarbonyl(Doc); 1-(4,4-dimethyl-2,6-dioxocyclohex-l-ylidene)-3-ethyl(Dde); 1-(4,4-dimethyl-2,6-dioxocyclohex-l-ylidene)-3-methylbutyl(ivDde); 4-methyltrityl(Mtt). Additional protecting groups and methods for their addition and removal from supported peptides are described, for example, by Isidro-Llobet et al. Chem. Rev. 2009, 19: 2455-2504.
[0152] A base may be used to activate or complete the activation of amino acids prior to exposing the amino acids to immobilized peptides. In some embodiments, the base is a non-nucleophilic bases, such as triisopropylethylamine, N,N-diisopropylethylamine, certain tertiary amines, or collidine, that are non-reactive to or react slowly with protected peptides to remove protecting groups. A coupling agent may be used to form a bond with the C-terminus of an amino acid to facilitate the coupling reaction and the formation of an amide bond. The coupling agent may be used to form activated amino acids prior to exposing the amino acids to immobilized peptides. Any suitable coupling agent may be used. In some embodiments, the coupling agent is a carbodiimide, a guanidinium salt, a phosphonium salt, or a uronium salt. Examples of carbodiimnides include, but are not limited to, N,N-dicyclohexylcarbodiimide (DCC), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC) and the like. Examples of phosphonium salts include, but are not limited to, such as benzotriazol-l-yloxy)tripyrrolidinophosphonium hexafluorophosphate (PyBOP); and the like. Examples of guanidinium/uronium salts include, but are not limited to, O-(benzotriazol-l-yl)-N,N,N,N-tetramethyluronium hexafluorophosphate (HBTU); 2(7-aza-H-benzotriazole-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate (HATU) 1-[(1-(cyano-2-ethoxy-2-oxoethylideneaminooxy)dimethylaminomorpholino)]uronium hexafluorophosphate (COMU); aand the like.
III. Pharmaceutical Compositions
[0153] Some embodiments of the present disclosure provide pharmaceutical compositions containing one or more TRPV1 allosteric modulators as described herein and one or more pharmaceutically acceptable excipients. The pharmaceutical compositions can be prepared by any of the methods well known in the art of pharmacy and drug delivery. In general, methods of preparing the compositions include the step of bringing a TRPV1 allosteric modulator and any other active ingredients into association with a carrier containing one or more accessory ingredients. The pharmaceutical compositions are typically prepared by uniformly and intimately bringing the active ingredient(s) into association with a liquid carrier or a finely divided solid carrier or both, and then, if necessary, shaping the product into the desired formulation. The compositions can be conveniently prepared and/or packaged in unit dosage form. In addition to the TRPV1 allosteric modulator, pharmaceutical compositions provided herein may also contain additional active ingredients such as analgesic agents, NSAIDs, antihistamines, steroids, and anti-cancer agents as described below.
[0154] Pharmaceutical compositions containing TRPV1 allosteric modulators can be in the form of aqueous or oleaginous solutions and suspensions (e.g. sterile injectable solutions for intravenous, intraperitoneal, intramuscular, intralesional, subcutaneous, or intrathecal injection; or sterile solutions or suspensions for administration as a nasal spray or nasal drops). Such preparations can be formulated using non-toxic parenterally-acceptable vehicles including water, Ringer's solution, and isotonic sodium chloride solution, and acceptable solvents such as 1,3-butane diol. In addition, sterile, fixed oils can be used as a solvent or suspending medium. For this purpose any bland fixed oil can be employed including synthetic monoglycerides, diglycerides, or triglycerides.
[0155] Aqueous suspensions can contain one or more TRPV1 modulators in admixture with excipients including, but not limited to: suspending agents such as sodium carboxymethylcellulose, methylcellulose, oleagino-propylmethylcellulose, sodium alginate, polyvinyl-pyrrolidone, gum tragacanth and gum acacia; dispersing or wetting agents such as lecithin, polyoxyethylene stearate, and polyethylene sorbitan monooleate; and preservatives such as ethyl, n-propyl, and p-hydroxybenzoate. Dispersible powders and granules (suitable for preparation of an aqueous suspension by the addition of water) can contain one or more TRPV1 allosteric modulators in admixture with a dispersing agent, wetting agent, suspending agent, or combinations thereof. Oily suspensions can be formulated by suspending a TRPV1 allosteric modulator in a vegetable oil (e.g., arachis oil, olive oil, sesame oil or coconut oil), or in a mineral oil (e.g., liquid paraffin). Oily suspensions can contain one or more thickening agents, for example beeswax, hard paraffin, or cetyl alcohol. These compositions can be preserved by the addition of an anti-oxidant such as ascorbic acid.
[0156] Pharmaceutical compositions containing TRPV1 allosteric modulators can also be formulated for oral use. Suitable compositions for oral administration include, but are not limited to, tablets, troches, lozenges, aqueous or oily suspensions, dispersible powders or granules, emulsions, hard or soft capsules, syrups, elixirs, solutions, buccal patches, oral gels, chewing gums, chewable tablets, effervescent powders, and effervescent tablets. Compositions for oral administration can be formulated according to any method known to those of skill in the art Such compositions can contain one or more agents selected from sweetening agents, flavoring agents, coloring agents, antioxidants, and preserving agents in order to provide pharmaceutically elegant and palatable preparations.
[0157] Tablets generally contain the active ingredient in admixture with non-toxic pharmaceutically acceptable excipients, including: inert diluents, such as cellulose, silicon dioxide, aluminum oxide, calcium carbonate, sodium carbonate, glucose, mannitol, sorbitol, lactose, calcium phosphate, and sodium phosphate: granulating and disintegrating agents, such as corn starch and alginic acid; binding agents, such as polyvinylpyrrolidone (PVP), cellulose, polyethylene glycol (PEG), starch, gelatin, and acacia; and lubricating agents such as magnesium stearate, stearic acid, and tale. The tablets can be uncoated or coated, enterically or otherwise, by known techniques to delay disintegration and absorption in the gastrointestinal tract and thereby provide a sustained action over a longer period. For example, a time delay material such as glyceryl monostearate or glyceryl distearate can be employed. Tablets can also be coated with a semi-permeable membrane and optional polymeric osmogents according to known techniques to form osmotic pump compositions for controlled release.
[0158] Compositions for oral administration can be formulated as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluent (such as calcium carbonate, calcium phosphate, or kaolin), or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium (such as peanut oil, liquid paraffin, or olive oil).
[0159] TRPV1 modulators as described herein can also be administered topically as a solution, ointment, cream, gel, or the like. Still further, transdermal delivery of the TRPV1 modulators can be accomplished by means of iontophoretic patches and the like.
[0160] In some embodiments, messenger RNAs encoding the TRPV1 allosteric modulators can be delivered as pharmaceutical compositions containing one or more excipients for increasing stability; increasing cell transfection; permitting the sustained or delayed release (e.g., from a depot formulation); altering the biodistribution (e.g., target to specific tissues or cell types); increasing the translation of encoded TRPV1 modulator in vivo; and/or altering the release profile of encoded TRPV1 modulator in vivo. Such excipients may include solvents, dispersion media, diluents, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives. mRNA formulations may also include, without limitation, lipidoids, liposomes, lipid nanoparticles, polymers, lipoplexes, core-shell nanoparticles, peptides, proteins, hyaluronidase, nanoparticle mimics and combinations thereof.
[0161] In some embodiments, pharmaceutical compositions for mRNA delivery may include liposomes such as those formed from the synthesis of stabilized plasmid-lipid particles (SPLP) or stabilized nucleic acid lipid particle (SNALP) that have been previously described and shown to be suitable for oligonucleotide delivery in vitro and in vivo (see e.g., U.S. Pat. No. 8,283,333, which is incorporated herein by reference in its entirety). Such liposomes may contain 3, 4, or more lipid components in addition to the mRNA. As an example a liposome can contain, but is not limited to, 50-60% cholesterol, 15-25% disteroylphosphatidyl choline (DSPC), 5-15% PEG-S-DSG, and 10-20% 1,2-dioleyloxy-N,N-dimethylaminopropane (DODMA). Cationic lipids such as 1,2-distearloxy-N,N-dimethylaminopropane (DSDMA), DODMA, DLin-DMA, or 1,2-dilinolenyloxy-3-dimethylaminopropane (DLenDMA), may also be included in the liposomes.
[0162] In some embodiments, a polynucleotide encoding a TRPV1 modulator may be formulated in a cationic oil-in-water emulsion where the emulsion particle comprises an oil core and a cationic lipid which can interact with the polynucleotide anchoring the molecule to the emulsion particle. Alternatively, the polynucleotide may be formulated in a water-in-oil emulsion comprising a continuous hydrophobic phase in which the hydrophilic phase is dispersed. (see, e.g., WO2012/006380, which is incorporated by reference in its entirety.
[0163] In some embodiments, the compositions include a polynucleotide encoding a TRPV1 modulator and a poloxamer. For example, the polynucleotide may be used in a gene delivery composition with the poloxamer described in U.S. Pub. No. 20100004313, the contents of which are herein incorporated by reference in its entirety. Polymer formulations may be stabilized by contacting the polymer formulation, which may include a cationic carrier, with a cationic lipopolymer which may ne covalently linked to cholesterol and polyethylene glycol groups. The cationic carrier may include, but is not limited to, polyethylenimine, poly(trimethylenimine), poly(tetramethylenimine), polypropylenimine, aminogycoside-polyamine, dideoxy-diamino-b-cyclodextrin, spermine, spermidine, poly(2-dimethylamino)ethyl methacrylate, poly(lysine), poly(histidine), poly(arginine), cationized gelatin, chitosan, cationic lipids as described above, and combinations thereof.
IV. Methods for TRPV1 Stimulation and Disease Treatment
[0164] Also provided herein are methods for stimulating TRPV1 activity in a cell. The methods include contacting the cell with an effective amount of a peptide construct as described above. Contacting cells may include addition of a TRPV1 allosteric modulator to a cell culture in vitro, inducing expression of the TRPV1 allosteric modulator in cell culture using a nucleic acid or vector as described above, administering a TRPV1 allosteric modulator to a subject (e.g., in conjunction with a pharmaceutical composition as described above), or inducing expression of the TRPV1 allosteric modulator in the subject. Stimulating TRPV1 generally includes contacting the cells with an amount of the TRPV1 allosteric modulator to increase the level of TRPV1 activity as compared to the level of TRPV1 activity in the absence of the TRPV1 allosteric modulator. For example, contacting the cells with the TRPV1 allosteric modulator can result in activity increases ranging from about 1% to about 99% or higher, e.g., from about 100-200%, or from about 100-250%, or from about 100%-500%. In some embodiments, TRPV1 activity may be increased by an order of magnitude or several orders of magnitude. TRPV1 activity levels may be assessed by a number of techniques, include via calcium imaging or electrophysiological studies as described in more detail below.
[0165] Also provided herein are methods for treatment of conditions associated with TRPV1 activity including, but not limited to, pain, itch, cancer, inflammation, atopic dermatitis, chemesthesis, and sensory disorders (e.g., loss of taste and/or smell). The methods include administering an effective amount of a TRPV1 allosteric modulator, or a nucleic acid encoding; the TRPV1 allosteric modulator, to a subject in need thereof. TRPV1 allosteric modulators can be administered at any suitable dose in the methods provided herein. In general, a TRPV1 allosteric modulator is administered at a dose ranging from about 1 microgram to about 1000 milligrams per kilogram of a subject's body weight (i.e., about 0.001-1000 mg/kg). The dose of TRPV1 allosteric modulator can be, for example, about 0.001-1000 mug/kg, or about 0.01-500 mg/kg, or about 0.01-250 mg/kg, or about 0.01-100 mg/kg, or about 0.1-100 mg/kg, or about 0.1-50 mg/kg, or about 0.1-10 mg/kg, or about 0.5-1000 mg/kg, or about 0.5-750 mg/kg, or about 0.750-750 mg/kg. The dose of TRPV1 allosteric modulator can be about 0.001, 0.005, 0.01, 0.05, 0.1, 0.5, 1, 5, 25, 50, 75, 100, 200, 250, 300, 400, 500, 600, 700, 800, 900, or 1000 mg/kg. The dosages can be varied depending upon the requirements of the patient, the severity of the infection being treated, and the particular formulation being administered. The dose administered to a patient should be sufficient to result in a beneficial therapeutic response in the patient. The size of the dose will also be determined by the existence, nature, and extent of any adverse side-effects that accompany the administration of the drug in a particular patient. Determination of the proper dosage for a particular situation is within the skill of the typical practitioner. The total dosage can be divided and administered in portions over a period of time suitable to treat to the disease or condition.
[0166] In some embodiments, a TRPV1 allosteric modulator is administered locally via injection to a target organ or tissue (e.g. an arthritic joint; a psoriatic plaque; or a tumor). In some such embodiments, dosages in the range of 1 pig to 50 mg (e.g., 1 ?g-10 mg, 10 ?g-10 mg, or 100 ?g-1 mg) may be employed.
[0167] Animal studies, such as mouse studies described in this disclosure, may be useful in determining dosing for humans. For example, an average mouse weighs 0.025 kg. Systemically administering 0.025, 0.05, 0.1 and 0.2 ?g of a TRPV1 allosteric modulator according to the present disclosure may therefore correspond to a dose range of 1, 2, 4, and 8 ?g of the TRPV1 allosteric modulator/kg. If an average human adult is assumed to have a weight of 70 kg, the corresponding systemic human dosage would be 70, 140, 280, and 560 ?g of TRPV1 allosteric modulator. Local dosages may be determined in similar fashion by considering the local mass of a target tissue e.g., a tissue mass of 0.1-0.5 kg surrounding a human joint. Dosages for other active agents may be determined in similar fashion.
[0168] TRPV1 allosteric modulators can be administered for periods of time which will vary depending upon the nature of the infection, its severity, and the overall condition of the subject to whom the TRPV1 allosteric modulator is administered. Administration can be conducted, for example, hourly, every 2 hours, three hours, four hours, six hours, eight hours, or twice daily including every 12 hours, or any intervening interval thereof. Administration can be conducted once daily, or once every 36 hours or 48 hours, or once every month or several months. Following treatment, a subject can be monitored for changes in his or her condition and for alleviation of the symptoms of the disorder. The dosage of the TRPV1 allosteric modulator can either be increased in the event the subject does not respond significantly to a particular dosage level, or the dose can be decreased if an alleviation of the symptoms of the disorder is observed, or if the disorder has been remedied, or if unacceptable side effects are seen with a particular dosage. Administration of the TRPV1 allosteric modulator may be conducted over periods of time ranging from a few days to several weeks, months, or years.
[0169] In some embodiments, the methods may be used for the treatment of pain. The terms neuropathic pain or neurogenic pain can be used interchangeably and refer to pain that arises from direct stimulation of nervous tissue itself, central or peripheral and can persist in the absence of stimulus. The sensations that characterize neuropathic pain vary and are often multiple and include burning, gnawing, aching, and shooting. (See, e.g., Rooper and Brown, (2005) Adams and Victor's Principles of Neurology, 8.sup.th NY, McGraw-Hill). These damaged nerve fibers send incorrect signals to other pain centers. The impact of nerve fiber injury includes a change in nerve function both at the site of injury and areas around the injury, as well as in the central nervous system. Chronic neuropathic pain often seems to have no obvious cause, however, some common causes may include, but are not limited to, alcoholism, amputation, back, leg and hip problems, chemotherapy, diabetes, facial nerve problems (e.g., trigeminal neuralgia), HIV infection or AIDS, multiple sclerosis, shingles, spine surgery, spinal cord injury, traumatic brain injury, and stroke. For example, one example of neuropathic pain is phantom limb syndrome, which occurs when an arm or leg has been removed because of illness or injury, but the brain still gets pain messages from the nerves that originally carried impulses from the missing limb. In some embodiments, the pain may be inflammatory pain, cancer pain, muscle pain, orthodontic pain, shingles-induced pain, or headache (e.g., migraine). Mechanical allodynia or tactile allodynia, pain induced by normally innocuous mechanical stimulation, is a common feature of chronic pain. Chronic pain due to arthritis and cancer are serious problems in pets and other companion animals in addition to humans. Advantageously, as discussed below, TRPV1 modulators can be used for treatment of pain without causing hyperthermia in subjects to whom the modulators are administered. In some embodiments, for example, the body temperature of the subject may increase by no more than 1? C. above basal body temperature (e.g., less than 0.8? C. or less than 0.5? C. above basal body temperature) upon administration of a TRPV1 modulator to the subject.
[0170] In some embodiments, the methods may be used for the treatment of pruritus, commonly referred to as itching. Itch is a major medical problem, and its impact on quality of life can equal that of pain. It represents an unmet medical need as few effective therapies are available. Itch can originate in the peripheral nervous system (dermal or neuropathic) or in the central nervous system (neuropathic, neurogenic, or psychogenic) Itch originating in the skin is considered proprioceptive and can be induced by a variety of stimuli, including mechanical, chemical, thermal, and electrical stimulation. Neuropathic itch can originate at any point along the afferent pathway as a result of damage of the nervous system. They could include diseases or disorders in the central nervous system or peripheral nervous system. Examples of neuropathic itch in origin are nostalgia paresthetica, brachioradial pruritus, brain tumors, multiple sclerosis, peripheral neuropathy, and nerve irritation. Neurogenic itch, which is itch induced centrally but with no neural damage, is often associated with increased accumulation of endogenous opioids and possibly synthetic opioids. Itch is also associated with some psychiatric disorders such as delusions of parasitosis or related obsessive-compulsive disorders, for example neurotic scratching.
[0171] TRPV1 allosteric modulators may also be administered in conjunction with other agents useful to treat pain and/or itch, including but not limited to steroids (e.g., cortisone, hydrocortisone) and non-steroidal anti-inflammatory agents (NSAIDs). Examples of NSAIDs include, but are not limited to, aceclofenac, 5-amino salicylic acid, aspirin, celecoxib, dexibuprofen, diclofenac, diflusinal, etodolac, fenoprofen, flufenamic acid, flurbiprofen, ibuprofen, indomethacin, ketoprofen, ketorolac, loxoprofen, mefenamic acid, nabumetone, naproxen, nimesulide, sulindac, and pharmaceutically acceptable salts thereof. Additional analgesic agents such as paracetamol (acetaminophen) and opioid analgesic agents (e.g., fentanyl, sufentanil, carfentanyl, lofentanil, alfentanil, hydromorphone, oxycodone, morphine, hydroxycodone, propoxyphene, pentazocine, methadone, thyridine, butorphanol, buprenorphine, levorphanol, codeine, oxymorphone, meperidine, and the like) may also be administered in conjunction with the TRPV1 modulator. Other active agents which are known to inhibit neuronal excitation may also be administered including, but not limited to, sodium channel blockers, local anaesthetics, modulators of CB2 receptors, potassium channel openers, calcium channel blockers, NMDA-receptor antagonists, GABA receptor modulators, alpha2 adrenoceptor modulators, examples of which are described in WO 2009/000038, which is incorporated herein by reference in its entirety. In some embodiments, treatment of pain may further include administration of a non-steroidal anti-inflammatory agent, an opioid analgesic, acetaminophen, or a combination thereof to the subject.
[0172] In some embodiments, treatment of pruritus may further include one or more antihistamines (e.g., diphenhydramine, clemastine, loratadine, hydroxyzine, promethazine, alimemazine, pheniramine, or the like), one or more steroids (e.g. clobetasol propionate, desonide, desoximetasone, fluocinonide, halobetasol propionate, hydrocortisone, triamcinolone acetomide, and the like), one or more anesthetics (e.g., lignocaine, bupivacaine, ropivacaine, procaine, tetracaine, and the like) or a combination thereof to the subject
[0173] TRPV1 is known to be expressed in several different neoplastic tissues. In some embodiments, the methods may be used for the treatment of cancers including, but not limited to, chronic myeloid leukemia, hairy cell leukemia, melanoma, multiple myeloma, non-Hodgkin lymphoma, acute myeloid leukemia, prostate cancer (including castration-resistant prostate cancer), chronic lymphocytic leukemia, cutaneous lymphomas, polycythemia vera, relapsed follicular lymphoma, systemic mastocytosis, and testicular cancer (including testicular teratoma). Other cancers include fibrosarcoma myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendothelio-sarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon cancer, colorectal cancer, kidney cancer, pancreatic cancer, bone cancer, breast cancer, ovarian cancer, esophageal cancer, stomach cancer, oral cancer, nasal cancer, throat cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilms' tumor, cervical cancer, uterine cancer, small cell lung carcinoma, bladder carcinoma, lung cancer, epithelial carcinoma, glioma, glioblastoma multiform, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, meningioma, skin cancer, neuroblastoma, or retinoblastoma.
[0174] In some embodiments, the cancer is a breast cancer, squamous cell carcinoma (e.g., of the tongue), hepatocellular carcinoma, or carcinoma of the bladder (e.g., a transitional carcinoma of the human bladder).
[0175] Methods for treating cancer may include administration of one or more anti-cancer agents including, but are not limited to, a chemotherapeutic agent (e.g., carboplatin, paclitaxel, pemetrexed, or the like), a tyrosine kinase inhibitor (e.g., erlotinib, crizotinib, osimertinib, or the like), and an immunotherapeutic agent (e.g., pembrolizumab, nivolumab, durvalumab, atezolizumab, or the like). One or more anti-cancer agents may be administered to a subject prior to administration of a TRPV1 allosteric modulator, concomitantly with administration of a TRPV1 allosteric modulator, or after administration of a TRPV1 allosteric modulator. Ami-cancer agents may be co-formulated with TRPV1 allosteric modulators in pharmaceutical compositions such as those as described above. In some embodiments, methods for treating cancer includes the administration of radiotherapy, e.g., external beam radiation; intensity modulated radiation therapy (IMRT); brachytherapy (internal or implant radiation therapy); stereotactic body radiation therapy (SBRT)/stereotactic ablative radiotherapy (SABR); stereotactic radiosurgery (SRS); or a combination of such techniques. Dosing and administration of the TRPV1 allosteric modulator may be varied as set forth above.
V. Examples
Example 1. Computational Design of Protein Binders to the ARD
[0176] Protein binders to the ARD were de novo designed following the hotspot centric stratagem described previously (
[0184] A total of 167 unique protein structures was selected. They were further cleaned and prepacked in Rosetta (Scripts 3 and 4 above). The ARD was then docked to the scaffold library in a coarse-grained manner with the PatchDock software (23) based on protein structure shape complementarity. The patchdocked scaffolds were fused with the two hotspots and then the protein-protein interface was redesigned by RosettaScripts (Script 5 above). These initial designs were assessed by plotting as shown in
[0185] All the molecular graphics of protein structure models were rendered by UCSF Chimera (32) software version 1.12 (33).
[0186] To positively modulate TRPV1 channel in a precise and domain-specific manner, we chose to design binders to the ARD (
[0187] Toward this goal, we improved the original hotspot centric method in three consecutive steps. First, we evaluated the candidate designs multi-metrically (
TABLE-US-00010 TABLE 4 Number Number Total Total Design Scaffold of of Score ddg SASA Hydrophobic Shape Name PDB Residues Mutations (REU) (REU) (?) area (?) complementarity De1 IQZM 93 24 ?497.304 ?31.13 1930.48 1367.27 0.6743 De2 IQZM 93 26 ?567.079 ?40.64 2253.36 1689.67 0.6853 De3 3ONJ 96 26 ?608.476 ?45.18 2991.22 2049.31 0.6355 De4 2HDZ 65 22 ?408.786 ?37.35 2311.28 1843.63 0.7126
Example 2. Fluorescence Imaging and FRET Quantification Demonstrate that Designed Proteins Bind to TRPV1
[0188] To experimentally test whether our designed proteins work as PAM of TRPV1, we first tested whether they could interact with TRPV1 channel in live cells. We genetically fused YFP and CFP to the C termini of TRPV1 and our designs, respectively.
[0189] Super-resolution fluorescence microscopy was performed with the Zeiss LSM 880 fluorescence microscope with Airyscan. YFP fused to TRPV1 and CFP fused to the designed proteins were excited by laser line at 488 nm and 458 nm, respectively. We used a 60? oil-immersion objective (NA 1.42) in these experiments. Fluorescence imaging was performed with the default settings for CFP and YFP channels in the microscope controlled by the Zeiss ZEN software. Overlay of YFP- and CFP-channel images was also done in ZEN.
[0190] For spectroscopic imaging in FRET experiments, the imaging system was built upon a Nikon TE2000-U microscope. The excitation light was generated by an Ar laser. The duration of light exposure was controlled by a computer-driven mechanical shutter (Uniblitz). A spectrograph (Acton SpectraPro 2150i) was used in conjunction with a CCD camera (Roper Cascade 128B). In this recording mode two filter cubes (Chroma) were used to collect spectroscopic images from each cell (excitation, dichroic): cube 1. D436/20, 455dclp; cube II, HQ500/20, Q5151p. No emission filter was used in these cubes. Under our experimental conditions, auto fluorescence from untransfected cells was negligible. Fluorescence imaging and analysis were done using the MetaMorph software (Universal Imaging). User-designed macros were used for automatic collection of the bright field cell image, the fluorescence cell image, and the spectroscopic image. Emission spectra were collected from the plasma membrane of the cell by positioning the spectrograph slit across a cell and recording the fluorescence intensity at the position corresponding to the membrane region (
[0191] When De1 and TRPV1 channel were co-transfected and expressed in HEK293 cells, we observed clear co-localization of these molecules on cell membrane with the Airyscan super resolution imaging (
TABLE-US-00011 TABLE 5 Design Apparent K.sub.D FRET ratio max De1 1.2*10.sup.5 3.86 De2 7.5*10.sup.4 2.35 De3 1.1*10.sup.4 1.99 De4 9.5*10.sup.9 n.a.
[0192] We further quantified the FRET efficiency between the designed protein and TRPV1 using the spectraFRET method we previously used to study TRP channels.[30] We observed that De1, De2 and De3 show FRET efficiency values of 9-2%, 7.4%, and 10.9%, respectively (
Example 3. Surface Plasmon Resonance Measurements Demonstrates that Designed Proteins Bind to TRVP1 ARD
[0193] To further quantify the binding affinity of the designs to the ARD, we expressed and purified both designed proteins and the ARD in E. coli. The DNA sequence of each designed protein and the ARD of TRPV1 (see their primary protein sequences in Table 6) was synthesized and inserted into the pET-32a plasmid after codon optimization for protein expression in bacteria E. coli BL21 (DE3) was transformed with the recombinant plasmids. A single colony was inoculated into media containing ampicillin; cultures were incubated in 37? C. at 200 rpm. Once cell density reached to OD 0.8-1.0 at 600 inn, IPTG was introduced for induction. SDS-PAGE was used to monitor the expression. A range of expression conditions were tested as shown in
[0194] We then quantified the binding of De1 and De3 to the ARD protein fixed on the sensor chip by surface plasma resonance (SPR) (
[0195] We observed that De and De3 bound with the ARD in a concentration-dependent manner, yielding K.sub.D values of 26.5?9.9 nM and 29.7?0.9 nM, respectively (
TABLE-US-00012 TABLE6 Protein PrimarySequence Del NGYSSEDKLRIAKRHLLPKQIERNALKKGELFVSEFAIL (SEQID GIILFYTDEAGVRGLEREISKLCRKAVKQLLLDKSTTSS NO:8) HASGFHLHDYLGVMR De2 NGYWSEDKERIAKRHLLPKQIERNALKKGELKVWEFAIF (SEQID GIILFYTWEAGVRGLEREISKLCRKAVKQLLLDKSTTRS NO:37) WASGFHLHDYLGVMR De3 SLLDSYKLDFWKTSTNAENSLHEAPSQPLSQRNTTLKHV (SEQID EQQQDELFDLLDQMDVEVNNSIGRDADRRWYLFELWFWK NO:9) ISIEEEIKRPLQSLVDSG De4 LPESPRFAQKIWQQSVIGDYLARFKNDRVKALKAMEDSS (SEQID NNSSMHRFAEFFAKAFEDLHRYLEEL NO:38) ARD MSVSAGEKPPRLYDRRSIFDAVAQSNCQELESLLPFLQR (SEQID SKKRLTDSEFKDPETGKTCLLKAMLNLHNGQNDTIALLL NO:39) DVARKTDSLKQFVNASYTDSYYKGQTALHIAIERRNMTL VTLLVENGADVQAAANGDFFKKTKGRPGFYFGELPLSLA ACTNQLAIVKFLLQNSWQPADISARDSVGNTVLHALVEV ADNTVDNTKFVTSMYNEILILGAKLHPTLKLEEITNRKG LTPLALAASSGKIGVLAYILQREIHEPECRHAAAHHHHH H
Example 4. Calcium Imaging Demonstrates that Designed Proteins are Positive Allosteric Modulators of TRPV1
[0196] We then investigated whether, upon binding of the designed proteins, TRPV1 activation was positively modulated. Transiently transfected HEK293 cells seeded on 25 mm coverslips were washed twice with an extracellular solution (ECS) containing 140 mM NaCl, 5 mM KCl, 1 mM MgCl.sub.2, 1.8 mM CaCl.sub.2, 10 mM glucose, and 15 mM HEPES (pH 7.4), followed by incubation in 2 ml of ECS supplemented with 2 ?M Fluo-4/AM (Kd for Ca.sup.2+ at 345 nM) and 0.05% Pluronic F-127 (both from Molecular Probes) at room temperature for 60 min. Probenecid (2 mM) was included in all solutions to prevent Fluo-4 leakage from cells. At the end of incubation, cells were washed three times with ECS and incubated in the same solution for another 20 min at room temperature to complete the intracellular hydrolysis process of the AM ester, which converts the non-fluorescent Fluo-4/AM into the fluorescent version Fluo-4.
[0197] Coverslip with dye-loaded cells was placed in the quick-release magnetic chamber (Warner) and mounted on the stage of a Nikon Eclipse TE2000-U microscope system equipped with a Roper Cascade 128B CCD camera. Fluo-4 was excited by an Argon laser with a filter set of Z488/10 (excitation), z488rdc (dichroic) and recorded through an emission filter HQ5001p (all from Chroma). The duration of light exposure was controlled by a computer-driven mechanical shutter (Uniblitz). Cell images were acquired sequentially with an exposure period of 200 ms at an interval of 1 s. The shutter and the camera were controlled and synchronized by MetaMorph software (Universal Imaging). Cells pretreated with 1 ?M thapsigargin during the dye-loading step (aiming to deplete ER Ca.sup.2+ store) did not exhibit noticeable difference in fluorescence intensity or kinetics changes compared to untreated cells.
[0198] With calcium imaging, we first observed that while 0.5 nM capsaicin did not illicit calcium influx in cells expressing only TRPV1, this low concentration was sufficient to activate TRPV1 channels co-expressed with either De1, or De3 (
Example 5. Electrophysiological Study of TRPV1 Positive Allosteric Modulation by Designed Proteins
[0199] Patch-clamp recordings were performed with a HEKA EPC10 amplifier controlled by PatchMaster software (HEKA). Whole-cell recordings at ?80 mV were used to test whether an ANAP-incorporated channel was functional. Patch pipettes were prepared from borosilicate glass and fire-polished to resistance of ?4 M?. For whole-cell recording, serial resistance was compensated by 60%. A solution with 130 nM NaCl, 10 mM glucose, 0.2 mM EDTA and 3 mM HEPES (pH 7.2) was used in both bath and pipette for concentration response curve measurements in TRPV1, TRPV2 and TRPV3. To measure calcium-dependent ligand-induced desensitization and tachyphylaxis, 2 mM CaCl.sub.2 was added to the solution. Membrane potential was clamped at ?80 mV. Current was sampled at 10 kHz and filtered at 2.9 kHz. All recordings were performed at room temperature (22? C.) with the maximum variation of 1? C. The capsaicin or 2-APB concentration-dependent activation curves were fit to a Hill equation to obtain the EC50 value and the slope factor.
[0200] Ligands were perfused to membrane patch by a gravity-driven system (RSC-200, Bio-Logic). Bath and ligand solution were delivered through separate tubes to minimize the mixing of solutions. Patch pipette was placed in front of the perfusion tube outlet.
[0201] Consistent with calcium imaging, patch-clamp recordings revealed that, when either De1 or De3 was co-expressed with TRPV1, the concentration-response curve of capsaicin activation in the absence of extracellular calcium was left-shifted (
[0202] Moreover, ligand activation of TRPV1 was accompanied with an acute desensitization process in the presence of extracellular calcium ions (
Example 6. Study of Analgesic Effects Exerted by Designed PAMs in Animals
[0203] To test whether our designed PAMs have analgesic effects, we performed animal behavior experiments.
[0204] Animals. Male Sprague-Dawley rats (200-250 g, Charles River Laboratories, Inc.) were housed under a 12 h light-dark cycle and allowed access to food and water ad libitum. The ambient temperature of the holding and testing; rooms was ?22? C. All procedures involving animals were carried out in strict compliance with the National Institutes of Health and institutional guidelines for the humane care of animals and were approved by the Animal Care and Use Committee of Zhejiang University (Approval ID: ZJU20190100). All efforts were made to minimize both animal numbers and distress within the experiments.
[0205] Animal behavioral measurements. A 10 mM stock solution of MRS1477 was prepared in 100% DMSO and further diluted in vehicle to 2 ?g/100 ?l (50 ?M). Capsaicin was prepared as a 100 mM stock solution in DMSO, stored at ?80? C., and was diluted directly into vehicle on the day of the experiments to 4.6 ?g/100 ?l (150 ?M). Capsaicin-only injectates contained an equal amount of DMSO as those with MRS1477. All intraplantar injections were made using a. 29 G??, 3/10 cc insulin syringe. The experimenter was blinded to the identity of the injectates in the various behavioral experiments.
[0206] Thermal hyperalgesia measurement was performed as reported previously (11, 35). Briefly, unrestrained rats were placed on a clear glass platform which a light beam was applied onto the plantar hind paws of the animals under a small plastic cage which allowed them to move freely. The thermal nociceptive response was defined as the latency between light stimulus onset and paw withdrawal using a feedback-controlled shutdown unit. The intensity of the light stimulus was set such that naive rats responded with a latency of approximately 5 s. Each paw was tested one time. In the absence of a response within a predetermined maximum latency (30 s), the test was terminated to prevent tissue damage. On the day of testing, rats were allowed to habituate for at least 30 min prior to thermal stimulation. Rats were tested prior to intradermal injection to establish a baseline, then at 2, 24, 48, 72 hours, 7, 16 and 21 days post-injection.
[0207] Statistics. All experiments have been independently repeated for at least three times. All statistical data are given as mean?SEM. Two-sided Student's t-test was applied to examine the statistical significance. N.S. indicates no significance. *, ** and ***,p<0.05,p<0.01 andp<0.001, respectively.
[0208] Results. Since the ARD of TRPV1 is located intracellularly, we genetically fused the TAT peptide (RKKRRQRRR) (27) to the N terminus of our De1 and De3 to facilitate their transmembrane delivery. Only TAT-De3 was able to be expressed and purified in E. coli. We observed that the TAT-De3 can still bind to the ARD in SPR experiments, though its affinity was reduced (
[0209] We observed significant analgesic effects of TAT-De3 intradermally injected into the hind paw of rats against thermal pain. We used the small molecule PAM MRS1477 as the positive control, because the analgesic effects of this molecule in thermal pain has been demonstrated (11). We used a halogen lamp to heat the hind paw of a rat at a spot less than 20 mm.sup.2 to above 45? C. to elicit thermal pain. We recorded paw withdrawal latency to reflect the pain sensation. Injection of capsaicin alone (150 ?M and 100 ?l) caused initial acute pain, but after two hours when we started to measure heat induced paw lifting behavior, we observed no change in the paw withdrawal latency (
VI. REFERENCES
[0210] 1. Steglitz J, Buscemi J, & Ferguson M J (2012) The future of pain research, education, and treatment: a summary of the IOM report Relieving pain in America: a blueprint for transforming prevention, care, education, and research. Translational behavioral medicine 2(1):6-8. [0211] 2. Caterina M J, et al. (1997) The capsaicin receptor: a heat-activated ion channel in the pain pathway. Nature 389(6653):816-824. [0212] 3. Tominaga M, et al. (1998) The cloned capsaicin receptor integrates multiple pain-producing stimuli. Neuron 21(3):531-543. [0213] 4. Caterina M J, et al. (2000) Impaired nociception and pain sensation in mice lacking the capsaicin receptor. Science 288(5464):306-313. [0214] 5. Kort M E & Kyn P R (2012) TRPV1 antagonists: clinical setbacks and prospects for future development. Prog Med Chem 51:57-70. [0215] 6. Julius D (2013) TRP channels and pain. Annual review of cell and developmental biology 29:355-384. [0216] 7. Gavva N R (2009) Setbacks in the Clinical Development ofTRPV1 Antagonists. The Open Drug Discovery Journal 1:1-35. [0217] 8. Sapio M R, et al. (2018) Pain control through selective chemo-axotomy of centrally projecting TRPV1+ sensory neurons. The Journal of clinical investigation 128(4):1657-1670, [0218] 9. Tadarola M J & Mannes A J (2011) The vanilloid agonist resiniferatoxin for interventional-based pain control. Current topics in medicinal chemistry 11(17):2171-2179. [0219] 10. Roh E J, Keller J M, Olah Z, Iadarola M J, & Jacobson K A (2008) Structure-activity relationships of 1,4-dihydropyridines that act as enhancers of the vanilloid receptor 1 (TRPV1). Bioorganic & medicinal chemistry 16(20):9349-9358. [0220] 11. Lebovitz E E, et al. (2012) Positive allosteric modulation of TRPV1 as a novel analgesic mechanism. Molecular pain 8:70. [0221] 12. Kaszas K, et at (2012) Small molecule positive allosteric modulation of TRPV1 activation by vanilloids and acidic pH. The Journal of pharmacology and experimental therapeutics 340(1): 152-160. [0222] 13. Lishko P V, Procko E, Jin X, Phelps C B, & Gaudet R (2007) The ankyrin repeats of TRPV1 bind multiple ligands and modulate channel sensitivity. Neuron 54(6):905-918. [0223] 14. Cao E, Liao M, Cheng Y, & Julius D (2013) TRPV1 structures in distinct conformations reveal activation mechanisms. Nature 504(7478):113-118. [0224] 15. Liao M, Cao E, Julius D, & Cheng Y (2013) Structure of the TRPV1 ion channel determined by electron cryo-microscopy. Nature 504(7478):107-112. [0225] 16. Leaver-Fay A. et al. (2011) ROSETTA3: an object-oriented software suite for the simulation and design of macromolecules. Methods in enzymology 487:545-574. [0226] 17. Fleishman S J, et at. (2011) Computational design of proteins targeting the conserved stem region of influenza hemagglutinin. Science 332(6031):816-821. [0227] 18. Fleishman S J, et al. (2011) Hotspot-centric de novo design of protein binders. J Mol Biol 413(5):1047-1062. [0228] 19. Strauch E M, Fleishman S J, & Baker D (2014) Computational design of a pH-sensitive IgG binding protein. Proc Natl Acad Sci USA 111(2):675-680. [0229] 20. Phelps C B, Wang R R, Choo S S, & Gaudet R (2010) Differential regulation of TRPV1, TRPV3, and TRPV4 sensitivity through a conserved binding site on the ankyrin repeat domain. J Biol Chem 285(1):731-740. [0230] 21. Lau S Y, Procko E, & Gaudet R (2012) Distinct properties of Ca2+-calmodulin binding to N- and C-terminal regulatory regions of the TRPV1 channel. J Gen Physiol 140(5):541-555. [0231] 22. Gao Y, Cao E, Julius D, & Cheng Y (2016) TRPV1 structures in nanodiscs reveal mechanisms of ligand and lipid action. Nature 534(7607):347-351. [0232] 23. Schneidman-Duhovny D, Inbar Y, Nussinov R, & Wolfson H J (2005) PatchDock and SymmDock: servers for rigid and symmetric docking. Nucleic Acids Res 33(Web Server issue):W363-367. [0233] 24. Fleishman S J, et al. (2011) RosettaScripts: a scripting language interface to the Rosetta macromolecular modeling suite. PLoS One 6(6):e20161. [0234] 25. Huff J (2015) The Airyscan detector from ZEISS: confocal imaging with improved signal-to-noise ratio and super-resolution. Nature Methods 12(12):i-ii. [0235] 26. Takanishi C L, Bykova E A, Cheng W, & Zheng J (2006) GFP-based FRET analysis in live cells. Brain research 1091(1):132-139. [0236] 27. Zou L, Peng Q, Wang P. & Zhou B (2017) Progress in Research and Application of HIV-1 TAT-Derived Cell-Penetrating Peptide. The Journal of membrane biology 250(2):115-122. [0237] 28. Gaudet R (2008) A primer on ankyrin repeat function in TRP channels and beyond. Molecular bioSystems 4(5):372-379. [0238] 29. Stevens R M, et al. (2019) Randomized, Double-Blind, Placebo-Controlled Trial of Intraarticular Trans-Capsaicin for Pain Associated With Osteoarthritis of the Knee. Arthritis Rheumatol 71(9):1524-1533. [0239] 30. Cheng W, Yang F, Takanishi C L, & Zheng J (2007) Thermosensitive TRPV1 channel subunits coassemble into heteromeric channels with intermediate conductance and gating properties. J Gen Physiol 129(3):191-207. [0240] 31. Wang C, et al. (2007) RosettaDock in CAPRI rounds 6-12. Proteins 69(4):758-763. [0241] 32. Pettersen E F, et al. (2004) UCSF Chimeraa visualization system for exploratory research and analysis. Journal of computational chemistry 25(13):1605-1612. [0242] 33. Anonymous (2018) UCSF Chimera. [0243] 34. Qiu S, Hua Y L, Yang F, Chen Y Z, & Luo J H (2005) Subunit assembly of N-methyl-d-aspartate receptors analyzed by fluorescence resonance energy transfer. J Biol Chem 280(26):24923-24930. [0244] 35. Gavva N R, et al. (2005) AMG 9810 [(E)-3-(4-t-butylphenyl)-N-(2,3-dihydrobenzo[b][1,4]dioxin-6-yl)acrylamide], a novel vanilloid receptor 1 (TRPV1) antagonist with antihyperalgesic properties. The Journal of pharmacology and experimental therapeutics 313(1):474-484.
VII. Exemplary Embodiments
[0245] Exemplary embodiments provided in accordance with the presently disclosed subject matter include, but are not limited to, the claims and the following embodiments: [0246] 1. A TRPV1 allosteric modulator comprising a peptide containing two hotspot amino acid residues, [0247] wherein the hotspot amino acid residues are aromatic amino acid residues that interact with a TRPV1 ankyrin repeat domain (ARD), and [0248] wherein alpha carbon atoms in the two hotspot amino acid residues are within 5-10 ? of each other upon folding of the peptide under physiological conditions. [0249] 2. The TRPV1 allosteric modulator of embodiment 1, comprising a polypeptide sequence having at least 70% identity to positions 64-94 of SEQ ID NO:9, provided that the amino acid residues at position 72 and position 76 are hotspot amino acid residues. [0250] 3. The TRPV1 allosteric modulator of embodiment 1 or embodiment 2, wherein the hotspot amino residues are phenylalanine residues. [0251] 4. The TRPV1 allosteric modulator of embodiment 2 or embodiment 3, comprising a polypeptide sequence having at least 95% identity to positions 64-94 of SEQ ID NO:9, provided that the amino acid residues at position 72 and position 76 are hotspot phenylalanine residues. [0252] 5. The TRPV1 allosteric modulator of any one of embodiments 2-4, comprising a polypeptide sequence having at least 70% identity to SEQ ID NO:9 provided that the amino acid residues at position 72 and position 76 are hotspot amino acid residues. [0253] 6. The TRPV1 allosteric modulator of embodiment 5, wherein the hotspot amino residues are phenylalanine residues. [0254] 7. The TRPV1 allosteric modulator of embodiment 6, comprising a polypeptide sequence having at least 90% identity to SEQ ID NO:9 provided that the amino acid residues at position 72 and position 76 are hotspot phenylalanine residues. [0255] 8. The TRPV1 allosteric modulator of any one of embodiments 1 and 5-7, wherein: [0256] the peptide comprises a helix.sup.1-loop-helix.sup.2-loop-helix.sup.3 architecture, helix.sup.1, helix.sup.2, and helix.sup.3 are folded in a three-helix bundle, and the hotspot amino acid residues are phenylalanine residues located in helix.sup.3. [0257] 9. The TRPV1 allosteric modulator of embodiment 1, comprising a polypeptide sequence having at least 70% identity to positions 35-89 of SEQ ID NO:8, provided that the amino acid residues at position 36 and position 83 are hotspot amino acid residues. [0258] 10. The TRPV1 allosteric modulator of embodiment 9, wherein the hotspot amino residues are phenylalanine residues. [0259] 11. The TRPV1 allosteric modulator of embodiment 9 or embodiment 10, comprising a polypeptide sequence having at least 95% identity to positions 35-89 of SEQ ID NO:8, provided that the amino acid residues at position 36 and position 83 are hotspot phenylalanine residues. [0260] 12. The TRPV1 allosteric modulator of any one of embodiments 9-11, comprising a polypeptide sequence having at least 70% identity to SEQ ID NO:8 provided that the amino acid residues at position 36 and position 83 are hotspot amino acid residues. [0261] 13. The TRPV1 allosteric modulator of embodiment 12, comprising a polypeptide sequence having at least 90% identity to SEQ ID NO:8 provided that the amino acid residues at position 36 and position 83 are hotspot phenylalanine residues. [0262] 14. The TRPV1 allosteric modulator of any one of embodiments 1, 12, and 13, wherein: [0263] the peptide comprises a helix.sup.1-loop-strand.sup.1-helix.sup.2-turn-helix.sup.3-strand.sup.2-helix.sup.4 architecture, [0264] strand.sup.1 and strand.sup.2 and folded in a parallel ? sheet, and [0265] the hotspot amino acid residues are phenylalanine residues located in helix.sup.2 and helix.sup.4. [0266] 15. The TRPV1 allosteric modulator of any one of embodiments 1-14, further comprising a cell penetration peptide sequence. [0267] 16. The TRPV1 allosteric modulator of embodiment 15, wherein the cell penetration peptide sequence is an HIV-1 tat protein sequence. [0268] 17. A TRPV1 allosteric modulator prepared by process comprising: [0269] i) assessing shape complementarity, binding energy, and solvent accessible surface area of a candidate peptide upon docking to a surface of a TRPV1 ankyrin repeat domain (ARD) in silico; [0270] ii) assessing ab initio refolding of the candidate peptide: [0271] iii) evolving the candidate peptide via in silico affinity maturation to define a mature allosteric modulator: [0272] iv) expressing or synthesizing the mature allosteric modulator, thereby preparing the TRPV1 allosteric modulator. [0273] 18. The TRPV1 allosteric modulator of embodiment 17, wherein the process further comprises: [0274] i-a) docking a surface of a peptide scaffold to a surface of the ARD to define a surface interface; [0275] wherein the peptide scaffold comprises one or more ARD-binding hotspot amino acid residues and a plurality of non-hotspot amino acid residues; [0276] i-b) fixing the hotspot amino acid residues to a target location on the surface of the TRPV1 ARD; [0277] i-c) substituting at least one non-hotspot residue with another amino acid residue to define the candidate peptide. [0278] 19. The TRPV1 allosteric modulator of embodiment 18, wherein the hotspot amino acid residues are phenylalanine residues. [0279] 20. The TRPV1 allosteric modulator of embodiment 18 or embodiment 19, wherein the target location on the surface of the TRPV1 ARD is located on the concave surface formed by the 2nd and 3rd fingers of the ARD. [0280] 21. The TRPV1 allosteric modulator of any one of embodiments 18-20, wherein the peptide scaffold is characterized by one or more properties selected from the group consisting of: [0281] an X-ray crystal structure determined at a resolution of at least 2.5 ?; [0282] an absence of DNA, RNA, or disulfide bonds in the X-ray crystal structure; [0283] an absence of ligands or cofactors in the X-ray crystal structure; [0284] no more than 100 amino acid residues in the primary amino acid sequence; [0285] no more than one polypeptide chain; [0286] monomeric stoichiometry; and [0287] previous expression in E. coli reported. [0288] 22. The TRPV1 allosteric modulator of any one of embodiments 18-21, wherein: [0289] the peptide scaffold comprises a helix.sup.1-loop-strand.sup.1-helix.sup.2-turn-helix.sup.3-strand.sup.2-helix.sup.4 architecture, [0290] strand.sup.1 and strand.sup.2 and folded in a parallel ? sheet, and [0291] the hotspot amino acid residues are phenylalanine residues located in helix.sup.2 and helix.sup.4. [0292] 23. The TRPV1 allosteric modulator of any one of embodiments 18-21, wherein: [0293] the peptide scaffold comprises a helix.sup.1-loop-helix.sup.2-loop-helix.sup.3 architecture, [0294] helix.sup.1, helix.sup.2, and helix.sup.3 are folded in a three-helix bundle, and [0295] the hotspot amino acid residues are phenylalanine residues located in helix.sup.3. [0296] 24. A TRPV1 allosteric modulator comprising a polypeptide sequence having at least 70% identity to positions 64-94 of SEQ ID NO:9, provided that the amino acid residues at position 72 and position 76 are aromatic amino acid residues. [0297] 25. The TRPV1 allosteric modulator of embodiment 24, wherein the aromatic amino residues are phenylalanine residues. [0298] 26. The TRPV1 allosteric modulator of embodiment 24 or embodiment 25, comprising a polypeptide sequence having at least 95% identity to positions 64-94 of SEQ ID NO:9, provided that the amino acid residues at position 72 and position 76 are phenylalanine residues. [0299] 27. The TRPV1 allosteric modulator of any one of embodiments 24-26, comprising a polypeptide sequence having at least 70% identity to SEQ ID NO:9 provided that the amino acid residues at position 72 and position 76 are aromatic amino acid residues. [0300] 28. The TRPV1 allosteric modulator of embodiment 27, wherein the aromatic amino residues are phenylalanine residues. [0301] 29. The TRPV1 allosteric modulator of embodiment 28, comprising a polypeptide sequence having at least 90% identity to SEQ ID NO:9 provided that the amino acid residues at position 72 and position 76 are phenylalanine residues. [0302] 30. A TRPV1 allosteric modulator comprising a polypeptide sequence having at least 70% identity to positions 35-89 of SEQ ID NO:8, provided that the amino acid residues at position 36 and position 83 are aromatic amino acid residues. [0303] 31. The TRPV1 allosteric modulator of embodiment 30, wherein the aromatic amino residues are phenylalanine residues. [0304] 32. The TRPV1 allosteric modulator of embodiment 30 or embodiment 31, comprising a polypeptide sequence having at least 95% identity to positions 35-89 of SEQ ID NO:8, provided that the amino acid residues at position 36 and position 83 are hotspot phenylalanine residues. [0305] 33. The TRPV1 allosteric modulator of any one of embodiments 30-32, comprising a polypeptide sequence having at least 70% identity to SEQ ID NO:8 provided that the amino acid residues at position 36 and position 83 are aromatic amino acid residues. [0306] 34. The TRPV1 allosteric modulator of embodiment 33, comprising a polypeptide sequence having at least 90% identity to SEQ ID NO:8 provided that the amino acid residues at position 36 and position 83 are phenylalanine residues. [0307] 35. A nucleic acid comprising a polynucleotide sequence encoding a TRPV1 allosteric modulator according to any one of embodiments 1-34. [0308] 36. An expression cassette comprising the nucleic acid of embodiment 35. [0309] 37. A recombinant cell comprising the nucleic acid of embodiment 35 or the expression cassette of embodiment 36. [0310] 38. A pharmaceutical composition comprising a TRPV1 allosteric modulator according to any one of embodiments 1-34 or the nucleic acid of embodiment 35 and a pharmaceutically acceptable excipient. [0311] 39. A method for treating a condition associated with TRPV1 activity, the method comprising administering an effective amount of a TRPV1 allosteric modulator according to any one of embodiments 1-34 or an effective amount of a pharmaceutical composition of embodiment 38 to a subject in need thereof. [0312] 40. The method of embodiment 39, wherein the condition is selected from the group consisting of pain, pruritus, and cancer. [0313] 41. The method of embodiment 39, wherein the pain comprises chronic pain or acute pain. [0314] 42. The method of embodiment 40 or embodiment 41, wherein the pain comprises neuropathic pain, inflammatory pain, cancer pain, or a combination thereof. [0315] 43. The method of any one of embodiments 39-42, further comprising administering; a non-steroidal anti-inflammatory agent, an opioid analgesic, acetaminophen, or a combination thereof. [0316] 44. The method of embodiment 40, wherein the pruritus comprises histamine-induced itching, lymphoma-induced itching, allergic itching, infection-induced itching, liver- or kidney-induced itching, diabetes-induced itching, skin disorder-induced itching, opioid-induced itching, or a combination thereof. [0317] 45. The method of any one of embodiments, 39, 40, and 44, further comprising administering an antihistamine, a steroid, an anesthetic, or a combination thereof to the subject. [0318] 46. The method of embodiment 40, wherein the cancer is breast cancer, squamous cell carcinoma, hepatocellular carcinoma, or carcinoma of the bladder. [0319] 47. The method of any one of embodiments 39, 40, and 46, further comprising administering an anti-cancer agent to the subject.
[0320] Although the foregoing has been described in some detail by way of illustration and example for purposes of clarity and understanding, one of skill in the art will appreciate that certain changes and modifications can be practiced within the scope of the appended claims. In addition, each reference provided herein is incorporated by reference in its entirety to the same extent as if each reference was individually incorporated by reference.
TABLE-US-00013 INFORMALSEQUENCELISTING SEQIDNO:1 SGYTEDEKLNIAKRHLLPKQIERNALKKGELTVDDSAIIGIIRYYTREAGVRGLEREISKLCRK AVKQLLLDKSLKHIEINGDNLHDYLGVQRF SEQIDNO:2 SLLISYESDFKTTLEQAKASLAEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVEVNNSIGD ASERATYKAKLREWKKTIQSDIKRPLQSLVDSGD SEQIDNO:3 MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDV DECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI SEQIDNO:4 GHMIKGEQKRYSEMTKEELQQEIAMLTEKARKAEQMGMVNEYAVYERKIAMAKAYMLNP ADFHPGEIYEIEGAPGEYFKVRYLKGVFAWGWRLKGNGEEEALPISLLRKPNLPQS SEQIDNO:5 MIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQELSPSS SVVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ SEQIDNO:6 MDETGKELVLVLYDYQEKSPRELTVKKGDILTLLNSTNKDWWKIEVNGRQGFVPAAYLKKLD SEQIDNO:7 MGKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAE DQKRYERELSEMRAPPAATNSSKKLE SEQIDNO:8(De1) NGYSSEDKLRIAKRHLLPKQIERNALKKGELFVSEFAILGIILFYTDEAGVRGLEREISKLCRKA VKQLLLDKSTTSSHASGFHLHDYLGVMR SEQIDNO:9(De3) SLLDSYKLDFWKTSTNAENSLHEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVEVNNSIG RDADRRWYLFELWFWKISIEEEIKRPLQSLVDSG SEQIDNO:10(15237) SLLDSYKLDFWKTSTNAENSLHEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVE VNNSIGRDADRRWYLFELWFWKISIEEEIKRPLQSLVDSG SEQIDNO:11(15237_2nd_0086) SLLISYRDDFFTTFWQATQSLKEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVEV NNSIGSLASKFAYKFLLDEWKDDIQRDIKRPLQSLVDSG SEQIDNO:12(5132) MVYQAKDFADLFGQAANASGKLIVTVLFATWCGPCKMISPKLVELSTQFADNVVVI KVKALKFEEFARDNNLSSMPVLVFWKNGDEVESFAGANAKRLEDVIKAN SEQIDNO:13(11577) EQKRYSEMTKEELQQEIAMLTEKARKAEQMGMVNEYAVYERKIAMAKAYMLNPA DFHPGEIYEIEGAPGEYFKVRYLKGVFAWGWRLKGNGEEEALPISLLRK SEQIDNO:14(2824) NGYSSEDKLRIAKRHLLPKQIERNALKKGELFVSEFAILGIILFYTDEAGVRGLEREISK LCRKAVKQLLLDKSTTSSHASGFHLHDYLGVMR SEQIDNO:15(926) MIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQ ELSPSSSVVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPP QSW SEQIDNO:16(15080) KELVLVLEEFKSHAPRSLKVKKGDILTILNDDDFSNAKIEVNGRQGFVPLFFAHRI SEQIDNO:17(15080_cst) KLLVLVYDYYSATAPRELTVKKGDILTLLNADLMFYLKIEVNGRQGFVPAFFALWM SEQIDNO:18(8320_2nd_0141) LPESPKRAEEIWQQSVIGDYLARFKNDRDRAYASMEFHWRFMSEDLKLMWIKKAAE DQKRYEREL SEQIDNO:19 RKKRRQRRR SEQIDNO:20 YGRKKRRQRRRA SEQIDNO:21 GRKKRRQRRRPPQ SEQIDNO:22 RQIKIWFQNRRMKWKK SEQIDNO:23 VKRGLKLRHVRPRVTRMDV SEQIDNO:24 GALFLGFLGAAGSTMGAWSQPKKKRKV SEQIDNO:25 KETWWETWWTEWSQPKKKRKV SEQIDNO:26 LLIILRRRIRKQAHAHSK SEQIDNO:27 MVRRFLVTLRIRRACGPPRVRV SEQIDNO:28 MVKSKIGSWILVLFVAMWSDVGLCKKRP SEQIDNO:29 KLALKLALKALKAALKLA SEQIDNO:30 GWTLNSAGYLLGKINLKALAALAKKIL SEQIDNO:31 LSTAADMQGVVTDGMASGLDKDYLKPDD SEQIDNO:32 DPKGDPKGVTVTVTVTVTGKGDPKPD SEQIDNO:33 RRIRPRPPRLPRPRPRPLPFPRPG SEQIDNO:34 CSIPPEVKFNKPFVYLI SEQIDNO:35 PFVYLI SEQIDNO:36 SDLWEMMMVSLACQY SEQIDNO:37 NGYWSEDKERIAKRHLLPKQIERNALKKGELKVWEFAIFGIILFYTWEAGVRGLEREI SKLCRKAVKQLLLDKSTTRSWASGFHLHDYLGVMR SEQIDNO:38 LPESPRFAQKIWQQSVIGDYLARFKNDRVKALKAMEDSSNNSSMHRFAEFFAKAFED LHRYLEEL SEQIDNO:39 MSVSAGEKPPRLYDRRSIFDAVAQSNCQELESLLPFLQRSKKRLTDSEFKDPETGKTC LLKAMLNLHNGQNDTIALLLDVARKTDSLKQFVNASYTDSYYKGQTALHIAIERRN MTLVTLLVENGADVQAAANGDFFKKTKGRPGFYFGELPLSLAACTNQLAIVKFLLQ NSWQPADISARDSVGNTVLHALVEVADNTVDNTKFVTSMYNEILILGAKLHPTLKLE EITNRKGLTPLALAASSGKIGVLAYILQREIHEPECRHAAAHHHHHH SEQIDNO:40 LYDRRSIFDAVAQSNCQELESLLPFLQRSKKRLTDSEFKDPETGKTCLLKAMLNLHN GQNDTIALLLDVARKTDSLKQFVNASYTDSYYKGQTALHIAIERRNMTLVTLLVENG ADVQAAANGDFFKKTKGRPGFYFGELPLSLAACTNQLAIVKFLLQNSWQPADISARD SVGNTVLHALVEVADNTVDNTKFVTSMYNEILILGAKLHPTLKLEEITNRKGLTPLA LAASSGKIGVLAYILQREIH