Treatment of mucopolysaccharidosis II with recombinant human iduronate-2-sulfatase (IDS)

11986515 ยท 2024-05-21

Assignee

Inventors

Cpc classification

International classification

Abstract

Compositions and methods are described for the delivery of recombinant human iduronate-2-sulfatase (IDS) produced by human neuronal or glial cells to the cerebrospinal fluid of the central nervous system (CNS) of a human subject diagnosed with mucopolysaccharidosis II (MPS II).

Claims

1. A method of treating mucopolysaccharidosis II (MPS II) in a human subject, the method comprising: a) measuring the level of D2S6 present in a biological sample obtained from the human subject; b) diagnosing the human subject with MPS II when the level of D2S6 in the biological sample is higher than a reference; and c) delivering an effective amount of an active human iduronate-2-sulfatase (hIDS) to the central nervous system (CNS) of the human subject diagnosed with MPS II, wherein the method further comprises calculating a ratio of D2S6 to total heparan sulfate disaccharides (HS) in the biological sample, wherein the total HS comprises disaccharides D2S6, D0A0, D0S0, and D0A6.

2. The method of claim 1, wherein the human subject is determined to be responsive to the active hIDS treatment if the D2S6 level is at least 20% of the total HS.

3. The method of claim 1, wherein the active hIDS is delivered to the CNS by administering an adeno-associated virus (AAV) vector comprising a nucleotide sequence encoding hIDS to the human subject.

4. The method of claim 1, wherein the active hIDS is delivered to the CNS by administering an enzyme replacement therapy with recombinant hIDS to the human subject.

5. The method of claim 1, wherein the delivering step c is performed via a viral vector, liposome, a lipid-containing complex, a macromolecular complex, a synthetic modified mRNA, an unmodified mRNA, a small molecule, a non-biologically active molecule, a polymerized molecule, a naked DNA, a plasmid, a phage, a transposon, a cosmid, or an episome.

6. The method of claim 1, wherein the active hIDS is delivered to the CNS via intrathecal, intracisternal (IC), intravenous, or intracerebroventricular (ICV) administration.

7. The method of claim 1, wherein the biological sample is obtained from the cerebrospinal fluid (CSF) of the human subject.

8. The method of claim 1, wherein the reference is the level of D2S6 in a CSF sample obtained from a human subject with attenuated MPS II.

9. The method of claim 1, wherein the method further comprises monitoring the level of D2S6 present in a biological sample obtained from the human subject after the delivering step c, wherein a decrease in the level of D2S6 compared to the level of D2S6 measured in step a is indicative of treatment.

10. The method of claim 9, wherein the biological sample obtained after the delivering step c is obtained from the human subject after about 1, 2, 3, 4, 5, 6, 7, 8, 10, 16, 20, 24, 30, 35, 40, 45, 48, 50, 52, or 56 weeks, or 1, 2, 3, 4, 5, or 6 months after the delivering step c.

11. The method of claim 9, wherein the decrease in the level of D2S6 after delivering step c is about or at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, or 90%, as compared to the level of D2S6 measured in step a.

12. The method of claim 1, wherein the level of D2S6 is higher by about or at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% than the reference.

13. A method of treating mucopolysaccharidosis II (MPS II) in a human subject, the method comprising delivering an effective amount of an active human iduronate-2-sulfatase (hIDS) to the central nervous system (CNS) of the human subject diagnosed with MPS II and measuring the level of D2S6 present in a biological sample obtained from the human subject after the active hIDS has been delivered to the CNS of the human subject.

14. The method of claim 13, wherein the active hIDS is delivered to the CNS by administering an adeno-associated virus (AAV) vector comprising a nucleotide sequence encoding hIDS to the human subject.

15. The method of claim 14, wherein the active hIDS is delivered to the CNS via intracisternal (IC) or intracerebroventricular (ICV) administration.

16. The method of claim 14, wherein the active hIDS is delivered to the CNS via intravenous, intracisternal (IC), or intracerebroventricular (ICV) administration.

17. The method of claim 13, wherein the active hIDS is delivered to the CNS by administering an enzyme replacement therapy with recombinant hIDS to the human subject.

18. The method of claim 17, wherein the active hIDS is delivered to the CNS via intrathecal, intracisternal (IC), intracerebroventricular (ICV), or intravenous administration.

19. The method of claim 13, wherein the biological sample is obtained from the cerebrospinal fluid (CSF) of the human subject.

20. The method of claim 13, wherein the human subject has neuronopathic MPS II.

21. The method of claim 20, wherein the level of D2S6 in the human subject after treatment with the active hIDS is in the attenuated range.

22. The method of claim 13, wherein the method further comprises monitoring the level of D2S6 present in a biological sample obtained from the human subject at more than one time after delivering the active hIDS to the human subject, wherein a decrease in the level of D2S6 over time is indicative of treatment.

23. The method of claim 22, wherein the level of D2S6 in the human subject after treatment with the active hIDS is decreased into the attenuated range.

24. The method of claim 22, wherein the biological sample is obtained from the human subject after about 1, 2, 3, 4, 5, 6, 7, 8, 10, 16, 20, 24, 30, 35, 40, 45, 48, 50, 52, or 56 weeks, or 1, 2, 3, 4, 5, or 6 months after delivering the active hIDS to the human subject.

25. A method of treating mucopolysaccharidosis II (MPS II) in a human subject, the method comprising delivering an effective amount of an active human iduronate-2-sulfatase (hIDS) to the central nervous system (CNS) of the human subject diagnosed with MPS II and measuring the level of D2S6 present in a biological sample obtained from the human subject, wherein the method comprises measuring the level of D2S6 present in a first biological sample obtained from the human subject before delivering the active hIDS to the human subject and measuring the level of D2S6 present in a second biological sample obtained from the human subject after delivering the active hIDS to the human subject, and wherein the first and second biological samples are obtained from the cerebrospinal fluid (CSF) of the human subject.

26. The method of claim 13, wherein the human subject is an adult human subject.

27. The method of claim 13, wherein the human subject is younger than 18 years old.

28. The method of claim 13, wherein the human subject is 5 years old or older and younger than 18 years old.

29. The method of claim 13, wherein the human subject is 4 months old or older and younger than 5 years old.

30. The method of claim 25, wherein the decrease in the level of D2S6 after delivering the active hIDS to the human subject is about or at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, or 90%, as compared to the first level of D2S6.

Description

4. BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1. The amino acid sequence of human IDS (SEQ ID NO: 1). A post-translational formylglycine modification of C.sup.84 (shown in bold in FIG. 1) is required for enzyme activity. Eight N linked glycosylation sites (N.sup.31, N.sup.115, N.sup.144, N.sup.246, N.sup.280, N.sup.325, N.sup.513 and N.sup.537) are bold and boxed. One tyrosine-O-sulfation site (Y) is bold and the full sulfation site sequence (PSSEKY.sup.165ENTKTCRGPD (SEQ ID NO:47)) is boxed. The N-terminus of the mature 42 kDa and mature 14 kDa polypeptides are indicated by horizontal arrows. In the brain, the N-terminus of the mature 42 kDa form starts at positions 34 or 36 as follows: T.sup.34DALNVLLI (SEQ ID NO: 54); and A.sup.36LNVLLIIV (SEQ ID NO: 55) as indicated in FIG. 1. (See, Sleat, 2005, Proteomics 5: 1520-1532, Table S2). Two of the eight N-linked glycosylation sites, namely N.sup.280 and N.sup.116, are mannose-6-phophorylated in IDS obtained from human brain. (Sleat et al., 2006, Mol & Cell Procomics 5.4: 686-701, reported at Table V).

(2) FIG. 2. Multiple sequence alignment of hIDS with known orthologs. The names of the species and protein IDs are as follows. SP|P22304|IDS_HUMAN [Homo sapiens]; TR|K6ZGI9_PANTR [Pan troglodytes (Chimpanzee)]; TR|K7BKV4_PANTR [Pan troglodytes (Chimpanzee)]; TR|H9FTX2_MACMU [Macaca mulatta (Rhesus macaque)]; TRF7EJG2_CALJA [Callithrix jacchus (White-tufted-ear marmoset)]; TR|U3DTL8_CALJA [Callithrix jacchus (White-tufted-ear marmoset)]; TRIG7NRX7_MACMU [Macaca mulatta (Rhesus macaque)]; TR|G7QIV9 MACFA [Macaca fascicularis (Crab-eating macaque; Cynomologous monkey)]; TR|H2PX10_PONAB [Pongo abelii (Sumatran orangutan)]; TR|A0A0D9R4D1_CHLSB [Chlorocebus sabaeus (Green monkey)]; TR|G1RST8|G1RST8_NOMLE [Nomascus leucogenys (Northern white-cheeked gibbon)]; UPI0000D9F625 [Macaca mulatta (Rhesus macaque)]; UPI000274358B [Pan paniscus (Pygmy chimpanzee; Bonobo)]; UPI00027F6FC5 [Papio Anubis (Olive baboon)]; UPI00027FAE03 [Saimiri boliviensis (Bolivian squirrel monkey)]; UPO0003ABBF28 [Macaca fascicularis (Crab-eating macaque; Cynomologous monkey)]: UPI000533297F [Rhinopithecus roxellana (Golden snub-nosed monkey; Pygathrix roxellana)]; UPI0005F40BD2 [Colobus angolensis palliates (Peters' Angolan colobus)] (SEQ ID NOs: 27-44).

(3) FIG. 3. MPS 11 mutations in hIDS and corresponding disease phenotypes, mild, intermediate or severe. (from Uniprot).

(4) FIG. 4. Human IDS processing as reported in Millat et al., 1997, Exp. Cell. Res. 230. 362-367, at FIG. 7.

(5) FIG. 5. Schematic Representation of Construct 1.

(6) FIG. 6. Clustal Multiple Sequence Alignment of AAV capsids 1-9 (SEQ ID NOs: 16-26). Amino acid substitutions (shown in bold in the bottom rows) can be made to AAV9 and AAV8 capsids by recruiting amino acid residues from the corresponding position of other aligned AAV capsids. Sequence regions designated by HVR=hypervariable regions.

(7) FIG. 7. Heparan Sulfate (HS) digestion with Heparinase.

(8) FIG. 8. Graph showing cerebral spinal fluid (CSF) heparan sulfate biomarker (ng/mL). Graph showed consistent HS decrease in the CSF after Construct 1 dosing. The median change from baseline at week 8 (N=6) was ?30.3% (p-value=0.03 as measured by Wilcoxon signed rank test). The median change from baseline at the last available timepoint (N=6) was ?35.8% (p-value=0.03 as measured by Wilcoxon signed rank test). The graph showed measurable CSF I2S enzyme concentration in cohort 2 after Construct 1 administration with a range of 1170-1940 pg/mL.

(9) FIG. 9. Graph showing cerebral spinal fluid (CSF) D2S6 biomarker (ng/mL). The median change from baseline at week 8 (N=6) was ?44.2% (p-value=0.03 as measured by Wilcoxon signed rank test). The median change from baseline at the last available timepoint (N=6) was ?39.2% (p-value=0.03 as measured by Wilcoxon signed rank test).

(10) FIGS. 10A-10C. Graphs showing neurodevelopment function comparing age equivalence (months) and age (months). The Graph in FIG. 10A showed continued cognitive development in 4 of 5 patients with >6 months of follow-up. Patients 1, 3, and 5 demonstrated continued cognitive development within a normal range. Patients 2 and 4 presented with significant cognitive delay at baseline. Patient 2 has continued cognitive development. Patient 4 acquired expressive and receptive language skills. FIGS. 10B and 10C show cognitive developmental quotient and age equivalence quotient, respectively, of patients in Construct 1 gene therapy clinical trial. The graphs in FIGS. 10B and 10C show that 3 out of 4 patients who entered the study with cognitive skill above the ?2SD of the normal range continued to stay above ?2SD as of >6-month follow-up. One patient entered the study with significant delay in neurocognitive development at baseline but demonstrated relative stabilization following Construct 1 administration at an older age (59 months) and continued to acquire expressive and receptive language skills.

(11) FIGS. 11A-11D. Graphs showing neurodevelopment function in terms of language and motor skills. FIG. 11A displays expressive communication; FIG. 11B displays receptive communication; FIG. 11C displays gross motor skills; and FIG. 11D displays fine motor skills. Graphs showed continued language and/or motor skills acquisition in patients with >6 months of follow-up.

(12) FIG. 12. Graph showing systemic efficacy by measuring plasma I2S protein concentration (?g/mL). The graph shows a general increase in plasma I2S enzyme levels in 5 out of 6 patients after Construct 1 administration (normal range (14,706 pg/mL?<100,000 pg/mL)).

(13) FIG. 13. Graph showing systemic efficacy by measuring urine total GAGs level (g/mol CK) in ERT-treated patients. Graph showed sustained decrease in urine GAG levels across all patients receiving ERT.

(14) FIG. 14. Graph showing systemic efficacy by measuring urine total GAGs level (g/mol CK) in ERT na?ve and ERT discontinued patients. Graphs showed a rapid decrease in urine GAGs in ERT-na?ve patients after Construct 1 administration (absence of urine GAG rebound post ERT withdrawal).

(15) FIG. 15. Ultrasound of liver or spleen in ERT na?ve patient. Liver and spleen dimensions in ERT-na?ve patient decreased 24 weeks after Construct 1 administration.

(16) FIG. 16. Proof-of-concept Study Activities.

(17) FIG. 17. Dose Rationale for the First-in-Human Clinical Trial.

(18) FIG. 18. Total heparan sulfate in CSF samples from healthy subjects, MPS I (neuronopathic and non-neuronopathic) subjects, and MPS II (neuronopathic and non-neuronopathic) subjects.

(19) FIGS. 19A-19C. Graphs showing the level of D0S0 disaccharide (FIG. 19A), D0A6 disaccharide (FIG. 19B), and D0A0 (FIG. 19C) in healthy subjects, MPS I (neuronopathic and non-neuronopathic) subjects, and MPS II (neuronopathic and non-neuronopathic) subjects.

(20) FIG. 20. Graph showing the level of D2S6 disaccharide in healthy subjects, MPS I (neuronopathic and non-neuronopathic) subjects, and MPS II (neuronopathic and non-neuronopathic) subjects.

(21) FIG. 21. Graph showing the percent composition of heparan sulfate disaccharides in healthy subjects, MPS I (neuronopathic and non-neuronopathic) subjects, and MPS II (neuronopathic and non-neuronopathic) subjects.

(22) FIG. 22. Diagram showing MPS II phase 1/2 clinical study summary.

(23) FIG. 23. Graphs showing widespread CNS and systemic biodistribution after Construct 1 IC administration in non-human. The term LD is low dose, IS is immunosuppression, and HD is high dose.

(24) FIGS. 24A-24B. Graphs showing cerebral spinal fluid (CSF) Biomarker Heparan Sulfate (HS) in subjects in the Phase 1/2 study. CSF HS measurements showed dose-dependent reductions in Cohorts 1-3 at Weeks 8 and 24.

(25) FIGS. 25A-25B. Graphs showing concentration of D2S6 in patients in Phase 1/2 study. CSF D2S6 measurement showed dose-dependent reductions in Cohorts 1-3 at Week 8 and 24, with Cohort 3 participants approaching normal levels.

(26) FIGS. 26A-26C. Graphs showing cognition, expressive language, and fine motor neurodevelopmental function for cohort 1 patients in Phase 1/2 study.

(27) FIGS. 27A-27C. Graphs showing cognition, expressive language, and fine motor neurodevelopmental function for cohort 2 patients in Phase 1/2 study.

(28) FIGS. 28A-28B. Graphs showing maladaptive behavior index and toileting skills for patients in Phase 1/2 study.

(29) FIGS. 29A-29B. Graphs showing plasma I2S protein levels and urine GAG levels in patients in Phase 1/2 study.

(30) FIG. 30. Diagram showing MPS I phase 1/2 clinical study summary.

(31) FIGS. 31A-31B. Graphs showing concentration of cerebral spinal fluid (CSF) biomarker and heparin sulfate in participants in the MPS I Phase 1/2 study (FIG. 31A) and in a single participant (FIG. 31B). Graphs show a decrease in CSF heparin sulfate in all participants through last time point available (e.g., week 24 for Phase 1/2 trial (FIG. 31A) and week 59 for the single participant (FIG. 31B). Study showed a measurable CSF IDUA enzyme activity in the majority of participants in the Phase 1/2 trial and in the single participant.

(32) FIGS. 32A-32F. Graphs showing neurodevelopment function BSID-III as cognition, expressive language, and fine motor in MPS I Phase 1/2 study and the single participant study.

(33) FIG. 33. Graph showing neurodevelopmental function BSID cognition in the MPS I single participant study.

(34) FIG. 34. Tables showing the neurodevelopmental function (WASI-II and VABS-III) for a 13 year-old MPS I Phase 1/2 study participant.

(35) FIGS. 35A-35B. Graphs showing level of I0S6 in MPS I Phase 1/2 participants (FIG. 35A) and in the single participant study (FIG. 35B).

(36) FIGS. 36A-36B. Graphs showing level of total urine GAGs in MPS I Phase 1/2 participants (FIG. 36A) and in the single participant study (FIG. 36B).

5. DETAILED DESCRIPTION OF THE INVENTION

(37) The invention involves the delivery of recombinant human iduronate-2-sulfatase (rhIDS) produced by human neuronal or glial cells to the cerebrospinal fluid (CSF) of the central nervous system (CNS) of a human subject diagnosed with mucopolysaccharidosis II (MPS II), including, but not limited to patients diagnosed with Hunter syndrome. See, also, International Patent Application No. PCT/US2017/027770, filed Apr. 14, 2017 (published as WO/2017/181113 on Oct. 19, 2017), which is incorporated by reference herein in its entirety, for compositions and methods that can be used according to the invention described herein.

(38) In a preferred embodiment, the treatment is accomplished via gene therapye.g., by administering a viral vector or other DNA expression construct encoding human IDS (hIDS), or a derivative of hIDS, to the CSF of a patient (human subject) diagnosed with MPS II, so that a permanent depot of transduced neuronal and/or glial cells is generated that continuously supplies the transgene product to the CNS. The rhIDS secreted from the neuronal/glial cell depot into the CSF will be endocytosed by cells in the CNS, resulting in cross-correction of the enzymatic defect in the recipient cells. Moreover, it has been found, unexpectedly, that the depot of transduced neural and glial cells in the CNS can deliver the recombinant enzyme to both the CNS and systemically, which may reduce or eliminate the need for systemic treatment, e.g., weekly i.v. injections of the enzyme. Also provided herein is the treatment of MPS I by administering a viral vector or other DNA expression construct encoding human IDUA to a subject (e.g., non-replicating recombinant AAV of serotype 9 capsid containing an hIDUA expression cassette; Construct 2; refer to PCT/US2021/014129; PCT/US2018/015910; and PCT/US2019/042205, each of which is incorporated by reference herein in its entirety).

(39) In an alternative embodiment, the hIDS can be produced by human neuronal or glial cells in cell culture (e.g., bioreactors) and administered as an enzyme replacement therapy (ERT), e.g., by injecting the enzymeinto the CSF, directly into the CNS, and/or systemically. However, the gene therapy approach offers several advantages over ERT since systemic delivery of the enzyme will not result in treating the CNS because the enzyme cannot cross the blood brain barrier; and, unlike the gene therapy approach of the invention, direct delivery of the enzyme to the CSF and/or CNS would require repeat injections which are not only burdensome, but pose a risk of infection.

(40) The hIDS encoded by the transgene can include, but is not limited to human IDS (hIDS) having the amino acid sequence of SEQ ID NO. 1 (as shown in FIG. 1), and derivatives of hIDS having amino acid substitutions, deletions, or additions, e.g., including but not limited to amino acid substitutions selected from corresponding non-conserved residues in orthologs of IDS shown in FIG. 2, with the proviso that such mutations do not include replacement of the cysteine residue at position 84 (C84) which is required for enzyme activity (Millat et al., 1997, Biochem J 326: 243-247); or a mutation that has been identified in severe, severe-intermediate, intermediate, or attenuated MPS II phenotypes e.g., as shown in FIG. 3, or as reported by Sukegawa-Hayasaka et al., 2006, J Inhert Metab Dis 29: 755-761 (reporting attenuated mutants R48P, A85T, W337R, and the truncated mutant Q531X; and severe mutants P86L, S333L, S349I, R468Q, R468L); Millat et al., 1998, BBA 1406: 214-218 (reporting attenuated mutants P480L and P480Q; and severe mutant P86L); and Bonucelli et al., 2001, BBA 1537:233-238, each of which is incorporated by reference herein in its entirety.

(41) For example, amino acid substitutions at a particular position of hIDS can be selected from among corresponding non-conserved amino acid residues found at that position in the IDS orthologs aligned in FIG. 2, with the proviso that such substitutions do not include any of the deleterious mutations shown in FIG. 3 or as reported by Sukegawa-Hayasaka et al., 2006, supra; Millat et al., 1998, supra; or Bonucelli et al., 2001, supra, each of which is incorporated by reference herein in its entirety. The resulting transgene product can be tested using conventional assays in vitro, in cell culture or test animals to ensure that the mutation does not disrupt IDS function. Preferred amino acid substitutions, deletions or additions selected should be those that maintain or increase enzyme activity, stability or half-life of IDS, as tested by conventional assays in vitro, in cell culture or animal models for MPS II. For example, the enzyme activity of the transgene product can be assessed using a conventional enzyme assay with, for example, 4-Methylumbelliferyl ?-L-idopyranosiduronic acid 2-sulfate or 4-methylumbelliferyl sulfate as the substrate (see, e.g., Lee et al., 2015, Clin. Biochem. 48(18):1350-1353, Dean et al., 2006, Clin. Chem. 52(4):643-649 for exemplary IDS enzyme assays that can be used, each of which is incorporated by reference herein in its entirety). The ability of the transgene product to correct MPS II phenotype can be assessed in cell culture; e.g., by transducing MPS II cells in culture with a viral vector or other DNA expression construct encoding hIDS or a derivative; by adding the transgene product or a derivative to MPS II cells in culture; or by co-culturing MPS II cells with human neuronal/glial host cells engineered to express and secrete rhIDS or a derivative, and determining correction of the defect in the MPS 11 cultured cells, e.g., by detecting IDS enzyme activity and/or reduction in GAG storage in the MPS II cells in culture (see, e.g., Stroncek et al., 1999, Transfusion 39(4):343-350, which is incorporated by reference herein in its entirety).

(42) Animal models for MPS II have been described that can be used to assess the therapeutics described herein. For example, a knockout mouse model (IDS-knockout) of MPS II was engineered by replacing exons 4 and 5 of the IDS gene with the neomycin resistance gene. (Garcia et al., 2007, J Inherit Metab Dis 30: 924-34). This IDS-knockout mouse exhibits many of the characteristics of MPS IL, including skeletal abnormalities, hepatosplenomegaly, elevated urinary and tissue GAG, and brain storage lesions (Muenzer et al., 2001, Acta Paediatr Suppl 91:98-99) and was used to assess the effect of enzyme replacement therapy in MPS II in support of clinical trials for ERT. This mouse model, therefore, is a relevant model for studying the effects of gene therapy delivering rdDS produced by neuronal or glial cells as a treatment for MPS II (see, e.g., Polito and Cosma, 2009, Am. J. Hum. Genet. 85(2):296-301, which is incorporated by reference herein in its entirety).

(43) Preferably, the hIDS transgene produced by the human neuronal/glial cells should be controlled by expression control elements that function in neurons and/or glial cells, e.g., the CB7 promoter (a chicken ?-actin promoter and CMV enhancer), and can include other expression control elements that enhance expression of the transgene driven by the vector (e.g., chicken ?-actin intron and rabbit ?-globin poly A signal). The cDNA construct for the hIDS transgene should include a coding sequence for a signal peptide that ensures proper co- and post-translational processing (glycosylation and protein sulfation) by the transduced CNS cells. Such signal peptides used by CNS cells may include but are not limited to:

(44) Oligodendrocyte-myelin glycoprotein (hOMG) signal peptide:

(45) TABLE-US-00011 (SEQIDNO:2) MEYQILKMSLCLFILLFLTPGILC

(46) Cellular repressor of E1A-stimulated genes 2 (hCREG2) signal peptide:

(47) TABLE-US-00012 (SEQIDNO:3) MSVRRGRRPARPGTRLSWLLCCSALLSPAAG

(48) V-set and transmembrane domain containing 2B (hVSTM2B) signal peptide:

(49) TABLE-US-00013 (SEQIDNO:4) MEQRNRLGALGYLPPLLLHALLLFVADA

(50) Protocadherin alpha-1 (hPCADHA1) signal peptide:

(51) TABLE-US-00014 (SEQIDNO:5) MVFSRRGGLGARDLLLWLLLLAAWEVGSG

(52) FAM19A1 (TAFA1) signal peptide:

(53) TABLE-US-00015 (SEQIDNO:6) MAMVSAMSWVLYLWISACA

(54) Interleukin-2 signal peptide:

(55) TABLE-US-00016 (SEQIDNO:14) MYRMQLLSCIALILALVTNS
Signal peptides may also be referred to herein as leader sequences or leader peptides.

(56) The recombinant vector used for delivering the transgene should have a tropism for cells in the CNS, including but limited to neurons and/or glial cells. Such vectors can include non-replicating recombinant adeno-associated virus vectors (rAAV), particularly those bearing an AAV9 or AAVrh10 capsid are preferred. AAV variant capsids can be used, including but not limited to those described by Wilson in U.S. Pat. No. 7,906,111 which is incorporated by reference herein in its entirety, with AAV/hu.31 and AAV/hu.32 being particularly preferred; as well as AAV variant capsids described by Chatterjee in U.S. Pat. Nos. 8,628,966, 8,927,514 and Smith et al., 2014, Mol Ther 22: 1625-1634, each of which is incorporated by reference herein in its entirety. However, other viral vectors may be used, including but not limited to lentiviral vectors, vaccinia viral vectors, or non-viral expression vectors referred to as naked DNA constructs.

(57) Pharmaceutical compositions suitable for administration to the CSF comprise a suspension of the rhIDS vector in a formulation buffer comprising a physiologically compatible aqueous buffer, a surfactant and optional excipients. In certain embodiments, the pharmaceutical compositions are suitable for intrathecal administration. In certain embodiments, the pharmaceutical compositions are suitable for intracisternal administration (injection into the cisterna magna). In certain embodiments, the pharmaceutical compositions are suitable for injection into the subarachnoid space via a C1-2 puncture. In certain embodiments, the pharmaceutical compositions are suitable for intracerebroventricular administration. In certain embodiments, the pharmaceutical compositions are suitable for administration via lumbar puncture. In some embodiments, the pharmaceutical composition comprising the rAAV of the present disclosure comprises sodium chloride at a concentration of about 8.77 g/L, magnesium chloride 6-hydrate, at a concentration of about 0.244 g/L, potassium chloride at a concentration of about 0.224 g/L, calcium chloride dihydrate at a concentration of about 0.206 g/L, dextrose anhydrous at a concentration of about 0.793 g/L, poloxamer 188 at a concentration of about 0.001% (volume/volume), sodium phosphate monobasic monohydrate at a concentration of about 0.0278 g/L, and sodium phosphate dibasic anhydrous at a concentration of about 0.114 g/L.

(58) Therapeutically effective doses of the recombinant vector should be administered to the CSF via intrathecal administration (i.e., injection into the subarachnoid space so that the recombinant vectors distribute through the CSF and transduce cells in the CNS). In some embodiments, the recombinant vector is administered in a solution comprising sodium chloride at a concentration of about 8.77 g/L, magnesium chloride 6-hydrate, at a concentration of about 0.244 g/L, potassium chloride at a concentration of about 0.224 g/L, calcium chloride dihydrate at a concentration of about 0.206 g/L, dextrose anhydrous at a concentration of about 0.793 g/L, poloxamer 188 at a concentration of about 0.001% (volume/volume), sodium phosphate monobasic monohydrate at a concentration of about 0.0278 g/L, and sodium phosphate dibasic anhydrous at a concentration of about 0.114 g/L. This can be accomplished in a number of wayse.g., by intracranial (cisternal or ventricular) injection, or injection into the lumbar cistern. For example intracisternal (IC) injection (into the cisterna magna) can be performed by CT-guided suboccipital puncture; or injection into the subarachnoid space can be performed via a C1-2 puncture when feasible for the patient; or lumbar puncture (typically diagnostic procedures performed in order to collect a sample of CSF) can be used to access the CSF. Alternatively, intracerebroventricular (ICV) administration (a more invasive technique used for the introduction of antiinfective or anticancer drugs that do not penetrate the blood-brain barrier) can be used to instill the recombinant vectors directly into the ventricles of the brain. Alternatively, intranasal administration may be used to deliver the recombinant vector to the CNS.

(59) Because of the relatively rapid brain growth that occurs early in a developing child, the total dose of AAV9.hIDS administered IC depends on the assumed brain mass across different age strata, see, e.g., Table 2 below. For brain mass by age for the study subjects see, e.g., A S Dekaban, Ann Neurol, 1978 October; 4(4): 345-56.

(60) TABLE-US-00017 TABLE 2 Total dose administered by age Assumed Dose 1 Dose 2 Subject Age brain mass (g) (total GC*) (total GC*) ?4 to <9 months 600 7.8 ? 10.sup.12 3.9 ? 10.sup.13 ?9 to <18 months 1000 1.3 ? 10.sup.13 6.5 ? 10.sup.13 ?18 months to <3 years 1100 1.4 ? 10.sup.13 7.2 ? 10.sup.13 ?3 years 1300 1.7 ? 10.sup.13 8.5 ? 10.sup.13 *GC was determined using a Poly-A-specific PCR assay

(61) CSF concentrations can be monitored by directly measuring the concentration of rhIDS in the CSF fluid obtained from occipital or lumbar punctures, or estimated by extrapolation from concentrations of the rhFDS detected in the patient's serum.

(62) By way of background, human IDS is translated as a 550 amino acid polypeptide that contains eight potential N-glycosylation sites (N.sup.31, N.sup.115, N.sup.144, N.sup.246, N.sup.280, N.sup.325, N.sup.513 and N.sup.537) depicted in FIG. 1 and includes a 25 amino acid signal sequence which is cleaved during processing. An initial 76 kDa intracellular precursor is converted into a phosphorylated 90 kDa precursor after modification of its oligosaccharide chains in the Golgi apparatus. This precursor is processed by glycosylation modifications and proteolytic cleavage through various intracellular intermediates to a major 55 kDa form. To summarize, after removal of the 25 aa signal sequence, proteolytic processing involves N-terminal proteolytic cleavage downstream of N.sup.31 removing a propeptide of eight amino acids (residues 26-33), and C-terminal proteolytic cleavage upstream of N.sup.513 which releases an 18 kDa polypeptide and produces a 62 kDa intermediate that is converted to a 55 kDa mature form. Further proteolytic cleavage yields a 45 kDa mature form located in the lysosomal compartment. (See FIG. 4 for diagram reproduced from Millat et al., 1997, Exp Cell Res 230: 362-367 (Millat 1997); Millat et al. 1997, Biochem J. 326: 243-247 (Millat 1997a); and Froissart et al., 1995, Biochem J. 309:425-430, each of which is incorporated by reference herein in its entirety).

(63) A formylglycine modification of C.sup.84 (shown in bold in FIG. 1) required for enzyme activity probably occurs as an early post-translational or co-translational event, most probably in the endoplasmic reticulum. (See, Millat 1997a, citing Schmidt et al., 1995, Cell 82: 271-278). Post-translational processing continues in the Golgi to include addition of complex sialic acid-containing glycans and acquisition of mannose-6-phosphate residues which tag the enzyme for delivery to the lysosomal compartment. (See, Clarke, 2008, Expert Opin Pharmacother 9: 311-317 for a concise review which is incorporated by reference herein in its entirety). While no single glycosylation site is essential for IDS stability, glycosylation at position N.sup.28 is important for cellular internalization and lysosomal targeting via the mannose-6-phosphate (M6P) receptor. (Chung et al., 2014, Glycoconj J 31:309-315 at p. 310, first column). In the normal physiologic state, IDS is produced at very low levels and very little, if any, enzyme is secreted from the cell. (Clarke, 2008, supra).

(64) The invention is based, in part, on the following principles: (i) Neuronal and glial cells in the CNS are secretory cells that possess the cellular machinery for post-translational processing of secreted proteinsincluding glycosylation, mannose-6-phosphorylation, and tyrosine-O-sulfationrobust processes in the CNS. See, e.g., Sleat et al., 2005, Proteomics 5: 1520-1532, and Sleat 1996, J Biol Chem 271: 19191-98 which describes the human brain mannose-6-phosphate glycoproteome and notes that the brain contains more proteins with a much greater number of individual isoforms and mannose-6-phosphorylated proteins than found in other tissues; and Kanan et al., 2009, Exp. Eye Res. 89: 559-567 and Kanan & Al-Ubaidi, 2015, Exp. Eye Res. 133: 126-131 reporting the production of tyrosine-sulfated glycoproteins secreted by neuronal cells, each of which is incorporated by reference in its entirety for post-translational modifications made by human CNS cells. (ii) The human brain produces multiple isoforms of natural/native IDS. In particular, N-terminal sequencing of human brain mannose-6-phosphorylated glycoproteins revealed that the N-terminal sequence of the mature 42 kDa chain of hIDS varies in the brain, starting at positions 34 or 36 as follows: T.sup.34DALNVLLI (SEQ ID NO: 54); and A.sup.36LNVLLIIV (SEQ ID NO: 55). (Sleat, 2005, Proteomics 5: 1520-1532, Table S2). Two of the eight N-linked glycosylation sites, namely N.sup.280 and N.sup.116. were found to be mannose-6-phophorylated in IDS obtained from human brain. (Sleat et al., 2006, Mol & Cell Proeomics 5.4: 686-701, reported at Table V). (iii) During processing of IDS, two polypeptides, 76 kDa and 90 kDa, are secreted by neural and glial cells, but only the 90 kDa polypeptide is mannose-6-phosphorylated, which is necessary for secreted forms of the enzyme to achieve cross correction. (See, Millat, 1997, FIG. 1 results for transduced lymphoblastoid cells, and Froissart 1995, FIG. 4 showing similar results for transduced fibroblastsin culture medium, only the 90 kDa form is phosphorylated). Interestingly, it has been demonstrated that recombinant IDS produced by neuronal and glial cells may be endocytosed by recipient CNS cells more avidly than recombinant IDS produced by other cells such as kidney. Daniele 2002 demonstrated M6P-receptor mediated endocytosis of recombinant IDS from conditioned media of transduced neuronal and glial cell cultures by a recipient population of non-transduced neuronal and glial cells which properly processed the precursor to the 45 kDa mature active form. Uptake of the recombinant IDS produced by the neuronal and glial cell lines (74% endocytosis) far exceeded uptake of the enzyme produced by a kidney cell line (5.6% endocytosis). In each case, uptake was inhibited by M6P, indicating that recombinant IDS uptake was M6P-receptor mediated. (See Daniele 2002, Tables 2 and 4 and accompanying description in Results at pp. 205-206 summarized in Table 3 below).

(65) TABLE-US-00018 TABLE 3 Summary of Results Reported in Daniele 2002 Media Recipient Cells: Cell Line Source Enzyme Units Recovered % Endocytosis of rIDS Units Neuronal Glial (mean value) Kidney .sup.(transfected) 35 U 1.7 U 2.2 U 5.6% Neuronal .sup.(Ad-transduced) 12 U 8.8 U 8.8 U 74% Glial .sup.(Ad-transduced) 14 U 10.5 U 10.5 U 74% (iv) The gene therapy approach described herein should result in the continuous secretion of an hIDS glycoprotein precursor of about 90 kDa as measured by polyacrylamide gel electrophoresis (depending on the assay used) that is enzymatically active. First, the enzyme responsible for the formylglycine modification of C.sup.84 which is required for IDS activitythe FGly-Generating Enzyme (FGE, aka SUMF1)is expressed in the cerebral cortex of the human brain (gene expression data for SUMF1 may be found, for example, at GeneCards, accessible at http://www.genecards.org). Second, the secreted glycosylated/phosphorylated rIDS produced by transduced neurons and glial cells in situ should be taken up and correctly processed by untransduced neural and glial cells in the CNS. Without being bound to any theory, it appears that the secreted rhIDS precursor produced in situ by gene therapy may be more avidly endocytosed by recipient cells in the CNS than would traditional recombinant enzymes used for ERT if administered to the CNS. For example, Elaprase? (made in HT1080, a fibrosarcoma cell line) is a purified protein reported to have a molecular weight of about 76 kDanot the 90 kDa species secreted by neuronal and glial cells that appears to be more heavily phosphorylated. While the eight N-linked glycosylation sites are reported to be fully occupied in Elaprase? and contain two bis-mannose-6-phosphate terminated glycans as well as complex highly sialylated glycans, the post-translational modification of C.sup.84 to FGly, which is an absolute requirement for enzyme activity, is only about 50%. (Clarke, 2008, Expert Opin Pharmacother 9:311-317; Elaprase? Full Prescribing Information and EMA filing). Another recombinant product, Hunterase? is made in CHO cells. While reported to have higher FGly and activity than Elaprase?, mannose-6-phosphorylation and uptake did not differ. (Chung, 2014, Glycoconj J 31:309-315). (v) The extracellular IDS efficacy in vivo depends on uptake (cell and lysosome internalization) through mannose-6-phosphate (M6P) and its active site formylglycine (FGly), which is converted from C.sup.84 through post-translational modification by formylglycine-generating enzyme. As shown above in Table 3, brain cells (neuronal and glial cells) show higher enzyme activities when incubated with IDS precursor media secreted by transduced neuronal and glial cells than with IDS precursor media secreted by genetically engineered kidney cells. The resultant five-fold increase in activity can likely be attributed to the efficient uptake of IDS (See Daniele 2002, Tables 2 and 4). Commercial forms of IDS, which are generated by CHO cells or HT-1080 cells, have a FGly content of about 50% to 70%, which determines the enzyme activity. However, neuronal and glial cells may improve upon this activity, due to improvement of IDS uptake. (vi) The cellular and subcellular trafficking/uptake of lysosomal proteins, including IDS, is through M6P. IDS from brain cells may contain higher M6P content, as reported in Daniele 2002, and in Sleat, Proteomics, 2005 (indicating that the human brain contains more (in both a quantitative and qualitative sense) Man6-P glycoproteins than other tissues). It is possible to measure the M6P content of an IDS precursor, as done in Daniele 2002. In the presence of inhibitory M6P (e.g., 5 mM), the uptake of IDS precursor generated by non-neuronal or non-glial cells, such as the genetically engineered kidney cells of Daniele 2002, is predicted to decrease to levels close to that of the control cells, as was shown in Daniele 2002. While in the presence of inhibitory M6P, the uptake of IDS precursor generated by brain cells, such as neuronal and glial cells, is predicted to remain at a high level, as was shown in Daniele 2002, where the uptake was four times higher than control cells and comparable to the level of IDS activity (or uptake) of IDS precursor generated by genetically engineered kidney cells without the presence of inhibitory M6P. This assay allows for a way to predict the M6P content in IDS precursor generated by brain cells, and, in particular, to compare the M6P content in IDS precursors generated by different types of cells. The gene therapy approach described herein should result in the continuous secretion of an hIDS precursor that may be taken up into neuronal and glial cells at a high level in the presence of inhibitory M6P in such an assay. (vii) The M6P content and uptake of IDS precursor may also be demonstrated by 90 kDa and 76 kDa gel bands (e.g., SDS-PAGE gel bands). The 90 kDa is reported to be highly glycosylated/phosphorylated and contains M6P, while 76 kDa is not. A very broad gel band with a range from 76 kDa to 95 kDa and with an average MW of 80-85 kDa, similar to the IDS precursor gel band generated from genetically engineered kidney cells (Daniele 2002, FIG. 1), may be contrasted with a gel band of IDS precursor generated from brain cells. In Daniele 2002, the gel band cannot be obtained due to unsuccessful immunoprecipitation of the IDS precursor. The gene therapy approach described herein should result in the continuous secretion of an hIDS precursor that differs from the IDS precursor gel band generated from genetically engineered kidney cells. (viii) The M6P content of commercial IDS precursor is 2 to 2.5 mol/mol, majority of which is present in a form of di-phosphorylated glycans. Although in average, every IDS precursor is phosphorylated, a normal distribution of glycans will have some IDS precursor with 2, 1 and 0 of di-phosphorylated M6P glycans assuming multiple phosphorylation sites. Uptake rate should be significant higher with multiple phosphorylation. (ix) The glycosylation of hIDS by human cells of the CNS will result in the addition of glycans that can improve stability, half-life and reduce unwanted aggregation of the transgene product. Significantly, the glycans that are added to hIDS of the invention include 2,6-sialic acid, incorporating Neu5Ac (NANA) but not its hydroxylated derivative, NeuGc (N-Glycolylneuraminic acid, i.e., NGNA or Neu5Gc). Such glycans are not present in recombinant IDS products, such as Hunterase?, made in CHO cells because CHO cells do not have the 2,6-sialyltransferase required to make this post-translational modification; nor do CHO cells produce bisecting GlcNAc, although they do add Neu5Gc (NGNA) as sialic acid not typical (and potentially immunogenic) to humans instead of Neu5Ac (NANA). See, e.g., Dumont et al., 2016, Critical Rev in Biotech 36(6):1110-1122 (Early Online pp. 1-13 at p. 5); and Hague et al., 1998 Electrophor 19:2612-2630 ([t]he CHO cell line is considered phenotypically restricted, in terms of glycosylation, due to the lack of an ?2,6-sialyl-transferase). Moreover, CHO cells can also produce an immunogenic glycan, the ?-Gal antigen, which reacts with anti-?-Gal antibodies present in most individuals, and at high concentrations can trigger anaphylaxis. See, e.g., Bosques, 2010, Nat Biotech 28: 1153-1156. The human glycosylation pattern of the rhIDS of the invention should reduce immunogenicity of the transgene product and improve efficacy. (x) Immunogenicity of a transgene product could be induced by various factors, including the immune condition of the patient, the structure and characteristics of the infused protein drug, the administration route, and the duration of treatment. Process-related impurities, such as host cell protein (HCP), host cell DNA, and chemical residuals, and product-related impurities, such as protein degradants and structural characteristics, such as glycosylation, oxidation and aggregation (sub-visible particles), may also increase immunogenicity by serving as an adjuvant that enhances the immune response. The amounts of process-related and product-related impurities can be affected by the manufacturing process: cell culture, purification, formulation, storage and handling, which can affect commercially manufactured IDS products. In gene therapy, proteins are produced in vivo, such that process-related impurities are not present and protein products are not likely to contain product-related impurities/degradants associated with proteins produced by recombinant technologies, such as protein aggregation and protein oxidation. Aggregation, for example, is associated with protein production and storage due to high protein concentration, surface interaction with manufacturing equipment and containers, and the purification process with certain buffer systems. But these conditions that promote aggregation are not present when a transgene is expressed in vivo. Oxidation, such as methionine, tryptophan and histidine oxidation, is also associated with protein production and storage, caused, for example, by stressed cell culture conditions, metal and air contact, and impurities in buffers and excipients. The proteins expressed in vivo may also oxidize in a stressed condition, but humans, like many organisms, are equipped with an antioxidation defense system, which not only reduces the oxidation stress, but can also repairs and/or reverses the oxidation. Thus, proteins produced in vivo are not likely to be in an oxidized form. Both aggregation and oxidation could affect the potency, pharmacokinetics (clearance) and can increase immunogenicity concerns. The gene therapy approach described herein should result in the continuous secretion of an hIDS precursor with a reduced immunogenicity compared to commercially manufactured products. (xi) In addition to the N-linked glycosylation sites, hIDS contains a tyrosine (Y) sulfation site (PSSEKY.sup.165ENTKTCRGPD (SEQ ID NO: 47)). (See, e.g., Yang et al., 2015, Molecules 20:2138-2164, esp. at p. 2154 which is incorporated by reference in its entirety for the analysis of amino acids surrounding tyrosine residues subjected to protein tyrosine sulfation. The rules can be summarized as follows: Y residues with E or D within +5 to ?5 position of Y, and where position ?1 of Y is a neutral or acidic charged amino acidbut not a basic amino acid, e.g., R, K, or H that abolishes sulfation). While not intending to be bound by any theory, sulfation of this site in hIDS may improve stability of the enzyme and binding affinity for substrate. Tyrosine-sulfation of hIDSa robust post-translational process in human CNS cellsshould result in improved processing and activity of transgene products. The significance of tyrosine-sulfation of lysosomal proteins has not been elucidated; but in other proteins it has been shown to increase avidity of protein-protein interactions (antibodies and receptors), and to promote proteolytic processing (peptide hormone). (See, Moore, 2003, J Biol. Chem. 278: 24243-46; and Bundegaard et al., 1995, The EMBO J 14: 3073-79). The tyrosylprotein sulfotransferase (TPST1) responsible for tyrosine-sulfation (which may occur as a final step in IDS processing) is apparently expressed at higher levels (based on mRNA) in the brain (gene expression data for TPST1 may be found, for example, at the EMBL-EBI Expression Atlas, accessible at http://www.ebi.ac.uk/gxa/home). Such post-translational modification, at best, is under-represented in CHO cell products. Unlike human CNS cells, CHO cells are not secretory cells and have a limited capacity for post-translational tyrosine-sulfation. (See, e.g., Mikkelsen & Ezban, 1991, Biochemistry 30: 1533-1537, esp. discussion at p. 1537)

(66) For the foregoing reasons, the production of rhIDS by human neuronal and/or glial cells should result in a biobetter molecule for the treatment of MPS II accomplished via gene therapye.g., by administering a viral vector or other DNA expression construct encoding rhIDS to the CSF of a patient (human subject) diagnosed with an MPS II disease (including but not limited to Hunter) to create a permanent depot in the CNS that continuously supplies a fully human-glycosylated, mannose-6-phosphorylated, sulfated transgene product secreted by the transduced CNS cells. The hIDS transgene product secreted from the depot into the CSF will be endocytosed by cells in the CNS, resulting in cross-correction of the enzymatic defect in the MPS II recipient cells.

(67) It is not essential that every rhIDS molecule produced either in the gene therapy or protein therapy approach be fully glycosylated, phosphorylated, and sulfated. Rather, the population of glycoproteins produced should have sufficient glycosylation (including 2,6-sialylation and mannose-6-phosphorylation) and sulfation to demonstrate efficacy. The goal of gene therapy treatment of the invention is to slow or arrest the progression of disease. Efficacy may be monitored by measuring cognitive function (e.g., prevention or decrease in neurocognitive decline); reductions in biomarkers of disease (such as GAG) in CSF and or serum; and/or increase in IDS enzyme activity in CSF and/or serum. Signs of inflammation and other safety events may also be monitored.

(68) As an alternative, or an additional treatment to gene therapy, the rhIDS glycoprotein can be produced in human neural or glial cell lines by recombinant DNA technology and the glycoprotein can be administered to patients diagnosed with MPS II systemically and/or into the CSF for ERT). Human cell lines that can be used for such recombinant glycoprotein production include but are not limited to HT-22, SK-N-MC, HCN-AA, HCN-2, NT2, SH-SY5y, hNSC11, or ReNcell VM (see, e.g., Dumont et al., 2016, Critical Rev in Biotech 36(6):1110-1122 Human cell lines for biopharmaceutical manufacturing: history, status, and future perspectives which is incorporated by reference in its entirety for a review of the human cell lines that could be used for the recombinant production of the rHuGlyIDS glycoprotein). To ensure complete glycosylation, especially sialylation, and tyrosine-sulfation, the cell line used for production can be enhanced by engineering the host cells to co-express ?-2,6-sialyltransferase (or both ?-2,3- and ?-2,6-sialyltransferases) and/or TPST-1 and TPST-2 enzymes responsible for tyrosine-O-sulfation.

(69) While the delivery of rhIDS should minimize immune reactions, the clearest potential source of toxicity related to CNS-directed gene therapy is generating immunity against the expressed rhIDS protein in human subjects who are genetically deficient for IDS and, therefore, potentially not tolerant of the protein and/or the vector used to deliver the transgene.

(70) Thus, in a preferred embodiment, it is advisable to co-treat the patient with immune suppression therapyespecially when treating patients with severe disease who have close to zero levels of IDS. Immune suppression therapies involving a regimen of tacrolimus or rapamycin (sirolimus) in combination with mycophenolic acid, or other immune suppression regimens used in tissue transplantation procedures can be employed. Such immune suppression treatment may be administered during the course of gene therapy, and in certain embodiments, pre-treatment with immune suppression therapy may be preferred. Immune suppression therapy can be continued subsequent to the gene therapy treatment, based on the judgment of the treating physician, and may thereafter be withdrawn when immune tolerance is induced; e.g., after 180 days.

(71) Combinations of delivery of the rhIDS to the CSF accompanied by delivery of other available treatments are encompassed by the methods of the invention. The additional treatments may be administered before, concurrently or subsequent to the gene therapy treatment. Available treatments for MPS II that could be combined with the gene therapy of the invention include but are not limited to enzyme replacement therapy using Elaprase? administered systemically or to the CSF; and/or HSCT therapy.

(72) In certain embodiments, described herein is a method for treating a human subject diagnosed with mucopolysaccharidosis type II (MPS II), comprising delivering to the cerebrospinal fluid (CSF) of said human subject a therapeutically effective amount of a recombinant human iduronate-2-sulfatase (IDS) precursor produced by human neuronal or human glial cells.

(73) In certain embodiments, described herein is a method of treating a human subject diagnosed with mucopolysaccharidosis type II (MPS II), comprising delivering to the cerebrospinal fluid (CSF) of said human subject, a therapeutically effective amount of a recombinant human iduronate-2-sulfatase (IDS) glycoprotein precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, has a formylglycine residue at C.sup.84 (FIG. 1), is ?2,6-sialylated, does not contain detectable NeuGc, and is mannose-6-phosphorylated.

(74) In certain embodiments, described herein is a method of treating a human subject diagnosed with mucopolysaccharidosis type II (MPS II), comprising delivering to the cerebrospinal fluid (CSF) of said human subject, a therapeutically effective amount of a recombinant human iduronate-2-sulfatase (IDS) glycoprotein precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, has a formylglycine residue at C.sup.4 (FIG. 1), is ?2,6-sialylated, does not contain detectable NeuGc and/or ?-Gal antigen, and is mannose-6-phosphorylated.

(75) In certain embodiments, the human IDS precursor is delivered to the CSF from a depot of cells in the central nervous system genetically engineered to secrete said IDS precursor into the CSF. In certain embodiments, the depot is formed in the subject's brain. In certain embodiments, the human subject is deficient in IDS activity. In certain embodiments, the human IDS comprises the amino acid sequence of SEQ ID NO. 1.

(76) In certain embodiments, described herein is a method of treating a human subject diagnosed with mucopolysaccharidosis type II (MPS II), comprising administering to the cerebrospinal fluid (CSF) of said human subject a recombinant nucleotide expression vector encoding human iduronate-2-sulfatase (IDS), wherein said expression vector when used to transduce a primary human neuronal cell in culture directs the expression of a secreted human IDS glycoprotein precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, has a formylglycine residue at C.sup.84 (FIG. 1), is ?2,6-sialylated and mannose-6-phosphorylated.

(77) In certain embodiments, described herein is a method of treating a human subject diagnosed with mucopolysaccharidosis type II (MPS II), comprising administering to the cerebrospinal fluid of the brain of said human subject, a therapeutically effective amount of a recombinant nucleotide expression vector encoding human IDS, so that a depot is formed in the subject's central nervous system that secretes a recombinant human IDS glycoprotein precursor that is ?2,6-sialylated and mannose-6-phosphorylated.

(78) In certain embodiments, secretion of said recombinant human IDS glycoprotein precursor that is ?2,6-sialylated is confirmed by transducing a human neuronal cell line with said recombinant nucleotide expression vector in cell culture. In certain embodiments, secretion of said recombinant human IDS glycoprotein precursor that is mannose-6-phosphorylated is confirmed by transducing a human neuronal cell line with said recombinant nucleotide expression vector in cell culture. In certain embodiments, the secretion is confirmed in the presence and absence of mannose-6-phosphate.

(79) In certain embodiments, described herein is a method of treating a human subject diagnosed with mucopolysaccharidosis type II (MPS II), comprising administering to the cerebrospinal fluid of the brain of said human subject, a therapeutically effective amount of a recombinant nucleotide expression vector encoding human IDS, so that a depot is formed that secretes a glycosylated IDS precursor containing a ?2,6-sialylated glycan; wherein said recombinant vector, when used to transduce human neuronal cells in culture results in secretion of said glycosylated IDS precursor containing a ?2,6-sialylated glycan in said cell culture.

(80) In certain embodiments, described herein is a method of treating a human subject diagnosed with mucopolysaccharidosis type II (MPS II), comprising administering to the cerebrospinal fluid of the brain of said human subject, a therapeutically effective amount of a recombinant nucleotide expression vector encoding human IDS, so that a depot is formed that secretes a glycosylated IDS precursor that contains a mannose-6-phosphate; wherein said recombinant vector, when used to transduce human neuronal cells in culture results in secretion of said glycosylated IDS precursor that is mannose-6-phosphorylated in said cell culture.

(81) In certain embodiments, described herein is a method of treating a human subject diagnosed with mucopolysaccharidosis type II (MPS II), comprising administering to the cerebrospinal fluid of the brain of said human subject, a therapeutically effective amount of a recombinant nucleotide expression vector encoding human IDS, so that a depot is formed that secretes a glycosylated IDS precursor that contains a formylglycine; wherein said recombinant vector, when used to transduce human neuronal cells in culture results in secretion of said glycosylated IDS precursor that contains a formylglycine in said cell culture.

(82) In certain embodiments, the human IDS comprises the amino acid sequence of SEQ ID NO. 1. In certain embodiments, the IDS transgene encodes a leader peptide. In certain embodiments, the expression vector is a replication defective AAV vector. In certain embodiments, the expression vector is delivered to the CSF of the subject by intrathecal (e.g., intracisternal, C1-2 puncture if feasible for the patient, or lumbar puncture), intracerebroventricular, or intranasal administration. In certain embodiments, the human subject is deficient in IDS activity. In some embodiments, the expression vector is delivered to the CSF of the subject by intrathecal administration in a solution comprising sodium chloride at a concentration of about 8.77 g/L, magnesium chloride 6-hydrate, at a concentration of about 0.244 g/L, potassium chloride at a concentration of about 0.224 g/L, calcium chloride dihydrate at a concentration of about 0.206 g/L, dextrose anhydrous at a concentration of about 0.793 g/L, poloxamer 188 at a concentration of about 0.001% (volume/volume), sodium phosphate monobasic monohydrate at a concentration of about 0.0278 g/L, and sodium phosphate dibasic anhydrous at a concentration of about 0.114 g/L.

(83) In preferred embodiments, the glycosylated IDS does not contain detectable NeuGc and/or ?-Gal. The phrase detectable NeuGc and/or ?-Gal used herein means NeuGc and/or ?-Gal moieties detectable by standard assay methods known in the art. For example, NeuGc may be detected by HPLC according to Hara et al., 1989, Highly Sensitive Determination of N-Acetyl- and N-Glycolylneuraminic Acids in Human Serum and Urine and Rat Serum by Reversed-Phase Liquid Chromatography with Fluorescence Detection. J. Chromatogr., B: Biomed. 377: 111-119, which is hereby incorporated by reference for the method of detecting NeuGc. Alternatively, NeuGc may be detected by mass spectrometry. The ?-Gal may be detected using an ELISA, see, for example, Galili et al., 1998, A sensitive assay for measuring alpha-Gal epitope expression on cells by a monoclonal anti-Gal antibody. Transplantation. 65(8): 1129-32, or by mass spectrometry, see, for example, Ayoub et al., 2013, Correct primary structure assessment and extensive glyco-profiling of cetuximab by a combination of intact, middle-up, middle-down and bottom-up ESI and MALDI mass spectrometry techniques. Landes Bioscience. 5(5): 699-710. See also the references cited in Platts-Mills et al., 2015, Anaphylaxis to the Carbohydrate Side-Chain Alpha-gal Immunol Allergy Clin North Am. 35(2): 247-260.

(84) In one aspect, provided herein is a method for treating a human subject diagnosed with MPS II, comprising delivering to the CSF of the human subject a therapeutically effective amount of a glycosylated recombinant human IDS precursor produced by human neuronal or human glial cells, wherein the glycosylated recombinant human IDS precursor is delivered by administration of a recombinant nucleotide expression vector encoding human IDS, wherein the recombinant nucleotide expression vector is administered at a dose that is dependent on the human subject's brain mass, and wherein the brain mass is determined by brain MRI of the human subject's brain.

(85) In another aspect, provided herein is a method for treating a human subject diagnosed with MPS II, comprising determining the human subject's brain mass from the human subject's brain MRI, and subsequently delivering to the CSF of the human subject a therapeutically effective amount of a glycosylated recombinant human IDS precursor produced by human neuronal cells or human glial cells, wherein the glycosylated recombinant human IDS precursor is delivered by administration of a recombinant nucleotide expression vector encoding human IDS, and wherein the recombinant nucleotide expression vector is administered at a dose that is dependent on the human subject's brain mass.

(86) In another aspect, provided herein is a method for treating a human subject diagnosed with MPS II, comprising (a) determining the human subject's brain mass from the human subject's brain MRI, (b) calculating the dose based on the human subject's brain mass, and (c) subsequently administrating to the CSF of the subject the dose of recombinant nucleotide expression vector encoding human IDS.

(87) In another aspect, provided herein is a method for treating a human subject diagnosed with MPS II, comprising, in the following order: (a) delivering to the CSF of the human subject a therapeutically effective amount of a glycosylated recombinant human IDS precursor produced by human neuronal or human glial cells; (b) measuring level of heparan sulfate in the CSF of the human subject; and (c) comparing the level of heparan sulfate in the CSF of the human subject with level of heapran sulfatae in a reference population; wherein the glycosylated recombinant human IDS precursor is delivered by administration of a recombinant nucleotide expression vector encoding human IDS, wherein the recombinant nucleotide expression vector is administered at a dose that is dependent on the human subject's brain mass, and wherein the brain mass is determined by brain magnetic resonance imaging (MRI) of the human subject's brain. In certain embodiments, the reference population consists of: (a) at least 1, 2, 3, 4, 5, 10, 25, 50, 75, 100, 200, 250, 300, 400, 500, or 1000 individual healthy people without MPS II, preferably of similar age, weight, and/or of the same gender as the human subject.

(88) In another aspect, provided herein is a method for treating a human subject diagnosed with MPS II, comprising, in the following order: (a) taking a first measurement of the level of heparan sulfate in the CSF of the human subject; (b) delivering to the CSF of the human subject a therapeutically effective amount of a glycosylated recombinant human IDS precursor produced by human neuronal or human glial cells; and (c) after a period of time, taking a second measurement of the level of heparan sulfate; wherein the glycosylated recombinant human IDS precursor is delivered by administration of a recombinant nucleotide expression vector encoding human IDS, wherein the recombinant nucleotide expression vector is administered at a dose that is dependent on the human subject's brain mass, and wherein the brain mass is determined by brain magnetic resonance imaging (MRI) of the human subject's brain. In certain embodiments, the period of time is about 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 2 months, 3 moths, 4 months, 5 months, 6 months, 7 months, 8 months, 11 months, or 1 year.

(89) In a preferred embodiment, the glycosylated recombinant human IDS precursor will be endocytosed by cells in the CNS. In a preferred embodiment, the glycosylated recombinant human IDS precursor is delivered to lysosomes of cells in the CNS of the human subject.

(90) In certain embodiments of the method for treating described herein, the human subject's brain mass is converted from the human subject's brain volume by multiplying the human subject's brain volume in cm.sup.3 by a factor of 1.046 g/cm.sup.3, wherein the human subject's brain volume is determined by brain MRI of the subject's brain.

(91) In certain embodiments of the method for treating described herein, the recombinant nucleotide expression vector is administered at a dose of about 1.3?10.sup.10 GC/g brain mass as determined by MRI, or about 6.5?10.sup.10 GC/g brain mass as determined by MRI. In certain embodiments of the method for treating described herein, the recombinant nucleotide expression vector is administered at a dose of about 1.3?10.sup.10 GC/g brain mass (e.g., the brain mass is determined by MRI and the genome count is determined by a Poly-A-specific PCR assay). In certain embodiments of the method for treating described herein, the recombinant nucleotide expression vector is administered at a dose of about 1.9?10.sup.10 GC/g brain mass (e.g., the brain mass is determined by MRI and the genome count is determined by a transgene-specific PCR assay). In certain embodiments of the method for treating described herein, the recombinant nucleotide expression vector is administered at a dose of about 6.5?10.sup.10 GC/g brain mass (e.g., the brain mass is determined by MRI and the genome count is determined by a Poly-A-specific PCR assay). In certain embodiments of the method for treating described herein, the recombinant nucleotide expression vector is administered at a dose of about 9.6?10.sup.10 GC/g brain mass (e.g., the brain mass is determined by MRI and the genome count is determined by a transgene-specific PCR assay). In certain embodiments of the method for treating described herein, the recombinant nucleotide expression vector is administered at a dose of about 2.0?10.sup.11 GC/g brain mass (e.g., the brain mass is determined by MRI and the genome count is determined by a Poly-A-specific PCR assay). In certain embodiments of the method for treating described herein, the recombinant nucleotide expression vector is administered at a dose of about 2.9?10.sup.10 GC/g brain mass (e.g., the brain mass is determined by MRI and the genome count is determined by a transgene-specific PCR assay).

(92) In various embodiments of the method for treating described herein, the human subject is 5 years old or older and less than 18 years old. In specific embodiments, the human subject is 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17 or 18 years old. In specific embodiments, the human subject is about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17 or 18 years old. In specific embodiments, the human subject is 5-6, 6-7, 7-8, 8-9, 9-10, 10-11, 11-12, 12-13, 13-14, 14-15, 15-16, 16-17, 17-18 or 18-19 years old. In specific embodiments, the human subject is about 5-6, 6-7, 7-8, 8-9, 9-10, 10-11, 11-12, 12-13, 13-14, 14-15, 15-16, 16-17, 17-18 or 18-19 years old. In certain embodiments, the recombinant nucleotide expression vector is administered at a dose of about 6.5?10.sup.10 GC/g brain mass as determined by MRI. In certain embodiments, the recombinant nucleotide expression vector is administered at a dose according to Table 7.

(93) In various embodiments of the method for treating described herein, the human subject is 4 months old or older and less than 5 years old. In specific embodiments, the human subject is 4, 5, 6, 7, 8, 9, 10, or 11 months old. In specific embodiments, the human subject is about 4, 5, 6, 7, 8, 9, 10, or 11 months old. In specific embodiments, the human subject is 4-5, 5-6, 6-7, 7-8, 8-9, 9-10, 10-11, or 11-12 months old. In specific embodiments, the human subject is about 4-5, 5-6, 6-7, 7-8, 8-9, 9-10, 10-11, or 11-12 months old. In specific embodiments, the human subject is 1, 2, 3, 4, or 5 years old. In specific embodiments, the human subject is about 1, 2, 3, 4, or 5 years old. In specific embodiments, the human subject is 1-2, 2-3, 3-4, 4-5, or 5-6 years old. In specific embodiments, the human subject is about 1-2, 2-3, 3-4, 4-5, or 5-6 years old. In certain embodiments, the recombinant nucleotide expression vector is administered at a dose of about 1.3?10.sup.10 GC/g brain mass as determined by MRI. In certain embodiments, the recombinant nucleotide expression vector is administered at a dose of about 6.5?10.sup.10 GC/g brain mass as determined by MRI. In certain embodiments, the recombinant nucleotide expression vector is administered at a dose of about 2.0?10.sup.10 GC/g brain mass as determined by MRI. In certain embodiments, the recombinant nucleotide expression vector is administered at a dose of about 2.9?10.sup.10 GC/g brain mass as determined by MRI. In certain embodiments, the recombinant nucleotide expression vector is administered at a dose of about 1.9?10.sup.10 GC/g brain mass as determined by MRI. In certain embodiments, the recombinant nucleotide expression vector is administered at a dose of about 9.6?10.sup.10 GC/g brain mass as determined by MRI. In certain embodiments, the recombinant nucleotide expression vector is administered at a dose of about 2.0?10.sup.10 GC/g brain mass (e.g., the brain mass is determined by MRI and the genome count is determined by a Poly-A-specific PCR assay). In certain embodiments, the recombinant nucleotide expression vector is administered at a dose of about 2.9?10.sup.11 GC/g brain mass (e.g., the brain mass is determined by MRI and the genome count is determined by a transgene-specific PCR assay). In certain embodiments, the recombinant nucleotide expression vector is administered at a dose of about 1.3?10.sup.10 GC/g brain mass (e.g., the brain mass is determined by MRI and the genome count is determined by a Poly-A-specific PCR assay). In certain embodiments, the recombinant nucleotide expression vector is administered at a dose of about 1.9?10.sup.10 GC/g brain mass (e.g., the brain mass is determined by MRI and the genome count is determined by a transgene-specific PCR assay). In certain embodiments, the recombinant nucleotide expression vector is administered at a dose of about 6.5?10.sup.10 GC/g brain mass (e.g., the brain mass is determined by MRI and the genome count is determined by a Poly-A-specific PCR assay). In certain embodiments, the recombinant nucleotide expression vector is administered at a dose of about 9.6?10.sup.10 GC/g brain mass (e.g., the brain mass is determined by MRI and the genome count is determined by a transgene-specific PCR assay). In certain embodiments, the recombinant nucleotide expression vector is administered at a dose chosen from Dose 1 or Dose 2 according to Table 5. In certain embodiments, the recombinant nucleotide expression vector is administered at a dose according to Table 6.

(94) In some embodiments of the method for treating described herein, the recombinant nucleotide expression vector is administered via intracisternal (IC) administration. In other embodiments of the method for treating described herein, the recombinant nucleotide expression vector is administered via intracerebroventricular (ICV) administration.

(95) In certain embodiments of the method for treating described herein, the recombinant nucleotide expression vector is administered at a volume that does not exceed 10% of the total cerebrospinal fluid volume of the human subject.

(96) In certain embodiments of the method for treating described herein, the glycosylated recombinant human IDS precursor is secreted at a detectable level.

(97) In certain embodiments of the method for treating described herein, the human neuronal or human glial cells carry at least one mutation in the endogenous gene encoding human IDS precursor.

(98) In certain embodiments of the method for treating described herein, the human neuronal or human glial cells are transduced with a recombinant adeno-associated virus vector (rAAV).

(99) In a preferred embodiment, the recombinant nucleotide expression vector is an AAV9 or AAVrh10 vector.

(100) In certain embodiments of the method for treating described herein, the glycosylated recombinant human IDS precursor is expressed under the control of a CB7 promoter.

(101) In certain embodiments of the method for treating described herein, the glycosylated recombinant human IDS precursor is expressed from a cDNA encoding human IDS precursor.

(102) In certain embodiments of the method for treating described herein, the glycosylated recombinant human IDS precursor is about 90 kDa as measured by polyacrylamide gel electrophoresis.

(103) In certain embodiments of the method for treating described herein, the glycosylated recombinant human IDS precursor contains a formylglycine.

(104) In certain embodiments of the method for treating described herein, the glycosylated recombinant human IDS precursor (a) is ?2,6-sialylated; (b) does not contain detectable NeuGc; (c) does not contain detectable ?-Gal antigen; (d) contains tyrosine-sulfation; and/or (e) is mannose-6-phosphorylated.

(105) In certain embodiments of the method for treating described herein, the glycosylated recombinant human IDS precursor comprises the amino acid sequence of SEQ ID NO. 1.

(106) In certain embodiments provided herein, the method further comprising administering an immune suppression therapy to the human subject before or concurrently with the human IDS precursor treatment and optionally continuing immune suppression therapy thereafter.

(107) In some embodiments, the immune suppression therapy comprises administering one or more corticosteroids, sirolimus, and/or tacrolimus. In a specific embodiment, the one or more corticosteroids are methylprednisolone and/or prednisone.

(108) In a specific embodiment, the immune suppression therapy comprises administering prednisone at a dose of about 0.10 mg/kg, 0.11 mg/kg, 0.12 mg/kg, 0.13 mg/kg, 0.14 mg/kg, 0.15 mg/kg, 0.16 mg/kg, 0.17 mg/kg, 0.18 mg/kg, 0.19 mg/kg, 0.20 mg/kg, 0.21 mg/kg, 0.22 mg/kg, 0.23 mg/kg, 0.24 mg/kg, 0.25 mg/kg, 0.26 mg/kg, 0.27 mg/kg, 0.28 mg/kg, 0.29 mg/kg, 0.30 mg/kg, 0.31 mg/kg, 0.32 mg/kg, 0.33 mg/kg, 0.34 mg/kg, 0.35 mg/kg, 0.36 mg/kg, 0.37 mg/kg, 0.38 mg/kg, 0.39 mg/kg, 0.40 mg/kg, 0.41 mg/kg, 0.42 mg/kg, 0.43 mg/kg, 0.44 mg/kg, 0.45 mg/kg, 0.46 mg/kg, 0.47 mg/kg, 0.48 mg/kg, 0.49 mg/kg, 0.5 mg/kg, 0.6 mg/kg, 0.7 mg/kg, 0.8 mg/kg, 0.9 mg/kg, or 1 mg/kg. In a specific embodiment, the immune suppression therapy comprises administering prednisone at a dose ranging from about 0.10 mg/kg to about 0.20 mg/kg. In a specific embodiment, the immune suppression therapy comprises administering prednisone at a dose ranging from about 0.20 mg/kg to about 0.30 mg/kg. In a specific embodiment, the immune suppression therapy comprises administering prednisone at a dose ranging from about 0.30 mg/kg to about 0.40 mg/kg. In a specific embodiment, the immune suppression therapy comprises administering prednisone at a dose ranging from about 0.40 mg/kg to about 0.50 mg/kg. In a specific embodiment, the immune suppression therapy comprises administering prednisone at a dose ranging from about 0.50 mg/kg to about 1 mg/kg. In a particular embodiment, the dose is administered daily. In a particular embodiment, the immune suppression therapy comprises administering prednisone at a dose of 0.5 mg/kg daily. In another particular embodiment, the immune suppression therapy comprises administering prednisone at a dose of 0.5 mg/kg daily with gradual tapering and discontinuation.

(109) In a specific embodiment, the immune suppression therapy comprises administering methylprednisolone at a dose of about 0.5 mg/kg, 0.6 mg/kg, 0.7 mg/kg, 0.8 mg/kg, 0.9 mg/kg, 1 mg/kg, 1.5 mg/kg, 2 mg/kg, 2.5 mg/kg, 3 mg/kg, 3.5 mg/kg, 4 mg/kg, 4.5 mg/kg, 5 mg/kg, 5.5 mg/kg, 6 mg/kg, 6.5 mg/kg, 7 mg/kg, 7.5 mg/kg, 8 mg/kg, 8.5 mg/kg, 9 mg/kg, 9.5 mg/kg, 10 mg/kg, 11 mg/kg, 12 mg/kg, 13 mg/kg, 14 mg/kg, 15 mg/kg, 16 mg/kg, 17 mg/kg, 18 mg/kg, 19 mg/kg, or 20 mg/kg. In a specific embodiment, the immune suppression therapy comprises administering methylprednisolone at a dose ranging from about 0.50 mg/kg to about 1.0 mg/kg. In a specific embodiment, the immune suppression therapy comprises administering methylprednisolone at a dose ranging from about 1.0 mg/kg to about 2.0 mg/kg. In a specific embodiment, the immune suppression therapy comprises administering methylprednisolone at a dose ranging from about 2.0 mg/kg to about 3.0 mg/kg. In a specific embodiment, the immune suppression therapy comprises administering methylprednisolone at a dose ranging from about 3.0 mg/kg to about 5.0 mg/kg. In a specific embodiment, the immune suppression therapy comprises administering methylprednisolone at a dose ranging from about 5.0 mg/kg to about 10.0 mg/kg. In a specific embodiment, the immune suppression therapy comprises administering methylprednisolone at a dose ranging from about 10.0 mg/kg to about 15.0 mg/kg. In a specific embodiment, the immune suppression therapy comprises administering methylprednisolone at a dose ranging from about 15.0 mg/kg to about 20.0 mg/kg. In a particular embodiment, the methylprednisolone is administered once. In a particular embodiment, the methylprednisolone is administered intravenously. In a particular embodiment, the methylprednisolone is administered for a maximum of 500 mg, In a particular embodiment, the methylprednisolone s administered over at least 30 minutes. In a particular embodiment, the immune suppression therapy comprises administering methylprednisolone at a dose of 10 mg/kg IV for maximum of 500 mg over at least 30 minutes.

(110) In a specific embodiment, the immune suppression therapy comprises administering sirolimus at a dose to maintain a target blood level of 1-3 ng/mL. In a specific embodiment, the immune suppression therapy comprises administering sirolimus at a dose of about 0.25 mg/m.sup.2/day, 0.3 mg/m.sup.2/day, 0.4 mg/m.sup.2/day, 0.5 mg/m.sup.2/day, 0.6 mg/m.sup.2/day, 0.7 mg/m.sup.2/day, 0.8 mg/m.sup.2/day, 0.9 mg/m.sup.2/day, 1 mg/m.sup.2/day, 1.25 mg/m.sup.2/day, 1.5 mg/m.sup.2/day, 1.75 mg/m.sup.2/day, 2 mg/m.sup.2/day, 2.25 mg/m.sup.2/day, 2.5 mg/m.sup.2/day, 2.75 mg/m.sup.2/day, 3 mg/m.sup.2/day, 3.25 mg/m.sup.2/day, 3.5 mg/m.sup.2/day, 3.75 mg/m.sup.2/day, 4 mg/m.sup.2/day, 4.25 mg/m.sup.2/day, 4.5 mg/m.sup.2/day, 4.75 mg/m.sup.2/day, or 5 mg/m.sup.2/day. In a specific embodiment, the immune suppression therapy comprises administering sirolimus at a dose ranging from about 0.25 mg/m.sup.2/day to about 0.5 mg/m.sup.2/day. In a specific embodiment, the immune suppression therapy comprises administering sirolimus at a dose ranging from about 0.50 mg/m.sup.2/day to about 1.0 mg/m.sup.2/day. In a specific embodiment, the immune suppression therapy comprises administering sirolimus at a dose ranging from about 1.0 mg/m.sup.2/day to about 1.5 mg/m.sup.2/day. In a specific embodiment, the immune suppression therapy comprises administering sirolimus at a dose ranging from about 1.5 mg/m.sup.2/day to about 2 mg/m.sup.2/day. In a specific embodiment, the immune suppression therapy comprises administering sirolimus at a dose ranging from about 2 mg/m.sup.2/day to about 5 mg/m.sup.2/day. In a particular embodiment, the dose is divided in BID dosing. In a particular embodiment, the immune suppression therapy comprises administering sirolimus at a dose of about 1 mg/m.sup.2/day every 4 hours. In a particular embodiment, the immune suppression therapy comprises administering sirolimus at a dose of about 0.5 mg/m.sup.2/day divided in BID dosing.

(111) In a specific embodiment, the immune suppression therapy comprises administering tacrolimus at a dose to maintain a target blood level of 2-4 ng/mL. In a particular embodiment, the immune suppression therapy comprises administering tacrolimus at a dose of about 0.01 mg/kg, 0.02 mg/kg, 0.03 mg/kg 0.04 mg/kg 0.05 mg/kg, 0.06 mg/kg, 0.07 mg/kg, 0.08 mg/kg, 0.09 mg/kg, or 0.10 mg/kg. In a particular embodiment, the immune suppression therapy comprises administering tacrolimus at a dose ranging from 0.01 mg/kg to 0.02 mg/kg. In a particular embodiment, the immune suppression therapy comprises administering tacrolimus at a dose ranging from 0.02 mg/kg to 0.03 mg/kg. In a particular embodiment, the immune suppression therapy comprises administering tacrolimus at a dose ranging from 0.03 mg/kg to 0.05 mg/kg. In a particular embodiment, the immune suppression therapy comprises administering tacrolimus at a dose ranging from 0.05 mg/kg to 0.07 mg/kg. In a particular embodiment, the immune suppression therapy comprises administering tacrolimus at a dose ranging from 0.07 mg/kg to 0.10 mg/kg. In a particular embodiment, the dose is administered twice daily. In a particular embodiment, the immune suppression therapy comprises administering tacrolimus at a dose of about 0.05 mg/kg twice daily.

(112) In some embodiments, the method further comprises administering one or more antibiotics to the human subject before or concurrently with the immune suppression therapy. In a specific embodiment, the one or more antibiotics are trimethoprim, sulfamethoxazole, pentamidine, dapsone, and/or atovaquone. In another specific embodiment, the one or more antibiotics are trimethoprim and/or sulfamethoxazole. In another specific embodiment, the one or more antibiotics are pentamidine, dapsone, and/or atovaquone. In specific embodiments, the one or more antibiotics are administered at a dose of about 1 mg/kg, 2 mg/kg, 3 mg/kg, 4 mg/kg, 5 mg/kg, 6 mg/kg, 7 mg/kg, 8 mg/kg, 9 mg/kg, or 10 mg/kg. In specific embodiments, the one or more antibiotics are administered at a dose ranging from about 1 mg/kg to 2 mg/kg. In specific embodiments, the one or more antibiotics are administered at a dose ranging from about 2 mg/kg to 3 mg/kg. In specific embodiments, the one or more antibiotics are administered at a dose ranging from about 3 mg/kg to 5 mg/kg. In specific embodiments, the one or more antibiotics are administered at a dose ranging from about 5 mg/kg to 7 mg/kg. In specific embodiments, the one or more antibiotics are administered at a dose ranging from about 7 mg/kg to 10 mg/kg. In a specific embodiment, the one or more antibiotics are administered at a dose of about three times a week. In certain embodiments, the one or more antibiotics are administered to prevent Pneumocystis carinii pneumonia.

(113) In some embodiments, the method further comprises administering one or more antifungal therapies to the human subject before or concurrently with the immune suppression therapy. In certain embodiments, the one or more antifungal therapies are initiated if the absolute neutrophil count is <500 mm.sup.3.

(114) In some embodiments, the method further comprises a step of measuring one or more of the following biomarkers after administration of the recombinant nucleotide expression vector: (a) level of glycosaminoglycans (GAGs) in CSF; (b) level of iduronate-2-sulfatase (I2S) in CSF; (c) level of GAGs in plasma; (d) level of I2S in plasma; (e) level of leukocyte I2S enzyme activity; and (f) level of GAGs in urine. In a specific embodiment, the GAGs in CSF comprise heparin sulfate in CSF. In another specific embodiment, the GAGs in CSF are heparin sulfate in CSF. In another specific embodiment, the GAGs in plasma comprise heparin sulfate in plasma. In another specific embodiment, the GAGs in plasma are heparin sulfate in plasma. In another specific embodiment, the GAGs in urine comprise heparin sulfate in urine. In another specific embodiment, the GAGs in urine are heparin sulfate in urine. In a specific embodiment, the step of measuring comprises mearing level of heparin sulfate in CSF. In another specific embodiment, the step of measuring comprises measuring level of leukocyte I2S enzyme activity.

(115) In certain embodiments of the method for treating described herein, the recombinant nucleotide expression vector is a liquid composition. In certain embodiments of the method for treating described herein, the recombinant nucleotide expression vector is a frozen composition. In certain embodiments of the method for treating described herein, the recombinant nucleotide expression vector is a lyophilized composition or a reconstituted lyophilized composition. In certain embodiments of the method for treating described herein, the recombinant nucleotide expression vector provided herein may be formulated in various dosage forms for IC or ICV administration. In certain embodiments of the method for treating described herein, the recombinant nucleotide expression vector provided herein may be provided in a unit-dosage form or multiple-dosage form. A unit-dosage form, as used herein, refers to a physically discrete unit suitable for administration to human and animal subjects, and packaged individually as is known in the art. Each unit-dose contains a predetermined quantity of the said recombinant nucleotide expression vector and/or other ingredient(s) sufficient to produce the desired therapeutic effect, in association with the required pharmaceutical carriers or excipients. Examples of a unit-dosage form include an ampoule, a vial, a prefilled syringe, or a cartridge.

(116) In certain embodiments of the method for treating described herein, a unit-dosage form may be administered in fractions or multiples thereof. In certain embodiments of the method for treating described herein, a multiple-dosage form is a plurality of identical unit-dosage forms packaged in a single container to be administered in segregated unit-dosage form. Examples of a multiple-dosage form include a vial, a prefilled syringe, or a cartridge. In certain embodiments, the prefilled syringe comprises 8.5?10.sup.12 GC of the recombinant nucleotide expression vector In certain embodiments, the prefilled syringe comprises 9.8?10.sup.12 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 1.1?10.sup.13 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 1.3?10.sup.13 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 1.5?10.sup.11 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 1.7?10.sup.13 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 4.2?10.sup.11 GC of the recombinant nucleotide expression vector In certain embodiments, the prefilled syringe comprises 4.9?10.sup.13 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 5.5?10.sup.11 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 6.3?10.sup.11 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 7.3?10.sup.11 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 8.5?10.sup.12 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 9.0?10.sup.13 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 1.0?10.sup.14 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 1.1?10.sup.10 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 1.2?10.sup.14 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 1.3?10.sup.14 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 1.4?10.sup.14 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 1.5?10.sup.11 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 1.6?10.sup.11 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 1.7?10.sup.14 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 1.8?10.sup.14 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 1.9?10.sup.10 of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 2.0?10.sup.14 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 2.1?10.sup.14 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 2.2?10.sup.14 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 2.3?10.sup.14 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 2.4?10.sup.14 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 2.5?10.sup.14 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 2.6?10.sup.14 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 1.3?10.sup.10 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 1.9?10.sup.10 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 6.5?10.sup.10 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 9.6?10.sup.10 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 2.0?10.sup.11 GC of the recombinant nucleotide expression vector. In certain embodiments, the prefilled syringe comprises 2.9?10.sup.11 GC of the recombinant nucleotide expression vector.

(117) As used herein, the term about means within plus or minus 10% of a given value or range. In certain embodiments, the term about means within plus or minus 1% of a given value or range, wherein the value is a dose that is dependent on the human subject's brain mass, and wherein the brain mass is determined by brain MRI of the human subject's brain. In certain embodiments, the term about means within plus or minus 2% of a given value or range, wherein the value is a dose that is determined by brain MRI of the subject's brain, and wherein the brain mass is determined by brain MRI of the human subject's brain. In certain embodiments, the term about means within plus or minus 5% of a given value or range, wherein the value is a dose that is dependent on the human subject's brain mass, and wherein the brain mass is determined by brain MRI of the human subject's brain. In certain embodiments, the term about means within plus or minus 7% of a given value or range, wherein the value is a dose that is dependent on the human subject's brain mass, and wherein the brain mass is determined by brain MRI of the human subject's brain. In certain embodiments, the term about means within plus or minus 10% c of a given value or range, wherein the value is a dose that is dependent on the human subject's brain mass, and wherein the brain mass is determined by brain MRI of the human subject's brain. However, it is to be understood that in this specification, the term about also affords support for recitation of the exact value with which the term is connected. For example, about 10 also provides support for the number 10 exactly.

(118) 5.1 Processing, N-Glycosylation and Tyrosine Sulfation

(119) 5.1.1. Processing

(120) Human IDS includes a 25 amino acid signal sequence which is cleaved during processing. An initial 76 kDa intracellular IDS precursor is converted into a phosphorylated 90 kDa IDS precursor after modification of its oligosaccharide chains in the Golgi apparatus. This precursor is processed by glycosylation modifications and proteolytic cleavage through various intracellular intermediates to a major 55 kDa form. To summarize, after removal of the 25 aa signal sequence, proteolytic processing involves N-terminal proteolytic cleavage downstream of N.sup.31 removing a propeptide of eight amino acids (residues 26-33), and C-terminal proteolytic cleavage upstream of N.sup.513 which releases an 18 kDa polypeptide and produces a 62 kDa intermediate that is converted to a 55 kDa mature form. Further proteolytic cleavage yields a 45 kDa mature form located in the lysosomal compartment. (See FIG. 4 for diagram reproduced from Millat et al., 1997, Exp Cell Res 230: 362-367 (Millat 1997); Millat et al. 1997, Biochem J. 326: 243-247 (Millat 1997a); and Froissart et al., 1995, Biochem J. 309:425-430, each of which is incorporated by reference herein in its entirety).

(121) A formylglycine modification of C.sup.84 (shown in bold in FIG. 1) required for enzyme activity probably occurs as an early post-translational or co-translational event, most probably in the endoplasmic reticulum. (See, Millat 1997a, citing Schmidt et al., 1995, Cell 82: 271-278). Post-translational processing continues in the Golgi to include addition of complex sialic acid-containing glycans and acquisition of mannose-6-phosphate residues which tag the enzyme for delivery to the lysosomal compartment. (See, Clarke, 2008, Expert Opin Pharmacother 9: 311-317 for a concise review which is incorporated by reference herein in its entirety).

(122) In a specific embodiment, HuGlyIDS used in accordance with the methods described herein, when expressed in a neuronal or glial cell, in vivo or in vitro, can be the 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) mannose-6-phosphorylated form of the enzyme. IDS produced from neuronal and glial cells may contain higher M6P content, as reported in Daniele 2002, and in Sleat, Proteomics, 2005 (indicating that the human brain contains more (in both a quantitative and qualitative sense) M6P glycoproteins than other tissues). It is possible to measure the M6P content of an IDS precursor, as done in Daniele 2002.

(123) Accordingly, in certain embodiments, HuGlyIDS used in accordance with the methods described herein, when expressed in a neuronal or glial cell, in vivo or in vitro, is mannose-6-phosphorylated at a higher level than IDS expressed in a non-neuronal or glial cell. In particular, HuGlyIDS used in accordance with the methods described herein, when expressed in a neuronal or glial cell, in vivo or in vitro, is mannose-6-phosphorylated at a higher level than IDS expressed in a HT1080 or CHO cell. In certain embodiments, the mannose-6-phosphorylation level of the expressed IDS is measured by uptake of the IDS by a human neuronal cell in the presence of M6P (e.g., 5 mM M6P). In certain embodiments, when expressed in a neuronal or glial cell, in vivo or in vitro, 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%-60%, 60%-70%, 70%-80%, 80%-90%, or 90%-100% of HuGlyIDS molecules used in accordance with the methods described herein are mannose-6-phosphorylated.

(124) 5.1.2. N-Glycosylation

(125) Neuronal and glial cells in the CNS are secretory cells that possess the cellular machinery for post-translational processing of secreted proteinsincluding glycosylation and tyrosine-O-sulfation. hIDS has eight asparaginal (N) glycosylation sites identified in FIG. 1 (N.sup.31ST; N.sup.115FS; N.sup.144HT; N.sup.246IT; N.sup.280IS; N.sup.325ST; N.sup.513FS; N.sup.537DS). Two of the eight N-linked glycosylation sites, namely N.sup.280 and N.sup.116, are mannose-6-phophorylated in IDS obtained from human brain. (Sleat et al., 2006, Mol & Cell Proeomics 5.4: 686-701, reported at Table V). While no single glycosylation site is essential for LDS stability, glycosylation at position N.sup.280 is important for cellular internalization and lysosomal targeting via the mannose-6-phosphate (M6P) receptor. (Chung et al., 2014, Glycoconj J 31:309-315 at p. 310, first column). In the normal physiologic state, IDS is produced at very low levels and very little, if any, enzyme is secreted from the cell. (Clarke, 2008, supra).

(126) It is not essential that every molecule produced either in the gene therapy or protein therapy approach be fully glycosylated and sulfated. Rather, the population of glycoproteins produced should have sufficient glycosylation and sulfation to demonstrate efficacy.

(127) In a specific embodiment, HuGlyIDS used in accordance with the methods described herein, when expressed in a neuronal or glial cell, in vivo or in vitro, could be glycosylated at 100% of its N-glycosylation sites. However, one of skill in the art will appreciate that not every N-glycosylation site of HuGlyIDS need be N-glycosylated in order for benefits of glycosylation to be attained. Rather, benefits of glycosylation can be realized when only a percentage of N-glycosylation sites are glycosylated, and/or when only a percentage of expressed IDS molecules are glycosylated. Accordingly, in certain embodiments, HuGlyIDS used in accordance with the methods described herein, when expressed in a neuronal or glial cell, in vivo or in vitro, is glycosylated at 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%-60%, 60%-70%, 70%-80%, 80%-90?/%, or 90%-100% of its available N-glycosylation sites. In certain embodiments, when expressed in a neuronal or glial cell, in vivo or in vitro, 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%-60%, 60%-70%, 70%-80%, 80%-90%, or 90%-100% of HuGlyIDS molecules used in accordance with the methods described herein are glycosylated at least one of their available N-glycosylation sites.

(128) In a specific embodiment, at least 10%, 20% 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 900, 95%, or 99% of the N-glycosylation sites present in HuGlyIDS used in accordance with the methods described herein are glycosylated at an Asn residue (or other relevant residue) present in an N-glycosylation site, when the HuGlyIDS is expressed in a neuronal or glial cell, in vivo or in vitro. That is, at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% of the N-glycosylation sites of the resultant HuGlyIDS are glycosylated.

(129) In another specific embodiment, at least 10%, 20% 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% of the N-glycosylation sites present in a HuGlyIDS molecule used in accordance with the methods described herein are glycosylated with an identical attached glycan linked to the Asn residue (or other relevant residue) present in an N-glycosylation site, when the HuGlyIDS is expressed in a neuronal or glial cell, in vivo or in vitro. That is, at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% of the N-glycosylation sites of the resultant HuGlyIDS have an identical attached glycan.

(130) Importantly, when the IDS proteins used in accordance with the methods described herein are expressed in neuronal or glial cells, the need for in vitro production in prokaryotic host cells (e.g., E. coli) or eukaryotic host cells (e.g., CHO cells) is circumvented. Instead, as a result of the methods described herein (e.g., use of neuronal or glial cells to express IDS), N-glycosylation sites of the IDS proteins are advantageously decorated with glycans relevant to and beneficial to treatment of humans, and, in particular, at the target location of treatment. Such an advantage is unattainable when CHO cells or E. coli are utilized in protein production, because e.g., CHO cells (1) do not express 2,6 sialyltransferase and thus cannot add 2,6 sialic acid during N-glycosylation and (2) can add Neu5Gc as sialic acid instead of Neu5Ac; and because E. coli does not naturally contain components needed for N-glycosylation. Furthermore, such an advantage may be unattainable when human cells that are not neuronal or glial cells are utilized in protein production. Accordingly, in one embodiment, an IDS protein expressed in a neuronal or glial cell to give rise to a HuGlyIDS used in the methods of treatment described herein is glycosylated in the manner in which a protein is N-glycosylated in human neuronal or glial cells, but is not glycosylated in the manner in which proteins are glycosylated in CHO cells. In another embodiment, an IDS protein expressed in a neuronal or glial cell to give rise to a HuGlyIDS used in the methods of treatment described herein is glycosylated in the manner in which a protein is N-glycosylated in a neuronal or glial cells, wherein such glycosylation is not naturally possible using a prokaryotic host cell, e.g., using E. coli. In one embodiment, an IDS protein expressed in a human neuronal or glial cell to give rise to a HuGlyIDS used in the methods of treatment described herein is glycosylated in the manner in which a protein is N-glycosylated in human neuronal or glial cells, but is not glycosylated in the manner in which proteins are glycosylated in human cells which are not neuronal or glial cells.

(131) Assays for determining the glycosylation pattern of proteins are known in the art. For example, hydrazinolysis can be used to analyze glycans. First, polysaccharides are released from their associated protein by incubation with hydrazine (the Ludger Liberate Hydrazinolysis Glycan Release Kit, Oxfordshire, UK can be used). The nucleophile hydrazine attacks the glycosidic bond between the polysaccharide and the carrier protein and allows release of the attached glycans. N-acetyl groups are lost during this treatment and have to be reconstituted by re-N-acetylation. The free glycans can be purified on carbon columns and subsequently labeled at the reducing end with the fluorophor 2-amino benzamide. The labeled polysaccharides can be separated on a GlycoSep-N column (GL Sciences) according to the HPLC protocol of Royle et al, Anal Biochem 2002, 304(1):70-90. The resulting fluorescence chromatogram indicates the polysaccharide length and number of repeating units. Structural information can be gathered by collecting individual peaks and subsequently performing MS/MS analysis. Thereby the monosaccharide composition and sequence of the repeating unit can be confirmed and additionally in homogeneity of the polysaccharide composition can be identified. Specific peaks of low molecular weight can be analyzed by MALDI-MS/MS and the result used to confirm the glycan sequence. Each peak corresponds to a polymer consisting of a certain number of repeat units and fragments thereof. The chromatogram thus allows measurement of the polymer length distribution. The elution time is an indication for polymer length, while fluorescence intensity correlates with molar abundance for the respective polymer.

(132) Homogeneity of the glycan patterns associated with proteins, as it relates to both glycan length and numbers glycans present across glycosylation sites, can be assessed using methods known in the art, e.g., methods that measure glycan length and hydrodynamic radius. Size exclusion-HPLC allows the measurement of the hydrodynamic radius. Higher numbers of glycosylation sites in a protein lead to higher variation in hydrodynamic radius compared to a carrier with less glycosylation sites. However, when single glycan chains are analyzed, they may be more homogenous due to the more controlled length. Glycan length can measured by hydrazinolysis, SDS PAGE, and capillary gel electrophoresis. In addition, homogeneity can also mean that certain glycosylation site usage patterns change to a broader/narrower range. These factors can be measured by Glycopeptide LC-MS/MS.

(133) N-glycosylation confers numerous benefits on the HuGlyIDS used in the methods described herein. Such benefits are unattainable by production of proteins in E. coli, because E. coli does not naturally possess components needed for N-glycosylation. Further, some benefits are unattainable through protein production in, e.g., CHO cells, because CHO cells lack components needed for addition of certain glycans (e.g., 2,6 sialic acid) and because CHO cells can add glycans, e.g., Neu5Gc not typical to humans, and the ?-Gal antigen which is immunogenic in most individuals and at high concentrations can trigger anaphylaxis. Even further, some benefits are unattainable through protein production in human cells that are not neuronal or glial cells. Thus, the expression of IDS in human neuronal or glial cells results in the production of HuGlyIDS comprising beneficial glycans that otherwise would not be associated with the protein if produced in CHO cells, in E. coli, or in human cells which are not neuronal or glial cells.

(134) 5.1.3. Tyrosine Sulfation

(135) In addition to the N-linked glycosylation sites, hIDS contains a tyrosine (Y) sulfation site (PSSEKY.sup.165ENTKTCRGPD (SEQ ID NO: 47)). (See, e.g., Yang et al., 2015, Molecules 20:2138-2164, esp. at p. 2154 which is incorporated by reference in its entirety for the analysis of amino acids surrounding tyrosine residues subjected to protein tyrosine sulfation. The rules can be summarized as follows: Y residues with E or D within +5 to ?5 position of Y, and where position ?1 of Y is a neutral or acidic charged amino acidbut not a basic amino acid, e.g., R, K, or H that abolishes sulfation).

(136) Importantly, tyrosine-sulfated proteins cannot be produced in E. coli, which naturally does not possess the enzymes required for tyrosine-sulfation. Further, CHO cells are deficient for tyrosine sulfation-they are not secretory cells and have a limited capacity for post-translational tyrosine-sulfation. See, e.g., Mikkelsen & Ezban, 1991, Biochemistry 30: 1533-1537. Advantageously, the methods provided herein call for expression of IDS, e.g., HuGlyIDS, in neurons or glial cells, which are secretory and do have capacity for tyrosine sulfation. Assays for detection tyrosine sulfation are known in the art. See, e.g., Yang et al., 2015, Molecules 20:2138-2164.

(137) Tyrosine-sulfation of hIDSa robust post-translational process in human CNS cellsshould result in improved processing and activity of transgene products. The significance of tyrosine-sulfation of lysosomal proteins has not been elucidated; but in other proteins it has been shown to increase avidity of protein-protein interactions (antibodies and receptors), and to promote proteolytic processing (peptide hormone). (See, Moore, 2003, J Biol. Chem. 278:24243-46; and Bundegaard et al., 1995, The EMBO J 14: 3073-79). The tyrosylprotein sulfotransferase (TPST1) responsible for tyrosine-sulfation (which may occur as a final step in IDS processing) is apparently expressed at higher levels (based on mRNA) in the brain (gene expression data for TPST1 may be found, for example, at the EMBL-EBI Expression Atlas, accessible at http://www.ebi.ac.uk/gxa/home).

(138) 5.2 Constructs and Formulations

(139) For use in the methods provided herein are viral vectors or other DNA expression constructs encoding iduronate-2-sulfatase (IDS), e.g., human IDS (hIDS). For use in the methods provided herein are viral vectors or other DNA expression constructs encoding glycosylated (HuGly) ?-L-iduronidase (IDUA), e.g., human IDUA (hIDUA). The viral vectors and other DNA expression constructs provided herein include any suitable method for delivery of a transgene to the cerebrospinal fluid (CSF). The means of delivery of a transgene include viral vectors, liposomes, other lipid-containing complexes, other macromolecular complexes, synthetic modified mRNA, unmodified mRNA, small molecules, non-biologically active molecules (e.g., gold particles), polymerized molecules (e.g., dendrimers), naked DNA, plasmids, phages, transposons, cosmids, or episomes. In some embodiments, the vector is a targeted vector, e.g., a vector targeted to neuronal cells.

(140) In some aspects, the disclosure provides for a nucleic acid for use, wherein the nucleic acid encodes an IDS, e.g., hIDS, operatively linked to a promoter selected from the group consisting of: cytomegalovirus (CMV) promoter, Rous sarcoma virus (RSV) promoter, MMT promoter, EF-1 alpha promoter, UB6 promoter, chicken beta-actin promoter, CAG promoter, RPE65 promoter and opsin promoter.

(141) In certain embodiments, provided herein are recombinant vectors that comprise one or more nucleic acids (e.g. polynucleotides). The nucleic acids may comprise DNA, RNA, or a combination of DNA and RNA. In certain embodiments, the DNA comprises one or more of the sequences selected from the group consisting of promoter sequences, the sequence of the gene of interest (the transgene, e.g., IDS), untranslated regions, and termination sequences. In certain embodiments, viral vectors provided herein comprise a promoter operably linked to the gene of interest.

(142) In certain embodiments, nucleic acids (e.g., polynucleotides) and nucleic acid sequences disclosed herein may be codon-optimized, for example, via any codon-optimization technique known to one of skill in the art (see, e.g., review by Quax et al., 2015, Mol Cell 59:149-161).

(143) In another aspect, the disclosure provides for a formulation comprising a recombinant nucleotide expression vector encoding human IDS, wherein the formulation is suitable for administration to the cerebrospinal fluid of human brain, so that a depot is formed in the human central nervous system that secretes a recombinant human IDS glycoprotein precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is ?2,6-sialylated, does not contain detectable NeuGc, does not contain ?-Gal antigen, and/or is mannose-6-phosphorylated. For example, the formulation may contain buffer (such as, a buffer having a particular pH, or a buffer containing a particular ingredient) that makes it suitable for administration to the cerebrospinal fluid of human brain, so that a depot is formed in the human central nervous system that secretes a recombinant human IDS glycoprotein precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is ?2,6-sialylated, does not contain detectable NeuGc, does not contain ?-Gal antigen, and/or is mannose-6-phosphorylated. In a specific embodiment, the buffer comprises a physiologically compatible aqueous buffer, a surfactant and optional excipients.

(144) In another aspect, the disclosure provides for a kit comprising a recombinant nucleotide expression vector encoding human IDS and a pharmaceutically acceptable carrier, wherein the recombinant nucleotide expression vector is suitable for administration to the cerebrospinal fluid (CSF) of human brain, so that a depot is formed in the human central nervous system that secretes a recombinant human IDS glycoprotein precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is ?2,6-sialylated, does not contain detectable NeuGc, does not contain detectable ?-Gal antigen, and/or is mannose-6-phosphorylated. In another aspect, the disclosure provides for a kit comprising a formulation comprising a recombinant nucleotide expression vector encoding human IDS, wherein the formulation is suitable for administration to the CSF of human brain, so that a depot is formed in the human central nervous system that secretes a recombinant human IDS glycoprotein precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is ?2,6-sialylated, does not contain detectable NeuGc, does not contain detectable ?-Gal antigen, and/or is mannose-6-phosphorylated. A kit described herein comprises the recombinant nucleotide expression vector or the formulation in one or more containers. Optionally associated with such one or more containers can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration.

(145) The formulations and kits encompassed herein can be used in accordance with the methods for treating a human patient as provided in this disclosure.

(146) 5.2.1. mRNA

(147) In certain embodiments, the vectors provided herein are modified mRNA encoding for the gene of interest (e.g., the transgene, for example, IDS). The synthesis of modified and unmodified mRNA for delivery of a transgene to the CSF is taught, for example, in Hocquemiller et al., 2016, Human Gene Therapy 27(7):478-496, which is incorporated by reference herein in its entirety. In certain embodiments, provided herein is a modified mRNA encoding for IDS, e.g., hIDS.

(148) 5.2.2. Viral Vectors

(149) Viral vectors include adenovirus, adeno-associated virus (AAV, e.g., AAV9, AAVrh10), lentivirus, helper-dependent adenovirus, herpes simplex virus, poxvirus, hemagglutinin virus of Japan (HVJ), alphavirus, vaccinia virus, and retrovirus vectors. Retroviral vectors include murine leukemia virus (MLV)- and human immunodeficiency virus (HIV)-based vectors. Alphavirus vectors include semliki forest virus (SFV) and sindbis virus (SIN). In certain embodiments, the viral vectors provided herein are recombinant viral vectors. In certain embodiments, the viral vectors provided herein are altered such that they are replication-deficient in humans. In certain embodiments, the viral vectors are hybrid vectors, e.g., an AAV vector placed into a helpless adenoviral vector. In certain embodiments, provided herein are viral vectors comprising a viral capsid from a first virus and viral envelope proteins from a second virus. In specific embodiments, the second virus is vesicular stomatitus virus (VSV). In more specific embodiments, the envelope protein is VSV-G protein.

(150) In certain embodiments, the viral vectors provided herein are HIV based viral vectors. In certain embodiments, HIV-based vectors provided herein comprise at least two polynucleotides, wherein the gag and pol genes are from an HIV genome and the env gene is from another virus.

(151) In certain embodiments, the viral vectors provided herein are herpes simplex virus-based viral vectors. In certain embodiments, herpes simplex virus-based vectors provided herein are modified such that they do not comprise one or more immediately early (IE) genes, rendering them non-cytotoxic.

(152) In certain embodiments, the viral vectors provided herein are MLV based viral vectors. In certain embodiments, MLV-based vectors provided herein comprise up to 8 kb of heterologous DNA in place of the viral genes.

(153) In certain embodiments, the viral vectors provided herein are lentivirus-based viral vectors. In certain embodiments, lentiviral vectors provided herein are derived from human lentiviruses. In certain embodiments, lentiviral vectors provided herein are derived from non-human lentiviruses. In certain embodiments, lentiviral vectors provided herein are packaged into a lentiviral capsid. In certain embodiments, lentiviral vectors provided herein comprise one or more of the following elements: long terminal repeats, a primer binding site, a polypurine tract, att sites, and an encapsidation site.

(154) In certain embodiments, the viral vectors provided herein are alphavirus-based viral vectors. In certain embodiments, alphavirus vectors provided herein are recombinant, replication-defective alphaviruses. In certain embodiments, alphavirus replicons in the alphavirus vectors provided herein are targeted to specific cell types by displaying a functional heterologous ligand on their virion surface.

(155) In certain embodiments, the viral vectors provided herein are AAV based viral vectors. In preferred embodiments, the viral vectors provided herein are AAV9 or AAVrh10 based viral vectors. In certain embodiments, the AAV9 or AAVrh10 based viral vectors provided herein retain tropism for CNS cells. Multiple AAV serotypes have been identified. In certain embodiments, AAV-based vectors provided herein comprise components from one or more serotypes of AAV. In certain embodiments, AAV based vectors provided herein comprise components from one or more of AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAVrh10, AAV10 or AAV11. In preferred embodiments, AAV based vectors provided herein comprise components from one or more of AAV8, AAV9, AAVrh10, AAV10, or AAV11 serotypes. AAV9-based viral vectors are used in the methods described herein. Nucleic acid sequences of AAV based viral vectors and methods of making recombinant AAV and AAV capsids are taught, for example, in U.S. Pat. No. 7,282,199 B2, U.S. Pat. No. 7,790,449 B2, U.S. Pat. No. 8,318,480 B2, U.S. Pat. No. 8,962,332 B2 and International Patent Application No. PCT/EP2014/076466, each of which is incorporated herein by reference in its entirety. In one aspect, provided herein are AAV (e.g., AAV9 or AAVrh10)-based viral vectors encoding a transgene (e.g., IDS). In specific embodiments, provided herein are AAV9-based viral vectors encoding IDS. In more specific embodiments, provided herein are AAV9-based viral vectors encoding hIDS.

(156) Provided in particular embodiments are AAV9 vectors comprising an artificial genome comprising (i) an expression cassette containing the transgene under the control of regulatory elements and flanked by ITRs; and (ii) a viral capsid that has the amino acid sequence of the AAV9 capsid protein or is at least 95%, 96%, 97%, 98%, 99% or 99.9% identical to the amino acid sequence of the AAV9 capsid protein (SEQ ID NO: 26) while retaining the biological function of the AAV9 capsid. In certain embodiments, the encoded AAV9 capsid has the sequence of SEQ ID NO: 26 with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 amino acid substitutions and retaining the biological function of the AAV9 capsid. FIG. 6 provides a comparative alignment of the amino acid sequences of the capsid proteins of different AAV serotypes with potential amino acids that may be substituted at certain positions in the aligned sequences based upon the comparison in the row labeled SUBS. Accordingly, in specific embodiments, the AAV9 vector comprises an AAV9 capsid variant that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 amino acid substitutions identified in the SUBS row of FIG. 6 that are not present at that position in the native AAV9 sequence.

(157) In certain embodiments, the AAV that is used in the methods described herein is Anc80 or Anc80L65, as described in Zinn et al., 2015, Cell Rep. 12(6): 1056-1068, which is incorporated by reference in its entirety. In certain embodiments, the AAV that is used in the methods described herein comprises one of the following amino acid insertions: LGETTRP (SEQ ID NO: 56) or LALGETTRP (SEQ ID NO: 57), as described in U.S. Pat. Nos. 9,193,956; 9,458,517; and 9,587,282 and US patent application publication no. 2016/0376323, each of which is incorporated herein by reference in its entirety. In certain embodiments, the AAV that is used in the methods described herein is AAV.7m8, as described in U.S. Pat. Nos. 9,193,956; 9,458,517; and 9,587,282 and US patent application publication no. 2016/0376323, each of which is incorporated herein by reference in its entirety. In certain embodiments, the AAV that is used in the methods described herein is any AAV disclosed in U.S. Pat. No. 9,585,971, such as AAV-PHP.B. In certain embodiments, the AAV that is used in the methods described herein is an AAV disclosed in any of the following patents and patent applications, each of which is incorporated herein by reference in its entirety: U.S. Pat. Nos. 7,906,111; 8,524,446; 8,999,678; 8,628,966; 8,927,514; 8,734,809; 9,284,357; 9,409,953; 9,169,299; 9,193,956; 9,458,517; and 9,587,282 US patent application publication nos. 2015/0374803; 2015/0126588; 2017/0067908; 2013/0224836; 2016/0215024; 2017/0051257; and International Patent Application Nos. PCT/US2015/034799; PCT/EP2015/053335.

(158) In certain embodiments, a single-stranded AAV (ssAAV) may be used supra. In certain embodiments, a self-complementary vector, e.g., scAAV, may be used (see, e.g., Wu, 2007, Human Gene Therapy, 18(2):171-82, McCarty et al, 2001, Gene Therapy, Vol 8, Number 16, Pages 1248-1254; and U.S. Pat. Nos. 6,596,535; 7,125,717; and 7,456,683, each of which is incorporated herein by reference in its entirety).

(159) In certain embodiments, the viral vectors used in the methods described herein are adenovirus based viral vectors. A recombinant adenovirus vector may be used to transfer in the IDS. The recombinant adenovirus can be a first generation vector, with an E1 deletion, with or without an E3 deletion, and with the expression cassette inserted into either deleted region. The recombinant adenovirus can be a second generation vector, which contains full or partial deletions of the E2 and E4 regions. A helper-dependent adenovirus retains only the adenovirus inverted terminal repeats and the packaging signal (phi). The transgene is inserted between the packaging signal and the 3ITR, with or without stuffer sequences to keep the artificial genome close to wild-type size of approx. 36 kb. An exemplary protocol for production of adenoviral vectors may be found in Alba et al., 2005, Gutless adenovirus: last generation adenovirus for gene therapy, Gene Therapy 12:S18-S27, which is incorporated by reference herein in its entirety.

(160) In certain embodiments, the viral vectors used in the methods described herein are lentivirus based viral vectors. A recombinant lentivirus vector may be used to transfer in the IDS. Four plasmids are used to make the construct: Gag/pol sequence containing plasmid, Rev sequence containing plasmids, Envelope protein containing plasmid (i.e. VSV-G), and Cis plasmid with the packaging elements and the IDS gene.

(161) For lentiviral vector production, the four plasmids are co-transfected into cells (i.e., HEK293 based cells), whereby polyethylenimine or calcium phosphate can be used as transfection agents, among others. The lentivirus is then harvested in the supernatant (lentiviruses need to bud from the cells to be active, so no cell harvest needs/should be done). The supernatant is filtered (0.45 ?m) and then magnesium chloride and benzonase added. Further downstream processes can vary widely, with using TFF and column chromatography being the most GMP compatible ones. Others use ultracentrifugation with/without column chromatography. Exemplary protocols for production of lentiviral vectors may be found in Lesch et al., 2011, Production and purification of lentiviral vector generated in 293T suspension cells with baculoviral vectors, Gene Therapy 18:531-538, and Ausubel et al., 2012, Production of CGMP-Grade Lentiviral Vectors, Bioprocess Int. 10(2):32-43, both of which are incorporated by reference herein in their entireties.

(162) In a specific embodiment, a vector for use in the methods described herein is one that encodes an IDS (e.g., hIDS) such that, upon transduction of cells in the CNS, or a relevant cell (e.g., a neuronal cell in vivo or in vitro), a glycosylated variant of IDS is expressed by the transduced cell. In a specific embodiment, a vector for use in the methods described herein is one that encodes an IDS (e.g., hIDS) such that, upon transduction of a cell in the CNS, or a relevant cell (e.g., a neuronal cell in vivo or in vitro), a sulfated variant of IDS is expressed by the cell.

(163) 5.2.3. Promoters and Modifiers of Gene Expression

(164) In certain embodiments, the vectors provided herein comprise components that modulate gene delivery or gene expression (e.g., expression control elements). In certain embodiments, the vectors provided herein comprise components that modulate gene expression. In certain embodiments, the vectors provided herein comprise components that influence binding or targeting to cells. In certain embodiments, the vectors provided herein comprise components that influence the localization of the polynucleotide (e.g., the transgene) within the cell after uptake. In certain embodiments, the vectors provided herein comprise components that can be used as detectable or selectable markers, e.g., to detect or select for cells that have taken up the polynucleotide.

(165) In certain embodiments, the viral vectors provided herein comprise one or more promoters. In certain embodiments, the promoter is a constitutive promoter. In alternate embodiments, the promoter is an inducible promoter. The native IDS gene, like most housekeeping genes, primarily uses a GC-rich promoter. In a preferred embodiment, strong constitutive promoters that provide for sustained expression of hIDS are used. Such promoters include CAG synthetic promoters that contain: Cthe cytomegalovirus (CMV) early enhancer element; Athe promoter as well as the first exon and intron of the chicken beta-actin gene; and Gthe splice acceptor of the rabbit beta-globin gene (see, Miyazaki et al., 1989, Gene 79: 269-277; and Niwa et al., Gene 108: 193-199).

(166) In certain embodiments, the promoter is a CB7 promoter (see Dinculescu et al., 2005, Hum Gene Ther 16: 649-663, incorporated by reference herein in its entirety). In some embodiments, the CB7 promoter includes other expression control elements that enhance expression of the transgene driven by the vector. In certain embodiments, the other expression control elements include chicken ?-actin intron and/or rabbit ?-globin polA signal. In certain embodiments, the promoter comprises a TATA box. In certain embodiments, the promoter comprises one or more elements. In certain embodiments, the one or more promoter elements may be inverted or moved relative to one another. In certain embodiments, the elements of the promoter are positioned to function cooperatively. In certain embodiments, the elements of the promoter are positioned to function independently. In certain embodiments, the viral vectors provided herein comprise one or more promoters selected from the group consisting of the human CMV immediate early gene promoter, the SV40 early promoter, the Rous sarcoma virus (RS) long terminal repeat, and rat insulin promoter. In certain embodiments, the vectors provided herein comprise one or more long terminal repeat (LTR) promoters selected from the group consisting of AAV, MLV, MMTV, SV40, RSV, HIV-1, and HIV-2 LTRs. In certain embodiments, the vectors provided herein comprise one or more tissue specific promoters (e.g., a neuronal cell-specific promoter).

(167) In certain embodiments, the viral vectors provided herein comprise one or more regulatory elements other than a promoter. In certain embodiments, the viral vectors provided herein comprise an enhancer. In certain embodiments, the viral vectors provided herein comprise a repressor. In certain embodiments, the viral vectors provided herein comprise an intron or a chimeric intron. In certain embodiments, the viral vectors provided herein comprise a polyadenylation sequence.

(168) 5.2.4. Signal Peptides

(169) In certain embodiments, the vectors provided herein comprise components that modulate protein delivery. In certain embodiments, the viral vectors provided herein comprise one or more signal peptides. In certain embodiments, the signal peptides allow for the transgene product (e.g., IDS) to achieve the proper packaging (e.g. glycosylation) in the cell. In certain embodiments, the signal peptides allow for the transgene product (e.g., IDS) to achieve the proper localization in the cell. In certain embodiments, the signal peptides allow for the transgene product (e.g., IDS) to achieve secretion from the cell. Examples of signal peptides to be used in connection with the vectors and transgenes provided herein may be found in Table 4. Signal peptides may also be referred to herein as leader sequences or leader peptides.

(170) TABLE-US-00019 TABLE4 Signalpeptidesforusewiththevectors providedherein. SEQ ID NO. SignalPeptide Sequence 2 Oligodendrocyte- MEYQILKMSLCLFILLFLTPGILC myelin glycoprotein (hOMG)signal peptide 3 Cellular MSVRRGRRPARPGTRLSWLLCCSALLSP repressorof AAG E1A-stimulated genes2(hCREG2) signalpeptide 4 V-setandtrans- MEQRNRLGALGYLPPLLLHALLLFVADA membranedomain containing2B (hVSTM2B) signalpeptide 5 Protocadherin MVFSRRGGLGARDLLLWLLLLAAWEVG alpha-1 SG (hPCADHA1) signalpeptide 6 FAM19A1(TAFA1) MAMVSAMSWVLYLWISACA signalpeptide 7 VEGF-Asignal MNFLLSWVHWSLALLLYLHHAKWSQA peptide 8 Fibulin-1 MERAAPSRRVPLPLLLLGGL signalpeptide ALLAAGVDA 9 Vitronectin MAPLRPLLILALLAWVALA signalpeptide 10 Complement MRLLAKIICLMLWAICVA FactorH signalpeptide 11 Opticin MRLLAFLSLLALVLQETGT signalpeptide 12 Albumin MKWVTFISLLFLFSSAYS signalpeptide 13 Chymotrypsi- MAFLWLLSCWALLGTTFG nogen signalpeptide 14 Interleukin-2 MYRMQLLSCIALILALVTNS signalpeptide 15 Trypsinogen-2 MNLLLILTFVAAAVA signalpeptide

(171) 5.2.5. Untranslated Regions

(172) In certain embodiments, the viral vectors provided herein comprise one or more untranslated regions (UTRs), e.g., 3 and/or 5 UTRs. In certain embodiments, the UTRs are optimized for the desired level of protein expression. In certain embodiments, the UTRs are optimized for the mRNA half life of the transgene. In certain embodiments, the UTRs are optimized for the stability of the mRNA of the transgene. In certain embodiments, the UTRs are optimized for the secondary structure of the mRNA of the transgene.

(173) 5.2.6. Inverted Terminal Repeats

(174) In certain embodiments, the viral vectors provided herein comprise one or more inverted terminal repeat (ITR) sequences. ITR sequences may be used for packaging the recombinant gene expression cassette into the virion of the viral vector. In certain embodiments, the ITR is from an AAV, e.g., AAV9 (see, e.g., Yan et al., 2005, J. Virol., 79(1):364-379; U.S. Pat. No. 7,282,199 B2, U.S. Pat. No. 7,790,449 B2, U.S. Pat. No. 8,318,480 B2, U.S. Pat. No. 8,962,332 B2 and International Patent Application No. PCT/EP2014/076466, each of which is incorporated herein by reference in its entirety).

(175) 5.2.7. Transgenes

(176) In certain embodiments, the vectors provided herein encode an IDS transgene. In specific embodiments, the IDS is controlled by appropriate expression control elements for expression in neuronal cells: In certain embodiments, the IDS (e.g., hIDS) transgene comprises the amino acid sequence of SEQ ID NO: 1. In certain embodiments, the IDS (e.g., hIDS) transgene comprises an amino acid sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence set forth in SEQ ID NO: 1.

(177) The HuGlyIDS encoded by the transgene can include, but is not limited to human IDS (hIDS) having the amino acid sequence of SEQ ID NO. 1 (as shown in FIG. 1), and derivatives of hIDS having amino acid substitutions, deletions, or additions, e.g., including but not limited to amino acid substitutions selected from corresponding non-conserved residues in orthologs of IDS shown in FIG. 2, with the proviso with the proviso that such mutations do not include replacement of the cysteine residue at position 84 (C84) which is required for enzyme activity (Millat et al., 1997, Biochem J 326: 243-247); or a mutation that has been identified in severe, severe-intermediate, intermediate, or attenuated MPS II phenotypes e.g., as shown in FIG. 3, or as reported by Sukegawa-Hayasaka et al., 2006, J Inhert Metab Dis 29: 755-761 (reporting attenuated mutants R48P, A85T, W337R, and the truncated mutant Q531X; and severe mutants P86L, S333L, S349I, R468Q, R468L); Millat et al., 1998, BBA 1406: 214-218 (reporting attenuated mutants P480L and P480Q; and severe mutant P86L): and Bonucelli et al., 2001, BBA 1537:233-238, each of which is incorporated by reference herein in its entirety.

(178) For example, amino acid substitutions at a particular position of hIDS can be selected from among corresponding non-conserved amino acid residues found at that position in the IDS orthologs aligned in FIG. 2, with the proviso that such substitutions do not include any of the deleterious mutations shown in FIG. 3 or as reported by Sukegawa-Hayasaka et al., 2006, supra; Millat et al., 1998, supra; or Bonucelli et al., 2001, supra, each of which is incorporated by reference herein in its entirety. The resulting transgene product can be tested using conventional assays in vitro, in cell culture or test animals to ensure that the mutation does not disrupt IDS function. Preferred amino acid substitutions, deletions or additions selected should be those that maintain or increase enzyme activity, stability or half-life of IDS, as tested by conventional assays in vitro, in cell culture or animal models for MPS II. For example, the enzyme activity of the transgene product can be assessed using a conventional enzyme assay with, for example, 4-Methylumbelliferyl ?-L-idopyranosiduronic acid 2-sulfate or 4-methylumbelliferyl sulfate as the substrate (see, e.g., Lee et al., 2015, Clin. Biochem. 48(18):1350-1353, Dean et al., 2006, Clin. Chem. 52(4):643-649 for exemplary IDS enzyme assays that can be used, each of which is incorporated by reference herein in its entirety). The ability of the transgene product to correct MPS II phenotype can be assessed in cell culture; e.g., by transducing MPS II cells in culture with a viral vector or other DNA expression construct encoding hIDS or a derivative; by adding the transgene product or a derivative to MPS II cells in culture; or by co-culturing MPS II cells with human neuronal/glial host cells engineered to express and secrete rhIDS or a derivative, and determining correction of the defect in the MPS II cultured cells, e.g., by detecting IDS enzyme activity and/or reduction in GAG storage in the MPS II cells in culture (see. e.g., Stroncek et al., 1999, Transfusion 39(4):343-350, which is incorporated by reference herein in its entirety).

(179) In some embodiments, a dose of a recombinant AAV of the disclosure is determined using a PCR assay. In some embodiments, the PCR assay is a Poly-A PCR assay. In some embodiments, the PCR assay is a transgene-specific PCR assay. In some embodiments, the dose determined in one assay is different (e.g., higher or lower) than a dose determined in another assay. For example, a dose determined using a transgene-specific PCR assay is higher (e.g., about 50% higher) than a dose determined using a Poly-A-specific PCR assay. In some embodiments, a dose determined by a transgene-specific PCR assay is higher by about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or higher than about 75% higher than a dose determined by a Poly-A-specific PCR assay. In some embodiments, a dose of 2.0?10.sup.11 GC/g brain mass, where the number of genome copies is determined using a Poly-A-specific PCR assay is equivalent to a dose of 2.9?10.sup.11 GC/g brain mass, where the number of genome copies is determined using a transgene-specific PCR assay. In some embodiments, the total dose administered to a subject accounts for the estimated brain mass of the subject, which can be determined using a magnetic resonance imaging (MRI) screening.

(180) 5.2.8. Constructs

(181) In certain embodiments, the viral vectors provided herein comprise the following elements in the following order: a) a first ITR sequence, b) a first linker sequence, c) a promoter sequence, d) a second linker sequence, e) an intron sequence, f) a third linker sequence, g) a sequence encoding the transgene (e.g., IDS), h) a fourth linker sequence, i) a poly A sequence, j) a fifth linker sequence, and k) a second ITR sequence.

(182) In certain embodiments, the viral vectors provided herein comprise the following elements in the following order: a) a promoter sequence, and b) a sequence encoding the transgene (e.g., IDS). In certain embodiments, the viral vectors provided herein comprise the following elements in the following order: a) a promoter sequence, and b) a sequence encoding the transgene (e.g., IDS), wherein the transgene comprises a signal peptide.

(183) In certain embodiments, the viral vectors provided herein comprise the following elements in the following order: a) a first ITR sequence, b) a first linker sequence, c) a promoter sequence, d) a second linker sequence, e) an intron sequence, f) a third linker sequence, g) a first UTR sequence, h) a sequence encoding the transgene (e.g., IDS), i) a second UTR sequence, j) a fourth linker sequence, k) a poly A sequence, 1) a fifth linker sequence, and m) a second ITR sequence.

(184) In certain embodiments, the viral vectors provided herein comprise the following elements in the following order: a) a first ITR sequence, b) a first linker sequence, c) a promoter sequence, d) a second linker sequence, e) an intron sequence, f) a third linker sequence, g) a first UTR sequence, h) a sequence encoding the transgene (e.g., IDS), i) a second UTR sequence, j) a fourth linker sequence, k) a poly A sequence, 1) a fifth linker sequence, and m) a second ITR sequence, wherein the transgene comprises a signal peptide, and wherein the transgene encodes hIDS.

(185) In a specific embodiment, the viral vector described herein comprises the elements and in the order as illustrated in FIG. 5.

(186) 5.2.9. Manufacture and Testing of Vectors

(187) The viral vectors provided herein may be manufactured using host cells. The viral vectors provided herein may be manufactured using mammalian host cells, for example, A549, WEHI, 10T1/2, BHK, MDCK, COS1, COS7, BSC 1, BSC 40, BMT 10, VERO, W138, HeLa, 293, Saos, C2C12, L, HT1080, HepG2, primary fibroblast, hepatocyte, and myoblast cells. The viral vectors provided herein may be manufactured using host cells from human, monkey, mouse, rat, rabbit, or hamster.

(188) The host cells are stably transformed with the sequences encoding the transgene and associated elements (i.e., the vector genome), and the means of producing viruses in the host cells, for example, the replication and capsid genes (e.g., the rep and cap genes of AAV). For a method of producing recombinant AAV vectors with AAV8 capsids, see Section IV of the Detailed Description of U.S. Pat. No. 7,282,199 B2, which is incorporated herein by reference in its entirety. Genome copy titers of said vectors may be determined, for example, by TAQMAN? analysis. Virions may be recovered, for example, by CsCl.sub.2 sedimentation.

(189) In vitro assays, e.g., cell culture assays, can be used to measure transgene expression from a vector described herein, thus indicating, e.g., potency of the vector. For example, the HT-22, SK-N-MC, HCN-1A, HCN-2, NT2, SH-SY5y, hNSC11, or ReNcell VM cell lines, or other cell lines that are derived from neuronal or glial cells or progenitors of neuronal or glial cells can be used to assess transgene expression. Once expressed, characteristics of the expressed product (i.e., HuGlyIDS) can be determined, including determination of the glycosylation and tyrosine sulfation patterns associated with the HuGlyIDS.

(190) 5.2.10. Compositions

(191) Compositions are described comprising a vector encoding a transgene described herein and a suitable carrier. A suitable carrier (e.g., for administration to the CSF, and, for example, to neuronal cells) would be readily selected by one of skill in the art.

(192) 5.3 Gene Therapy

(193) Methods are described for the administration of a therapeutically effective amount of a transgene construct to human subjects having MPS II. More particularly, methods for administration of a therapeutically effective amount of a transgene construct to patients having MPS II, in particular, for administration to the CSF are described. In particular embodiments, such methods for administration to the CSF of a therapeutically effective amount of a transgene construct can be used to treat to patients having Hunter's syndrome.

(194) 5.3.1. Target Patient Populations

(195) In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients diagnosed with MPS II. In specific embodiments, the patients have been diagnosed with mild MPS II. In specific embodiments, the patients have been diagnosed with severe MPS II. In specific embodiments, the patients have been diagnosed with Hunter's syndrome. In specific embodiments, the patients have been diagnosed with neuronopathic MPS II. In some embodiments, a patient has been diagnosed with hepatosplenomegaly, has a symptom associated with hepatosplenomegaly, is suspected of having hepatosplenomegaly, and/or has a predisposition to suffer from hepatosplenomegaly. Examples of symptoms associated with hepatosplenomegaly include, but are not limited to, brown urine, clay-colored bowel movements, enlarged or swollen abdomen, fever, itching, jaundice or yellowing of the eyes and skin, nausea, pain (e.g., I the upper right portion of the stomach), fatigue, and/or vomiting. In some embodiments, a patient diagnosed with MPS II has hepatosplenomegaly. In some embodiments, a patient is suffering from hepatosplenomegaly associated with MPS II. In some embodiments, a patient is being treated or has been treated with ERT.

(196) In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients diagnosed with MPS II who have been identified as responsive to treatment with IDS, e.g., hIDS.

(197) In certain embodiments, therapeutically effective doses of the recombinant vector are administered to pediatric patients. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are less than three years old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are aged 2 to 4 years old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are 4 months old or older and less than 5 years old. In a specific embodiment, therapeutically effective doses of the recombinant vector are administered to patients that have severe MPS 11 and are 4 months old or older and less than 5 years old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are 5 years old or older and less than 18 years old. In a specific embodiment, therapeutically effective doses of the recombinant vector are administered to patients that have neuronopathic MPS II and are 5 years old or older and less than 18 years old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are 18 months old or older and 8 years old or younger. In a specific embodiment, therapeutically effective doses of the recombinant vector are administered to patients that are pediatric male patients and are 18 months old or older and 8 years old or younger. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are aged 3 to 8 years old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are aged 8 to 16 years old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are aged 5 to 18 years old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are 10 years old or younger. In a specific embodiment, therapeutically effective doses of the recombinant vector are administered to patients that have severe MPS II and are 10 years old or younger. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are 18 years old or younger. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are more than 5 years old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are more than 10 years old.

(198) In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are 4, 5, 6, 7, 8, 9, 10, or 11 months old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are about 4, 5, 6, 7, 8, 9, 10, or 11 months old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are 4-5, 5-6, 6-7, 7-8, 8-9, 9-10, 10-11, or 11-12 months old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are about 4-5, 5-6, 6-7, 7-8, 8-9, 9-10, 10-11, or 11-12 months old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are 1, 2, 3, 4, or 5 years old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are about 1, 2, 3, 4, or 5 years old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are 1-2, 2-3, 3-4, 4-5, or 5-6 years old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are about 1-2, 2-3, 3-4, 4-5, or 5-6 years old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are 5-6, 6-7, 7-8, 8-9, 9-10, 10-11, 11-12, 12-13, 13-14, 14-15, 15-16, 16-17, 17-18, or 18-19 years old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are about 5-6, 6-7, 7-8, 8-9, 9-10, 10-11, 11-12, 12-13, 13-14, 14-15, 15-16, 16-17, 17-18, or 18-19 years old.

(199) In certain embodiments, therapeutically effective doses of the recombinant vector are administered to adolescent patients. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to adult patients. In some embodiments, therapeutically effective doses of the recombinant vector are administered to male patients. In other embodiments, therapeutically effective doses of the recombinant vector are administered to female patients.

(200) In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients diagnosed with MPS II who have been identified as responsive to treatment with IDS, e.g., hIDS, injected into the CSF prior to treatment with gene therapy.

(201) 5.3.2. Dosage and Mode of Administration

(202) In certain embodiments, therapeutically effective doses of the recombinant vector are administered to the CSF via intrathecal administration (i.e., injection into the subarachnoid space so that the recombinant vectors distribute through the CSF and transduce cells in the CNS). This can be accomplished in a number of wayse.g., by intracranial (cisternal or ventricular) injection, or injection into the lumbar cistern. In certain embodiments, intrathecal administration is performed via intracisternal (IC) injection (e.g., into the cisterna magna). In specific embodiments, intracisternal injection is performed by CT-guided suboccipital puncture. In specific embodiments, intrathecal injection is performed by lumbar puncture. In specific embodiments, injection into the subarachnoid space is performed by C1-2 puncture if feasible for the patient. Alternatively, intracerebroventricular (ICV) administration (a more invasive technique used for the introduction of antiinfective or anticancer drugs that do not penetrate the blood-brain barrier), for example, image-assisted ICV injection, can be used to instill the recombinant vectors directly into the ventricles of the brain. In a specific embodiment, the recombinant vector is administered via a single image-assisted ICV injection. In a further specific embodiment, the recombinant vector is administered via a single image-assisted ICV injection with immediate removal of the administration catheter. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to the CNS via intranasal administration. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to the CNS via intraparenchymal injection. In certain embodiments, intraparenchymal injection is targeted to the striatum. In certain embodiments, intraparenchymal injection is targeted to the white matter. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to the CSF by any means known to the art, for example, by any means disclosed in Hocquemiller et al., 2016, Human Gene Therapy 27(7):478-496, which is hereby incorporated by reference in its entirety.

(203) In preferred embodiments, for intrathecal administration (including IC and ICV administration), therapeutically effective doses of the recombinant vector are administered to the CSF in an injection volume that does not exceed 10% of the total CSF volume, which total CSF volume is about 50 mL in infants and about 150 mL in adults. A carrier suitable for intrathecal injection, such as Elliott's B Solution or a modified Elliott's B Solution, should be used as a vehicle for the recombinant vectors. Elliott's B Solution (generic name: sodium chloride, sodium bicarbonate, anhydrous dextrose, magnesium sulfate, potassium chloride, calcium chloride and sodium phosphate) is a sterile, nonpyrogenic, isotonic solution containing no bacteriostatic preservatives and is used as a diluent for intrathecal administration of chemotherapeutics. The modified Elliott's B solution includes 8.77 g/L sodium chloride, 0.244 g/L magnesium chloride, 0.0278 g/L sodium phosphate monobasic monohydrate, 0.114 g/L sodium phosphate dibasic anhydrous, 0.224 g/L potassium chloride, 0.206 g/L calcium chloride, 0.793 g/L dextrose, 0.001% poloxamer 188, pH 7.26. In some embodiments, the AAV or a composition comprising the AAV of the present disclosure is provided in a modified Elliott's B solution for intrathecal administration.

(204) In one embodiment, a non-replicating recombinant AAV9 vector expressing human iduronate-2-sulfatase (IDS) is used for treatment. In certain embodiments, the IDS expression cassette is flanked by inverted terminal repeats (ITRs) and expression is driven by a hybrid of the cytomegalovirus (CMV) enhancer and the chicken beta actin promoter (CB7). In certain embodiments, the transgene includes the chicken beta actin intron and a rabbit beta-globin polyadenylation (polyA) signal.

(205) In certain embodiments, the recombinant nucleotide expression vector is administered at a dose that is dependent on the human subject's brain mass. In preferred embodiments, the brain mass is determined by brain magnetic resonance imaging (MRI) of the human subject's brain. In certain embodiments, the human subject's brain mass is converted from the human subject's brain volume by multiplying the human subject's brain volume in cm.sup.3 by a factor of 1.046 g/cm3, wherein the human subject's brain volume is obtained from the human subject's brain MRI. In some embodiments, a dose is the number of genome copies per weight of brain mass. In some embodiments, the number of genome copies in a dose (e.g., the dose of the recombinant nucleotide expression vector) is determined by a Poly-A-specific PCR assay. In some embodiments, the number genome copies in a dose (e.g., the dose of the recombinant nucleotide expression vector) is determined by a transgene-specific PCR assay. In some embodiments, the weight of brain mass is determined by MRI.

(206) In certain embodiments, the rAAV9.hIDS is administered IC (by suboccipital injection) as a single flat dose ranging from 1.4?10.sup.10 GC (1.1?10.sup.10 GC/g brain mass) to 7.0?10.sup.3 GC (5.6?10.sup.10 GC/g brain mass) in a volume of about 5 to 20 ml. In the event the patient has neutralizing antibodies to AAV, doses at the high range may be used. In some embodiments, a single dose of an rAAV encoding hIDS is administered to the subject in the central nervous system (e.g., in the cerebrospinal fluid) and, surprisingly, treatment effects are observed outside of the CNS. For example, changes in organ sizes are observed outside of the CNS (e.g., spleen or liver) after the rAAV of the disclosure is administered to a subject in the CNS. In some embodiments, changes in biomarker levels (e.g., D2S6, HS, total GAG, and/or anti-IDS antibody) are detected outside of the CNS after administration of the rAAV of the disclosure in the cerebrospinal fluid (e.g., changes in biomarker levels detected in the liver, spleen, urine, plasma, or blood). In some embodiments, no additional therapy for MPS II is administered to the subject outside the CNS.

(207) In certain embodiments, the recombinant vector described herein may be administered intrathecally as a single flat dose ranging from about 1.3?10.sup.10 GC/g brain mass to about 6.5?10.sup.10 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In a specific embodiment, the recombinant vector described herein may be administered intrathecally as a single flat dose at about 1.3?10.sup.10 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In a specific embodiment, the recombinant vector described herein may be administered intrathecally as a single flat dose at about 1.9?10.sup.10 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In another specific embodiment, the recombinant vector described herein may be administered intrathecally as a single flat dose at about 6.5?10.sup.10 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In a specific embodiment, the recombinant vector described herein may be administered intrathecally as a single flat dose at about 9.6?10.sup.10 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In a specific embodiment, the recombinant vector described herein may be administered intrathecally as a single flat dose at about 2.0?10.sup.10 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In a specific embodiment, the recombinant vector described herein may be administered intrathecally as a single flat dose at about 2.9?10.sup.11 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In another specific embodiment, the recombinant vector described herein may be administered intrathecally as a single flat dose at Dose 1 or Dose 2 as listed in and according to Table 5 below (for example, when the human patient is 4 months old or older and less than 5 years old).

(208) In certain embodiments, the recombinant vector described herein may be administered intrathecally as a single flat dose ranging from about 1.3?10.sup.10 GC/g brain mass to about 2.0?10.sup.11 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In certain embodiments, the recombinant vector described herein may be administered intrathecally as a single flat dose ranging from about 1.3?10.sup.10 GC/g brain mass to about 2.9?10.sup.11 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In a specific embodiment, the recombinant vector described herein may be administered intrathecally as a single flat dose at about 2.0?10.sup.11 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In a specific embodiment, the recombinant vector described herein may be administered intrathecally as a single flat dose at about 2.9?10.sup.11 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In another specific embodiment, the recombinant vector described herein may be administered intrathecally as a single flat dose at Dose 3 as listed in and according to Table 6 below (for example, when the human patient is 4 months old or older and less than 5 years old).

(209) In certain embodiments, the recombinant vector described herein may be administered by IC administration as a single flat dose ranging from about 1.3?10.sup.10 GC/g brain mass to about 6.5?10.sup.10 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In a specific embodiment, the recombinant vector described herein may be administered by IC administration as a single flat dose at about 1.3?10.sup.10 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In a specific embodiment, the recombinant vector described herein may be administered by IC administration as a single flat dose at about 1.9?10.sup.10 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In another specific embodiment, the recombinant vector described herein may be administered by IC administration as a single flat dose at about 6.5?10.sup.10 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In a specific embodiment, the recombinant vector described herein may be administered by IC administration as a single flat dose at about 9.6?10.sup.10 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In another specific embodiment, the recombinant vector described herein may be administered by IC administration as a single flat dose at Dose 1 or Dose 2 as listed in and according to Table 5 below (for example, when the human patient is 4 months old or older and less than 5 years old).

(210) In certain embodiments, the recombinant vector described herein may be administered by IC administration as a single flat dose ranging from about 1.3?10.sup.10 GC/g brain mass to about 2.0?10.sup.11 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In certain embodiments, the recombinant vector described herein may be administered by IC administration as a single flat dose ranging from about 1.3?10.sup.10 GC/g brain mass to about 2.9?10.sup.11 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In a specific embodiment, the recombinant vector described herein may be administered by IC administration as a single flat dose at about 2.0?10.sup.11 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In a specific embodiment, the recombinant vector described herein may be administered by IC administration as a single flat dose at about 2.9?10.sup.11 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In another specific embodiment, the recombinant vector described herein may be administered by IC administration as a single flat dose at Dose 3 as listed in and according to Table 6 below (for example, when the human patient is 4 months old or older and less than 5 years old).

(211) In certain embodiments, the recombinant vector described herein may be administered by ICV administration as a single flat dose ranging from about 1.3?10.sup.10 GC/g brain mass to about 6.5?10.sup.10 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In a specific embodiment, the recombinant vector described herein may be administered by ICV administration as a single flat dose at about 1.3?10.sup.10 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In a specific embodiment, the recombinant vector described herein may be administered by ICV administration as a single flat dose at about 1.9?10.sup.10 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In another specific embodiment, the recombinant vector described herein may be administered by ICV administration as a single flat dose at about 6.5?10.sup.10 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In a specific embodiment, the recombinant vector described herein may be administered by ICV administration as a single flat dose at about 9.6?10.sup.10 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In another specific embodiment, the recombinant vector described herein may be administered by ICV administration as a single flat dose at Dose 1 or Dose 2 as listed in and according to Table 5 below (for example, when the human patient is 4 months old or older and less than 5 years old).

(212) In certain embodiments, the recombinant vector described herein may be administered by ICV administration as a single flat dose ranging from about 1.3?10.sup.10 GC/g brain mass to about 2.0?10.sup.11 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In certain embodiments, the recombinant vector described herein may be administered by ICV administration as a single flat dose ranging from about 1.3?10.sup.10 GC/g brain mass to about 2.9?10.sup.10 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In a specific embodiment, the recombinant vector described herein may be administered by ICV administration as a single flat dose at about 2.0?10.sup.11 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In a specific embodiment, the recombinant vector described herein may be administered by ICV administration as a single flat dose at about 2.9?10.sup.11 GC/g brain mass (for example, when the human patient is 4 months old or older and less than 5 years old). In another specific embodiment, the recombinant vector described herein may be administered by ICV administration as a single flat dose at Dose 3 as listed in and according to Table 6 below (for example, when the human patient is 4 months old or older and less than 5 years old).

(213) TABLE-US-00020 TABLE 5 Total Dose Administered by Brain Mass (Dose 1 or Dose 2) Dose Levels Dose 1 Dose 2 Total GC* Total GC* Brain Mass (in g) (1.3 ? 10.sup.10 (6.5 ? 10.sup.10 Min Max Target GC/g brain mass) GC/g brain mass) 700 650 8.5 ? 10.sup.12 4.2 ? 10.sup.13 701 800 750 9.8 ? 10.sup.12 4.9 ? 10.sup.13 801 900 850 1.1 ? 10.sup.13 5.5 ? 10.sup.13 901 1050 975 1.3 ? 10.sup.13 6.3 ? 10.sup.13 1051 1200 1125 1.5 ? 10.sup.13 7.3 ? 10.sup.13 1201 1300 1.7 ? 10.sup.13 8.5 ? 10.sup.13 *GC determined based on a Poly-A-specific PCR assay

(214) TABLE-US-00021 TABLE 6 Total Dose Administered by Brain Mass (Dose 3) Dose 3 Total GC determined by Poly-A-specific PCR Brain Mass (in g) assay (2.0 ? 10.sup.11 Min Max Target GC/g brain mass) 474 450 9.0 ? 10.sup.13 475 524 500 1.0 ? 10.sup.14 525 574 550 1.1 ? 10.sup.14 575 624 600 1.2 ? 10.sup.14 625 674 650 1.3 ? 10.sup.14 675 724 700 1.4 ? 10.sup.14 725 774 750 1.5 ? 10.sup.14 775 824 800 1.6 ? 10.sup.14 825 874 850 1.7 ? 10.sup.14 875 924 900 1.8 ? 10.sup.14 925 974 950 1.9 ? 10.sup.14 975 1024 1000 2.0 ? 10.sup.14 1025 1074 1050 2.1 ? 10.sup.14 1075 1124 1100 2.2 ? 10.sup.14 1125 1174 1150 2.3 ? 10.sup.14 1175 1224 1200 2.4 ? 10.sup.14 1225 1274 1250 2.5 ? 10.sup.14 1275 >1300 1300 2.6 ? 10.sup.14 Total Dose Administered by Brain Mass Dose 3 EC Dose 3 EC Total GC determined by Transgene PCR assay Brain Mass (in g) (2.9 ? 10.sup.11 GC/g Min Max Target brain mass) 474 450 1.3 ? 10.sup.14 475 524 500 1.5 ? 10.sup.14 525 574 550 1.6 ? 10.sup.14 575 624 600 1.8 ? 10.sup.14 625 674 650 1.9 ? 10.sup.14 675 724 700 2.1 ? 10.sup.14 725 774 750 2.2 ? 10.sup.14 775 824 800 2.4 ? 10.sup.14 825 874 850 2.4 ? 10.sup.14 875 924 900 2.6 ? 10.sup.14 925 974 950 2.8 ? 10.sup.14 975 1024 1000 2.9 ? 10.sup.14 1025 1074 1050 3.1 ? 10.sup.14 1075 1124 1100 3.2 ? 10.sup.14 1125 1174 1150 3.4 ? 10.sup.14 1175 1224 1200 3.5 ? 10.sup.14 1225 1274 1250 3.7 ? 10.sup.14 1275 >1300 1300 3.8 ? 10.sup.14

(215) In a specific embodiment, the recombinant vector described herein may be administered intrathecally as a single flat dose at about 6.5?10.sup.10 GC/g brain mass (for example, when the human patient is 5 years old or older and less than 18 years old). In another specific embodiment, the recombinant vector described herein may be administered intrathecally as a single flat dose as listed in and according to Table 7 below (for example, when the human patient is 5 years old or older and less than 18 years old).

(216) In a specific embodiment, the recombinant vector described herein may be administered by IC administration as a single flat dose at about 6.5?10.sup.10 GC/g brain mass (for example, when the human patient is 5 years old or older and less than 18 years old). In another specific embodiment, the recombinant vector described herein may be administered by IC administration as a single flat dose as listed in and according to Table 7 below (for example, when the human patient is 5 years old or older and less than 18 years old).

(217) In a specific embodiment, the recombinant vector described herein may be administered by ICV administration as a single flat dose at about 6.5?10.sup.10 GC/g brain mass (for example, when the human patient is 5 years old or older and less than 18 years old). In another specific embodiment, the recombinant vector described herein may be administered by ICV administration as a single flat dose as listed in and according to Table 7 below (for example, when the human patient is 5 years old or older and less than 18 years old).

(218) TABLE-US-00022 TABLE 7 Total Dose Administered by Brain Mass Dose: Total GC determined by Poly-A-specific Target Brain PCR assay Brain Mass (in g) Mass (6.5 ? 10.sup.10 Min Max (in g) GC/g brain mass) 801 900 850 5.5 ? 10.sup.13 901 1050 975 6.3 ? 10.sup.13 1051 1200 1125 7.3 ? 10.sup.13 1201 1300 8.5 ? 10.sup.13

(219) 5.4 Combination Therapies

(220) Combinations of administration of the HuGlyIDS to the CSF accompanied by administration of other available treatments are encompassed by the methods of the invention. The additional treatments may be administered before, concurrently or subsequent to the gene therapy treatment. Available treatments for MPS II that could be combined with the gene therapy of the invention include but are not limited to enzyme replacement therapy (ERT) using idursulfase administered systemically or to the CSF; and/or HSCT therapy. In another embodiment, ERT can be administered using the rHuGlyIDS glycoprotein produced in human neuronal and glial cell lines by recombinant DNA technology. Human neuronal and glial cell lines that can be used for such recombinant glycoprotein production include but are not limited to HT-22, SK-N-MC, HCN-1 A, HCN-2, NT2, SH-SY5y, hNSC11, or ReNcell VM to name a few. To ensure complete glycosylation, especially sialylation, and tyrosine-sulfation, the cell line used for production can be enhanced by engineering the host cells to co-express ?-2,6-sialyltransferase (or both ?-2,3- and ?-2,6-sialyltransferases) and/or TPST-1 and TPST-2 enzymes responsible for tyrosine-O-sulfation.

(221) 5.5 Biomarkers/Sampling/Monitoring Efficacy

(222) Efficacy may be monitored by measuring cognitive function (e.g., prevention or decrease in neurocognitive decline); reductions in biomarkers of disease (such as GAG, including heparan sulfate and dermatan sulfate) in CSF and or serum; and/or increase in IDS enzyme activity in CSF and/or serum. Signs of inflammation and other safety events may also be monitored.

(223) In one aspect, provided herein is a method of monitoring efficacy by determining if a subject undergoing ERT treatment or a subject who has received ERT treatment can discontinue ERT treatment after administration of a gene therapy (e.g., rAAV encoding hIDS) of the disclosure. For example, provided herein is a method of treating and/or identifying a subject diagnosed with MPS II (e.g., a subject who is likely to be responsive to discontinuing treatment with ERT), comprising: (a) administering a therapeutically effective amount of a gene therapy (e.g., an rAAV encoding hIDS) of the disclosure to the subject, wherein the subject was treated with ERT or is being treated with ERT; (b) identifying the subject as being likely to be responsive to discontinuing ERT treatment, comprising: i. obtaining or having obtained a biological sample from the subject; ii. determining the level of at least one biomarker in the biological sample; and iii. identifying the subject as being likely to be responsive to discontinuing ERT treatment if the level of the biomarker in the biological sample is different (e.g., higher or lower) than a reference (e.g., reference level of the at least one biomarker); and (c) discontinuing ERT treatment in the subject. In some embodiments, a biomarker is D2S6, HS, total GAG, and/or anti-IDS antibody. In some embodiments, ERT is recombinant idursulfase. In some embodiments, the subject diagnosed with MPS II has hepatosplenomegaly.

(224) In another aspect, provided herein is a method of selectively treating a human subject with MPS II, comprising administering to the subject a therapeutically effective amount of an rAAV encoding hIDS, wherein the subject was treated with ERT or is being treated with ERT, and wherein the subject has been determined likely to be responsive to discontinuing treatment with ERT according to a method comprising: (a) obtaining a biological sample from the subject; and (b) determining the level of at least one biomarker in the biological sample; wherein the subject is determined likely to be responsive to discontinuing treatment with ERT when the level of the at least one biomarker is different (e.g., higher or lower) than a reference. In some embodiments, a biomarker is D2S6, HS, total GAG, and/or anti-IDS antibody. In some embodiments, ERT is recombinant idursulfase. In some embodiments, the subject diagnosed with MPS II has hepatosplenomegaly.

(225) In another aspect provided herein is a method of identifying or diagnosing a subject as having neuronopathic or non-neuronopathic MPS II or MPS I. In some embodiments, the method comprises determining the level of one or more disaccharides (e.g., D0A0, D0S0, D0A6, D2S6) in a biological sample from a subject. In some embodiments, the method comprises determining the level of undegraded glycosaminoglycans (GAGs) in a biological sample from a subject. In some embodiments, the subject is identified or diagnosed as having neuronopathic MPS II or MPS I if the level of one or more disaccharides (e.g., D0A0, D0S0, D0A6, and/or D2S6) is elevated as compared to a reference level. In some embodiments, the subject is identified or diagnosed as having neuronopathic MPS II or MPS I if the level of GAG heparan sulfate (HS) is elevated (e.g., in the brain) as compared to a reference level. In some embodiments, the total amount of heparin sulfate (t-HS) is the sum of four disaccharides (D2S6, D0A0, D0S0, D0A6) in cerebrospinal fluid (CSF) following enzymatic digestion (e.g., as determined based on a bioanalytical mass spectrometry method). In some embodiments, an elevated level of D2S6 in e.g., CSF of a subject (e.g., presymptomatic subject) is indicative of neuronopathic MPS II or MPS I. In some embodiments, the level of D2S6 is indicative of iduronate-2-sulfatase enzyme activity and can be used for therapy monitoring. In some embodiments, the one or more disaccharides comprises one or more of D0A0, D0S0, D0A6, D2S6, or a combination thereof. In another aspect provided herein is a method of identifying or diagnosing a subject as having neuronopathic or non-neuronopathic MPS II or MPS I, wherein the subject is identified or diagnosed as having neuronopathic MPS II if the level of one or more disaccharides (e.g., D0A0, D0S0, D0A6, and/or D2S6) in a biological sample from the subject is elevated as compared to a reference level. In some embodiments, the subject is presymptomatic or has no visible or detectable MPS II or MPS I symptom. In some embodiments, the subject has or has been diagnosed with MPS I or MPS II. In some embodiments, the reference level is the level of one or more disaccharides (e.g., D0A0, D0S0, D0A6, and/or D2S6) in a biological sample from one or more healthy subjects and/or from one or more non-neuronopathic subjects. In some embodiments, the reference level is the level of D2S6 in a biological sample (e.g., CSF sample) from one or more healthy subjects and/or from one or more non-neuronopathic subjects. In some embodiments, the reference level is a pre-determined level. In some embodiments, the level of one or more disaccharides (e.g., D0A0, D0S0, D0A6, D2S6) is about or at least about 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 25%, 30%, 35%, 40%, or higher than 40% of the total heparan sulfate disaccharides (HS) in a biological sample from a subject (e.g., a subject with MPS I or MPS II). In some embodiments, the level of one or more disaccharides (e.g., D0A0, D0S0, D0A6, and/or D2S6) is about or at least about 20% the total heparan sulfate disaccharides (HS) in a biological sample from a subject (e.g., a subject with MPS I or MPS II). In some embodiments, the level of one or more disaccharides (e.g., D0A0, D0S0, D0A6, and/or D2S6) in a biological sample from a subject (e.g., a subject with MPS I or MPS II) is about or at least about 5%, 10%, 115, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or more than 90?/% higher than the level of one or more disaccharides (e.g., D0A0, D0S0, D0A6, and/or D2S6) in a biological sample from a reference (e.g., a healthy subject). In some embodiments, the level of total heparin sulfate (e.g., D0A0, D0S0, D0A6, D2S6) is about or at least about 250 ng/mL, 275 ng/mL, 300 ng/mL, 325 ng/mL, 350 ng/mL, 375 ng/mL, 400 ng/mL, 425 ng/mL, 450 ng/mL, 475 ng/mL, 500 ng/mL, 525 ng/mL, 550 ng/mL, 575 ng/mL, 600 ng/mL, 625 ng/mL, 650 ng/mL, 675 ng/mL, 700 ng/mL, 725 ng/mL, 750 ng/mL, 775 ng/mL, 800 ng/mL, 825 ng/mL, 850 ng/mL, 875 ng/mL, 900 ng/mL, 925 ng/mL, 950 ng/mL, 975 ng/mL, 1000 ng/mL, or more than 1000 ng/mL. In some embodiments, the level of total heparin sulfate (e.g., D0A0, D0S0, D0A6, and/or D2S6) is about or at least about 500 ng/mL. In some embodiments, the level of total heparin sulfate (e.g., D0A0, D0S0, D0A6, and/or D2S6) is about or at least about 600 ng/mL. In some embodiments, the level of total heparin sulfate (e.g., D0A0, D0S0, D0A6, and/or D2S6) is about or at least about 700 ng/mL. In some embodiments, the level of total heparin sulfate (e.g., D0A0, D0S0, D0A6, and/or D2S6) is about or at least about 800 ng/mL. In some embodiments, the level of total heparin sulfate (e.g., D0A0, D0S0, D0A6, and/or D2S6) is between about 500 ng/mL to about 1000 ng/mL, about 300 ng/mL to about 1000 ng/mL, about 400 ng/mL to about 1000 ng/mL, about 550 ng/mL to about 1000 ng/mL about 600 ng/mL to about 1000 ng/mL, about 700 ng/mL to about 1000 ng/mL 500 ng/mL to about 900 ng/mL, about 300 ng/mL to about 900 ng/mL, about 400 ng/mL to about 900 ng/mL, about 550 ng/mL to about 900 ng/mL about 600 ng/mL to about 900 ng/mL, or about 700 ng/mL to about 900 ng/mL. In some embodiments, the level of at least one heparin sulfate (e.g., D0A0, D0S0, D0A6, and/or D2S6) is about or at least about 50 ng/mL, 75 ng/mL, 80 ng/mL, 85 ng/mL, 90 ng/mL, 95 ng/mL, 100 ng/mL, 105 ng/mL, 110 ng/mL, 115 ng/mL, 120 ng/mL, 125 ng/mL, 130 ng/mL, 135 ng/mL, 140 ng/mL, 145 ng/mL, 150 ng/mL, 155 ng/mL, 160 ng/mL, 165 ng/mL, 170 ng/mL, 175 ng/mL, 180 ng/mL, 185 ng/mL, 190 ng/mL, 195 ng/mL, 200 ng/mL, 210 ng/mL, 220 ng/mL, 230 ng/mL, 240 ng/mL, 250 ng/mL, 260 ng/mL, 270 ng/mL, 280 ng/mL, 290 ng/mL, 300 ng/mL, 310 ng/mL, 320 ng/mL, 330 ng/mL, 340 ng/mL, 350 ng/mL, 360 ng/mL, 370 ng/mL, 380 ng/mL, 390 ng/mL, 400 ng/mL, or more than 400 ng/mL. In some embodiments, the level of at least one heparin sulfate (e.g., D0A0, D0S0, D0A6, and/or D2S6) is about or at least about 50 ng/mL, 60 ng/mL, 70 ng/mL, 80 ng/mL, 90 ng/mL, 100 ng/mL, 110 ng/mL, 120 ng/mL, 130 ng/mL, 140 ng/mL, 150 ng/mL, 160 ng/mL, 170 ng/mL, 180 ng/mL, 190 ng/mL, 200 ng/mL, or more than 200 ng/mL. In some embodiments, the level of at least one heparin sulfate (e.g., D0A0, D0S0, D0A6, and/or D2S6) is about or at least about 80 ng/mL (e.g., for D0S0 or D0A6). In some embodiments, the level of at least one heparin sulfate (e.g., D0A0, D0S0, D0A6, and/or D2S6) is about or at least about 100 ng/mL (e.g., for D0S0, D0A6, or D2S6). In some embodiments, the level of at least one heparin sulfate (e.g., D0A0, D0S0, D0A6, and/or D2S6) is about or at least about 90 ng/mL (e.g., for D0S0, D0A6, or D2S6). In some embodiments, the level of at least one heparin sulfate (e.g., D0A0, D0S0, D0A6, and/or D2S6) is about or at least about 110 ng/mL (e.g., for D0S0, D0A6, or D2S6). In some embodiments, the level of at least one heparin sulfate (e.g., D0A0, D0S0, D0A6, and/or D2S6) is about or at least about 120 ng/mL (e.g., for D0S0, D0A6, or D2S6). In some embodiments, the level of at least one heparin sulfate (e.g., D0A0, D0S0, D0A6, and/or D2S6) is about or at least about 160 ng/mL (e.g., for D2S6 or D0A6). In some embodiments, the level of at least one heparin sulfate (e.g., D0A0, D0S0, D0A6, and/or D2S6) is about or at least about 250 ng/mL (e.g., for D2S6 or D0A0). In some embodiments, the level of at least one heparin sulfate (e.g., D0A0, D0S0, D0A6, and/or D2S6) is about or at least about 300 ng/mL (e.g., for D2S6 or D0A0). In some embodiments, the level of at least one heparin sulfate (e.g., D0A0, D0S0, D0A6, and/or D2S6) is about or at least about 350 ng/mL (e.g., for D2S6 or D0A0).). In some embodiments, the level of at least one heparin sulfate (e.g., D0A0, D0S0, D0A6, and/or D2S6) is about or at least about 150 ng/mL (e.g., for D2S6). In some embodiments, the level of at least one heparin sulfate (e.g., D0A0, D0S0, D0A6, and/or D2S6) is about or at least about 170 ng/mL (e.g., for D2S6). In some embodiments, the level of at least one heparin sulfate (e.g., D0A0, D0S0, D0A6, and/or D2S6) is about or at least about 180 ng/mL (e.g., for D2S6). In some embodiments, the level of at least one heparin sulfate (e.g., D0A0, D0S0, D0A6, and/or D2S6) is about or at least about 200 ng/mL (e.g., for D2S6). In some embodiments, the level of one or more heparan sulfate disaccharide(s) (e.g., D0A0, D0S0, D0A6, and/or D2S6) or the level of D2S6 in a biological sample from a subject is elevated by about or at least about 10 ng/mL, 20 ng/mL, 30 ng/mL, 40 ng/mL, 50 ng/mL, 60 ng/mL, 70 ng/mL, 80 ng/mL, 90 ng/mL, 100 ng/mL, 150 ng/mL, 160 ng/mL, 170 ng/mL, 180 ng/mL, 190 ng/mL, 200 ng/mL, 210 ng/mL, 220 ng/mL, 230 ng/mL, 240 ng/mL, 250 ng/mL, 260 ng/mL, 270 ng/mL, 280 ng/mL, 290 ng/mL, 300 ng/mL, 310 ng/mL, 320 ng/mL, 330 ng/mL, 340 ng/mL, 350 ng/mL, 360 ng/mL, 370 ng/mL, 380 ng/mL, 390 ng/mL, 400 ng/mL, 410 ng/mL, 420 ng/mL, 430 ng/mL, 440 ng/mL, 450 ng/mL, 460 ng/mL, 470 ng/mL, 480 ng/mL, 490 ng/mL, 500 ng/mL, or more than 500 ng/mL as compared to a reference level (e.g., level of one or more heparan sulfate disaccharide(s) (e.g., D0A0, D0S0, D0A6, and/or D2S6) or the level of D2S6 in a biological sample from one or more healthy subjects and/or from one or more non-neuronopathic subjects, or a pre-determined value). In some embodiments, the total level of heparan sulfate disaccharide(s) (e.g., D0A0, D0S0, D0A6, and/or D2S6) in a biological sample from a subject is elevated by about or at least about 10 ng/mL, 20 ng/mL, 30 ng/mL, 40 ng/mL, 50 ng/mL, 60 ng/mL, 70 ng/mL, 80 ng/mL, 90 ng/mL, 100 ng/mL, 150 ng/mL, 160 ng/mL, 170 ng/mL, 180 ng/mL, 190 ng/mL, 200 ng/mL, 210 ng/mL, 220 ng/mL, 230 ng/mL, 240 ng/mL, 250 ng/mL, 260 ng/mL, 270 ng/mL, 280 ng/mL, 290 ng/mL, 300 ng/mL, 310 ng/mL, 320 ng/mL, 330 ng/mL, 340 ng/mL, 350 ng/mL, 360 ng/mL, 370 ng/mL, 380 ng/mL, 390 ng/mL, 400 ng/mL, 410 ng/mL, 420 ng/mL, 430 ng/mL, 440 ng/mL, 450 ng/mL, 460 ng/mL, 470 ng/mL, 480 ng/mL, 490 ng/mL, 500 ng/mL, 510 ng/mL, 520 ng/mL, 530 ng/mL, 540 ng/mL, 550 ng/mL, 560 ng/mL, 570 ng/mL, 580 ng/mL, 590 ng/mL, 600 ng/mL, 610 ng/mL, 620 ng/mL, 630 ng/mL, 640 ng/mL, 650 ng/mL, 660 ng/mL, 670 ng/mL, 680 ng/mL, 690 ng/mL, 700 ng/mL, 710 ng/mL, 720 ng/mL, 730 ng/mL, 740 ng/mL, 750 ng/mL, 760 ng/mL, 770 ng/mL, 780 ng/mL, 790 ng/mL, 800 ng/mL, 850 ng/mL, 900 ng/mL, 950 ng/mL, 1000 ng/mL, or more than 1000 ng/mL as compared to a reference level (e.g., the total level of heparan sulfate disaccharides (e.g., D0A0, D0S0, D0A6, and D2S6) in a biological sample from one or more healthy subjects and/or from one or more non-neuronopathic subjects, or a pre-determined value).

(226) In some embodiments, a subject is determined to be responsive to a treatment of the disclosure (e.g, rAAV9 encoding hIDUA for treating MPS I; Construct 2) based on the level of I0S6 in a biological sample from the subject. In some embodiments, an elevated level of I0S6 in a biological sample from the subject (e.g., subject with MPS I) as compared to a reference, is indicative that the subject is responsive to a treatment of the disclosure (or treatment with rAAV9 encoding hIDUA for MPS I). In some embodiments, the reference is a level of I0S6 in a biological sample from a healthy subject or a population of healthy subjects. In some embodiments, the reference is a level of I0S6 in a biological sample from a subject with MPS I or a population of subjects with MPS I. In some embodiments, the reference is a level of I0S6 in a biological sample from a subject who does not have MPS I or is not diagnosed with MPS I or a population of subjects not diagnosed with MPS I. In some embodiments, the reference is a level of IS06 in a biological sample from the same subject but taken at a different time point (e.g., obtained at an earlier time point). In some embodiments, the reference is a predetermined value.

(227) 5.5.1. Disease Markers

(228) In certain embodiments, efficacy of treatment with the recombinant nucleotide expression vector is monitored by measuring the level of a disease biomarker in the patient. In certain embodiments, the level of the disease biomarker is measured in the CSF of the patient. In certain embodiments, the level of the disease biomarker is measured in the serum of the patient. In certain embodiments, the level of the disease biomarker is measured in the plasma of the patient. In certain embodiments, the level of the disease biomarker is measured in the urine of the patient. In certain embodiments, the disease biomarker is GAG. In some embodiments, the disease biomarker is I0S6. In preferred embodiments, the disease biomarker is heparan sulfate. In certain embodiments, the disease biomarker is D2S6. I2S enzyme cleaves sulfates from HS in the lysosome and absence of I2S causes long chains of fully sulfated D2S6 to accumulate. In some embodiments, quantitative measurement of D2S6 is reflective of I2S enzyme activity level and elevated levels of HS and D2S6 correlate closely with the neuronopathic phenotype of MPS II. In some embodiments, levels of D2S6 inversely correlate with neurocognitive development. In some embodiments, the disease biomarker is an anti-AAV antibody (e.g., anti-AAV9 antibody). In certain embodiments, the disease biomarker is dermatan sulfate. In certain embodiments, the disease biomarker is IDS enzyme activity. In certain embodiments, the disease biomarker is inflammation. In certain embodiments, the disease biomarker is a safety event.

(229) In certain embodiments, efficacy of treatment with the recombinant nucleotide expression vector is monitored by measuring one or more of the following biomarkers in a sample from the patient: (a) level of GAGs in CSF; (b) level of I2S in CSF; (c) level of GAGs in plasma; (d) level of I2S in plasma; (e) level of leukocyte I2S enzyme activity; (f) level of GAGs in urine, (g) level of heparan sulfate in CSF, and (h) level of dermatan sulfate in CSF. In certain embodiments, efficacy of treatment with the recombinant nucleotide expression vector is monitored by measuring I2S and/or GAGs in CSF, urine, and/or plasma. In certain embodiments, efficacy of treatment with the recombinant nucleotide expression vector is monitored by measuring heparan sulfate in CSF, plasma, and/or urine. In certain embodiments, efficacy of treatment with the recombinant nucleotide expression vector is monitored by measuring non-reducing heparan sulfate. In some embodiments, heparan sulfate measured in CSF is the primary endpoint for determining efficacy of treatment. In certain embodiments, efficacy of treatment with the recombinant nucleotide expression vector is monitored by measuring D2S6 in CSF. In some embodiments, D2S6 is measured using any detectable/available assay or biological sample used for detecting D2S6 (e.g., CSF, urine, and/or plasma). In certain embodiments, efficacy of treatment with the recombinant nucleotide expression vector is monitored by measuring total urine GAGs, urine HS and/or plasma I2S enzyme activity. In some embodiments, urine GAG is indicative of systemic effect and/or is independent of ERT treatment. In some embodiments, efficacy of a treatment of the disclosure is determined based on the level of I2S protein concentration in a sample from a subject (e.g., an increase in the level of I2S protein concentration is indicative of efficacy). In some embodiments, Heparan sulfate (HS) and D2S6 (glycosaminoglycans (GAGs) are measured in the cerebrospinal fluid (CSF) at baseline and/or after administration of the recombinant vector of the present disclosure. In some embodiments, determining or monitoring efficacy of MPS II treatment in a subject is determined by detecting a level of at least one biomarker (e.g., D2S6) in a biological sample from a subject obtained at about, at least about, or at most about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490 days, or 1, 2, 3, 4, 5, 6, 7, 8, 10, 16, 20, 24, 30, 35, 40, 45, 48, 50, 52, 56, 104 weeks, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 months, or 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 years after the the rAAV of the present disclosure is administered to the subject (e.g., and comparing the level with a reference). In some embodiments, determining or monitoring efficacy of MPS I treatment in a subject is determined by detecting a level of at least one biomarker (e.g., I0S6) in a biological sample from a subject obtained at about, at least about, or at most about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490 days, or 1, 2, 3, 4, 5, 6, 7, 8, 10, 16, 20, 24, 30, 35, 40, 45, 48, 50, 52, 56, 104 weeks, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 months, or 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 years after the the rAAV of the present disclosure is administered to the subject (e.g., and comparing the level with a reference).

(230) In some embodiments, the level of HS and/or D2S6 is decreased in a subject after administration of a recombinant vector of the present disclosure as compared to a reference (e.g., compared to the level of HS and/or D2S6 in the subject before administration of a recombinant vector of the present disclosure, or as compared to baseline, or a predetermined value). In some embodiments, the level of HS is decreased by about or at least about 3%, 5%, 7%, 8%, 9%, 10%4, 12%, 15%, 17%, 20%, 22%, 25%, 27%, 30%, 32%, 35%, 37%, 40%, 42%, 45%, 47%, 50%, 52%, 55%, 57%, 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 88%, 85%, 87%, 90%, 92%, 95%, 97%, 100%, or more than 100% after administration of a recombinant vector of the present disclosure as compared to a reference, e.g., before ERT is discontinued, (e.g., compared to the level of HS in the subject before administration of a recombinant vector of the present disclosure). In some embodiments, the level of D2S6 is decreased by about or at least about 3%, 5%, 7%, 8%, 9%, 10%, 12%, 15%, 17%, 20%, 22%, 25%, 27%, 30%, 32%, 35%, 37%, 40%, 42%, 45%, 47%, 50%, 52%, 55%, 57%, 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 88%, 85%, 87%, 90%, 92%, 95%, 97%, 100%, or more than 100% after administration of a recombinant vector of the present disclosure as compared to a reference, e.g., before ERT is discontinued, (e.g., compared to the level of D2S6 in the subject before administration of a recombinant vector of the present disclosure). In some embodiments, the level of I0S6 is decreased in a subject after administration of a recombinant vector of the present disclosure as compared to a reference (e.g., compared to the level of I0S6 in the subject before administration of a recombinant vector of the present disclosure, or as compared to baseline, or a predetermined value). In some embodiments, the level of IS06 is decreased by about or at least about 3%, 5%, 7%, 8%, 9%, 10%, 12%, 15%, 17%, 20%, 22%, 25%, 27%, 30%, 32%, 35%, 37%, 40%, 42%, 45%, 47%, 50%, 52%, 55%, 57%, 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 88%, 85%, 87%, 90%, 92%, 95%, 97%, 100%, or more than 100% after administration of a recombinant vector of the present disclosure as compared to a reference, e.g., before ERT is discontinued, (e.g., compared to the level of I0S6 in the subject before administration of a recombinant vector of the present disclosure). In some embodiments, a biomarker (e.g., HS, D2S6, I0S6, total GAG, and/or I2S enzyme) is measured before administration of the recombinant vector of the present disclosure, on the same day as the administration of the recombinant vector of the present disclosure, on one day after the administration of the recombinant vector of the present disclosure, and/or after about 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 13 weeks, 14 weeks, 15 weeks, 16 weeks, 17 weeks, 18 weeks, 19 weeks, 20 weeks, 22 weeks, 24 weeks, 26 weeks, 30 weeks, 35 weeks, 40 weeks, 42 weeks, 44 weeks, 46 weeks, 48 weeks, 50 weeks, 52 weeks, 54 weeks, 56 weeks, 60 weeks, 65 weeks, 70 weeks, 75 weeks, 80 weeks, 85 weeks, 90 weeks, 95 weeks, 100 weeks, 104 weeks, 1 year, 2 years, or more than 2 years after the administration of the recombinant vector of the present disclosure. In some embodiments, a biomarker (e.g., HS, D2S6, I0S6, total GAG, and/or 2S enzyme) is measured before administration of the recombinant vector of the present disclosure, on the same day as the administration of the recombinant vector of the present disclosure, 8 weeks after, 16 weeks after, 24 weeks after, 32 weeks after, 40 weeks after, 48 weeks after, 56 weeks after, 72 weeks after, 104 weeks after, 1 year after, 2 years after, or more than 2 years after administration of the recombinant vector of the present disclosure. In some embodiments, HS and/or D2S6 is measured in CSF in ng/ml. In some embodiments, a biomarker (e.g., HS, I0S6, and/or D2S6) is decreased by about or at least about 5 ng/ml, 10 ng/ml, 15 ng/ml, 20 ng/ml, 25 ng/ml, 30 ng/ml, 35 mg/ml, 40 mg/ml, 45 ng/ml, 50 ng/ml, 55 ng/ml, 60 ng/ml, 65 ng/ml, 70 ng/ml, 75 ng/ml, 80 ng/ml, 85 ng/ml, 90 ng/ml, 95 ng/ml, 100 ng/ml, 110 ng/ml, 120 ng/ml, 130 ng/ml, 140 ng/ml, 150 ng/ml, 160 ng/ml, 170 ng/ml, 180 ng/ml, 190 ng/ml, 200 ng/ml, 220 ng/ml, 250 ng/ml, 270 ng/ml, 300 ng/ml, or more than 300 ng/ml after the administration of the recombinant vector of the present disclosure as compared to a reference (e.g., as compared to the amount from baseline or the amount before treatment with the recombinant vector of the present disclosure). In some embodiments, total GAG (e.g., in urine) is measured in g/mol, CK. In some embodiments, a biomarker (e.g., total GAG) is decreased by about or at least about 5 g/mol, 10 g/mol, 15 g/mol, 20 g/mol, 25 g/mol, 30 g/mol, 35 mg/ml, 40 mg/ml, 45 g/mol, 50 g/mol, 55 g/mol, 60 g/mol, 65 g/mol, 70 g/mol, 75 g/mol, 80 g/mol, 85 g/mol, 90 g/mol, 95 g/mol, 100 g/mol, 110 g/mol, 120 g/mol, 130 g/mol, 140 g/mol, 150 g/mol, 160 g/mol, 170 g/mol, 200 g/mol, or more than 200 g/mol after the administration of the recombinant vector of the present disclosure as compared to a reference (e.g., as compared to the amount from baseline or the amount before treatment with the recombinant vector of the present disclosure). In some embodiments, a biomarker (e.g., HS, D2S6, I0S6, and/or total GAG) is decreased and/or hepatosplenomegaly is decreased by about or at least about 3%, 5%, 7%, 8%, 9%, 10%, 12%, 15%, 17%, 20%, 22%, 25%, 27%, 30%, 32%, 35%, 37%, 40%, 42%, 45%, 47%, 50%, 52%, 55%, 57%, 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 88%, 85%, 87%, 90%, 92%, 95%, 97%, 100%, or more than 100% after the administration of the recombinant vector of the present disclosure as compared to a reference, e.g., before ERT is discontinued, (e.g., as compared to the amount from baseline or the amount before treatment with the recombinant vector of the present disclosure). In some embodiments, determining that a biomarker is increased or decreased in a subject is determined before ERT is discontinued in the subject. In some embodiments, a biomarker (e.g., HS, I0S6, D2S6, and/or total GAG) is decreased and/or hepatosplenomegaly is decreased for about, after about, at least about, or up to about 2 days, 5 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 13 weeks, 14 weeks, 15 weeks, 16 weeks, 17 weeks, 18 weeks, 19 weeks, 20 weeks, 22 weeks, 24 weeks, 26 weeks, 30 weeks, 35 weeks, 40 weeks, 42 weeks, 44 weeks, 46 weeks, 48 weeks, 50 weeks, 52 weeks, 54 weeks, 56 weeks, 60 weeks, 65 weeks, 70 weeks, 75 weeks, 80 weeks, 85 weeks, 90 weeks, 95 weeks, 100 weeks, 104 weeks, more than 104 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, 15 months, 18 months, 21 months, 24 months, 30 months, 36 months, 40 months, 48 months, 50 months, 55 months, 60 months, 65 months, 70 months, 75 months, 80 months, 85 months, 90 months, 95 months, 100 months, 1 year, 1.5 years, 2 years, 2.5 years, 3 years, 3.5 years, 4 years, 4.5 years, 5 years, 5.5 years, 6 years, 6.5 years, 7 years, 7.5 years, 8 years, 8.5 years, 9 years, 9.5 years, 10 years, or more than 10 years after the administration of the recombinant vector of the present disclosure as compared to a reference (e.g., compared to the level of a biomarker in the subject before administration of a recombinant vector of the present disclosure, or compared to a biomarker level from a previously obtained biological sample from the subject, or compared to baseline, or compared to the level of a biomarker in a healthy subject). For example, in some embodiments, a biomarker (e.g., HS, D2S6, I0S6, and/or total GAG) is decreased and/or hepatosplenomegaly is decreased by about or at least about 5%, 20%, 25%, 30%, 35%, 40% 45%, 50%, or more than 50% for about, at least about, or up to about 2 weeks, 4 weeks, 6 weeks, 8 weeks, 16 weeks, 24 weeks, 48 weeks, 56 weeks, 104 weeks, 2 years, or more than 2 years after the administration of the recombinant vector of the present disclosure (e.g., as compared to the level of the biomarker or hepatosplenomegaly from baseline or the level of the biomarker or hepatosplenomegaly before treatment with the recombinant vector of the present disclosure, or as compared to the level of a biomarker or hepatosplenomegaly obtained from the subject at an earlier time point). In some embodiments, a decrease in a biomarker (e.g., HS, D2S6, I0S6, and/or total GAG), a decrease in hepatosplenomegaly, and/or an increase in a biomarker (e.g., I2S) is sustained for about or at least about 2 days, 5 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 13 weeks, 14 weeks, 15 weeks, 16 weeks, 17 weeks, 18 weeks, 19 weeks, 20 weeks, 22 weeks, 24 weeks, 26 weeks, 30 weeks, 35 weeks, 40 weeks, 42 weeks, 44 weeks, 46 weeks, 48 weeks, 50 weeks, 52 weeks, 54 weeks, 56 weeks, 60 weeks, 65 weeks, 70 weeks, 75 weeks, 80 weeks, 85 weeks, 90 weeks, 95 weeks, 100 weeks, 104 weeks, more than 104 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, 15 months, 18 months, 21 months, 24 months, 30 months, 36 months, 40 months, 48 months, 50 months, 55 months, 60 months, 65 months, 70 months, 75 months, 80 months, 85 months, 90 months, 95 months, 100 months, 1 year, 1.5 years, 2 years, 2.5 years, 3 years, 3.5 years, 4 years, 4.5 years, 5 years, 5.5 years, 6 years, 6.5 years, 7 years, 7.5 years, 8 years, 8.5 years, 9 years, 9.5 years, 10 years, or more than 10 years after the administration of the recombinant vector of the present disclosure.

(231) In some embodiments, the level of a biomarker (e.g., I2S enzyme) is increased by about or at least about 3%, 5%, 7%, 8%, 9%, 10%, 12%, 15%, 17%, 20%, 22%, 25%, 27%, 30%, 32%, 35%, 37%, 40%, 42%, 45%, 47%, 50%, 52%, 55%, 57%, 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 88%, 85%, 87%, 90%, 92%, 95%, 97%, 100%, or more than 100% after the administration of the recombinant vector of the present disclosure as compared to a reference (e.g., compared to the level of the biomarker in the subject before administration of the recombinant vector of the present disclosure). In some embodiments, a biomarker (e.g., I2S enzyme) is increased for about, after about, at least about, or up to about 2 days, 5 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 13 weeks, 14 weeks, 15 weeks, 16 weeks, 17 weeks, 18 weeks, 19 weeks, 20 weeks, 22 weeks, 24 weeks, 26 weeks, 30 weeks, 35 weeks, 40 weeks, 42 weeks, 44 weeks, 46 weeks, 48 weeks, 50 weeks, 52 weeks, 54 weeks, 56 weeks, 60 weeks, 65 weeks, 70 weeks, 75 weeks, 80 weeks, 85 weeks, 90 weeks, 95 weeks, 100 weeks, 104 weeks, more than 104 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, 15 months, 18 months, 21 months, 24 months, 30 months, 36 months, 40 months, 48 months, 50 months, 55 months, 60 months, 65 months, 70 months, 75 months, 80 months, 85 months, 90 months, 95 months, 100 months, 1 year, 1.5 years, 2 years, 2.5 years, 3 years, 3.5 years, 4 years, 4.5 years, 5 years, 5.5 years, 6 years, 6.5 years, 7 years, 7.5 years, 8 years, 8.5 years, 9 years, 9.5 years, 10 years, or more than 10 years after the administration of the recombinant vector of the present disclosure as compared to a reference (e.g., compared to the level of the biomarker in the subject before administration of the recombinant vector of the present disclosure). In some embodiments, a biomarker (e.g., I2S enzyme) is increased by about or at least about 5%, 20%, 25%, 30%, 35%, 40% 45%, 50%, or more than 50% at about, for about, at least about, or up to about 2 weeks, 4 weeks, 6 weeks, 8 weeks, 16 weeks, 24 weeks, 48 weeks, 56 weeks, 104 weeks, 2 years, or more than 2 years after the administration of the recombinant vector of the present disclosure (e.g., as compared to the amount from baseline or the amount before treatment with the recombinant vector of the present disclosure). In some embodiments, a biomarker (e.g., I2S enzyme) is increased by about or at least about 500 pg/ml, 1000 pg/ml, 1500 pg/ml, 10000 pg/ml, 15000 pg/ml, 20000 pg/ml, 25000 mg/ml, 30000 mg/ml, 35000 pg/ml, 40000 pg/ml, 45000 pg/ml, 50000 pg/ml, or more than 50000 pg/ml after the administration of the recombinant vector of the present disclosure (e.g., as compared to the amount from baseline or the amount before treatment with the recombinant vector of the present disclosure).

(232) In some embodiments, heparan sulfate (HS) glycosaminoglycan (CAGs) in CSF is measured using a bioanalytical LC/MS. In some embodiments, heparan sulfate non-reducing ends and total heparan sulfate in CNS is measured using a bioanalytical LC/MS. In some embodiments, heparan sulfate non-reducing ends and total heparan sulfate CAGs in plasma is measured using a bioanalytical LC/MS. In some embodiments, HS CAGs in urine is measured using a bioanalytical LC/MS. In some embodiments, urine total CAGs concentration is measured using a colorimetric assay. In some embodiments, more details about the assays that can be used is provided in Section 6 of the disclosure.

(233) In some embodiments, if a biomarker (e.g., D2S6, I0S6, HS, GAG (e.g., total GAG in urine)) and/or hepatosplenomegaly is increased and/or a biomarker (e.g., I2S) is decreased after a recombinant vector of the present disclosure is administered to the subject, another dose (e.g., same dose, lower dose, or higher dose as compared to previous dose) of the recombinant vector of the present disclosure is administered to the subject. In some embodiments, if a biomarker (e.g., D2S6, HS, GAG (e.g., total GAG in urine)) and/or hepatosplenomegaly is increased and/or a biomarker (e.g., I2S) is decreased after a recombinant vector of the present disclosure is administered to the subject, another therapy or treatment is administered to the the subject (e.g., a therapy or treatment that is used to treat MPS II, a therapy or treatment used to treat a symptom that the subject is suffering from, a therapy or treatment for hepatosplenomegaly, and/or a therapy or treatment used to treat or prevent a symptom from MPS II). In some embodiments, if a biomarker (e.g., I0S6)) and/or hepatosplenomegaly is increased and/or a biomarker (e.g., I2S) is decreased after a recombinant vector of the present disclosure is administered to the subject, another therapy or treatment is administered to the the subject (e.g., a therapy or treatment that is used to treat MPS 1, a therapy or treatment used to treat a symptom that the subject is suffering from, a therapy or treatment for hepatosplenomegaly, and/or a therapy or treatment used to treat or prevent a symptom from MPS I). For example, if a biomarker (e.g., D2S6, I0S6, HS, GAG (e.g., total GAG in urine)) and/or hepatosplenomegaly is increased and/or if a biomarker (e.g., I2S) is decreased by about or by at least about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, or more than 100% as compared to a reference, another dose (e.g., same dose, lower dose, or higher dose as compared to previous dose) of the recombinant vector of the present disclosure is administered to the subject and/or another therapy or treatment is administered to the subject (e.g., ERT treatment). In some embodiments, a reference is a control. In some embodiments, a reference is the biomarker level and/or hepatosplenomegaly in a previous biological sample or from an image (e.g., ultrasound) obtained from the subject. In some embodiments, a reference is the biomarker level and/or hepatosplenomegaly from the subject at baseline (e.g., before the recombinant vector of the present disclosure is administered to the subject). In some embodiments, a reference is the biomarker level and/or hepatosplenomegaly in a healthy subject or in a subject who does not have or has not been diagnosed with MPS II. In some embodiments, a reference is the level of the at least one biomarker and/or hepatosplenomegaly in a biological sample obtained from a subject diagnosed with MPS II who never received ERT or is not receiving ERT. In some embodiments, a reference is the biomarker level and/or hepatosplenomegaly in a subject or group of subjects with MPS II. In some embodiments, if an increase in a biomarker (e.g., D2S6, I0S6, HS, GAG (e.g., total GAG in urine)) and/or an increase in hepatosplenomegaly and/or a decrease in a biomarker (e.g., I2S) is observed over a period of about, at least about, or up to about 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 13 weeks, 14 weeks, 15 weeks, 16 weeks, 17 weeks, 18 weeks, 19 weeks, 20 weeks, 22 weeks, 24 weeks, 26 weeks, 30 weeks, 35 weeks, 40 weeks, 41 weeks, 42 weeks, 43 weeks, 44 weeks, 45 weeks, 46 weeks, 47 weeks, 48 weeks, 49 weeks, 50 weeks, 51 weeks, 52 weeks, 53 weeks, 54 weeks, 55 weeks, 56 weeks, 57 weeks, 58 weeks, 59 weeks, 60 weeks, 65 weeks, 70 weeks, 75 weeks, 80 weeks, 85 weeks, 90 weeks, 95 weeks, 100 weeks, 104 weeks, more than 104 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, 15 months, 18 months, 21 months, 24 months, 30 months, 36 months, 40 months, 48 months, 50 months, 55 months, 60 months, 65 months, 70 months, 75 months, 80 months, 85 months, 90 months, 95 months, 100 months, 1 year, 1.5 years, 2 years, 2.5 years, 3 years, 3.5 years, 4 years, 4.5 years, 5 years, 5.5 years, 6 years, 6.5 years, 7 years, 7.5 years, 8 years, 8.5 years, 9 years, 9.5 years, 10 years, or more than 10 years after the administration of the recombinant vector of the present disclosure, another dose (e.g., same dose, lower dose, or higher dose as compared to previous dose) of the recombinant vector of the present disclosure is administered to the subject and/or another therapy or treatment is administered to the the subject.

(234) In some embodiments, a subject is receiving or has received enzyme replacement therapy (ERT) prior to and/or continuously with the administration of a recombinant vector of the present disclosure. In some embodiments, ERT treatment is discontinued in a subject prior to the administration of a recombinant vector of the present disclosure. In some embodiments, ERT treatment is discontinued in a subject at about 52 weeks after a recombinant vector of the present disclosure is administered to a subject. In some embodiments, ERT treatment is discontinued in a subject at about 56 weeks after a recombinant vector of the present disclosure is administered to a subject. In some embodiments, ERT treatment is discontinued in a subject at about, before about, or after about 52 weeks after a recombinant vector of the present disclosure is administered to a subject (e.g., at about, before about, or after about one day, two days, three days, four days, five days, six days, 1 week, 2 weeks, 3 weeks, 4 weeks, 6 weeks, 8 weeks, 10 weeks, 12 weeks, 14 weeks, 16 weeks, 18 weeks, 20 weeks, 22 weeks, 24 weeks, 26 weeks, 28 weeks, 30 weeks, 32 weeks, 34 weeks, 36 weeks, 38 weeks, 40 weeks, 42 weeks, 44 weeks, 46 weeks, 48 weeks, 50 weeks, 52 weeks, 54 weeks, 56 weeks, 58 weeks, 60 weeks, 65 weeks, 70 weeks, 75 weeks, 80 weeks, 85 weeks, 90 weeks, 95 weeks, 100 weeks, or more than 100 weeks after a recombinant vector of the present disclosure is administered to a subject). In some embodiments, determining the level of a biomarker and/or hepatosplenomegaly is used to determine if a patient can discontinue enzyme replacement therapy (ERT) treatment after a recombinant vector of the present disclosure is administered to a subject. In some embodiments, an increase in a biomarker (e.g., I2S) after a recombinant vector of the present disclosure is administered to a subject (e.g., as compared to baseline) is indicative that a subject can stop treatment with ERT. In some embodiments, an increase in a biomarker (e.g., I2S) over a period of time after a recombinant vector of the present disclosure is administered to a subject is indicative that a subject can stop treatment with ERT. In some embodiments, if a subject is negative for an anti-AAV antibody (e.g., a biological sample from the subject does not show a detectable level of anti-AAV9 antibodies), ERT treatment is discontinued before a recombinant vector of the present disclosure is administered to a subject. In some embodiments, ERT treatment is discontinued by about or at least about 1 year, 10 months, 8 months, 6 months, 5 months, 4 months, 3 months, 2 months, 1 month, 3 weeks, 2 weeks, 1 week, 10 days, 5 days, 4 days, 3 days, 2 days, or 1 day before a recombinant vector of the present disclosure is administered to a subject. In some embodiments, a decrease in a biomarker (e.g., D2S6, HS, GAG (e.g., total GAG in urine)) and/or a decrease in hepatosplenomegaly after a recombinant vector of the present disclosure is administered to a subject (e.g., as compared to baseline) is indicative that a subject can stop treatment with ERT. In some embodiments, a decrease in a biomarker (e.g., D2S6, 10S6, HS, GAG (e.g., total GAG in urine)) and/or decrease in hepatosplenomegaly over a period of time after a recombinant vector of the present disclosure is administered to a subject is indicative that a subject can stop treatment with ERT. In some embodiments, a decrease in a biomarker (e.g., D2S6, I0S6, HS, GAG (e.g., total GAG in urine)) and/or a decrease in hepatosplenomegaly and/or an increase in a biomarker (e.g., I2S) over a period of about, at least about, or up to about 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 13 weeks, 14 weeks, 15 weeks, 16 weeks, 17 weeks, 18 weeks, 19 weeks, 20 weeks, 22 weeks, 24 weeks, 26 weeks, 30 weeks, 35 weeks, 40 weeks, 41 weeks, 42 weeks, 43 weeks, 44 weeks, 45 weeks, 46 weeks, 47 weeks, 48 weeks, 49 weeks, 50 weeks, 51 weeks, 52 weeks, 53 weeks, 54 weeks, 55 weeks, 56 weeks, 57 weeks, 58 weeks, 59 weeks, 60 weeks, 65 weeks, 70 weeks, 75 weeks, 80 weeks, 85 weeks, 90 weeks, 95 weeks, 100 weeks, 104 weeks, more than 104 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, 15 months, 18 months, 21 months, 24 months, 30 months, 36 months, 40 months, 48 months, 50 months, 55 months, 60 months, 65 months, 70 months, 75 months, 80 months, 85 months, 90 months, 95 months, 100 months, 1 year, 1.5 years, 2 years, 2.5 years, 3 years, 3.5 years, 4 years, 4.5 years, 5 years, 5.5 years, 6 years, 6.5 years, 7 years, 7.5 years, 8 years, 8.5 years, 9 years, 9.5 years, 10 years, or more than 10 years after the administration of the recombinant vector of the present disclosure is indicative that the subject can discontinue or stop treatment with ERT. In some embodiments, if a biomarker level (e.g., D2S6, 10S6, HS, GAG (e.g., total GAG in urine)) decreased and/or hepatosplenomegaly is decreased and/or if a biomarker (e.g., I2S) is increased by about or by at least about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, or more than 100% as compared to a reference level, ERT treatment is stopped or discontinued. In some embodiments, if a biomarker level (e.g., D2S6, I0S6, HS, GAG (e.g., total GAG in urine)) is decreased and/or hepatosplenomegaly is decreased and/or if a biomarker (e.g., I2S) is increased by about or by at least about 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 15-fold, 20-fold, 25-fold, 30-fold, 35-fold, 40-fold, 45-fold, 50-fold, 55-fold, 60-fold, 65-fold, 70-fold, 75-fold, 80-fold, 85-fold, 90-fold, 95-fold, 100-fold, or more than 100-fold (e.g., after a recombinant vector of the present disclosure is administered) as compared to a reference level, ERT treatment is stopped or discontinued. In some embodiments, ERT is discontinued indefinitely. In some embodiments, ERT is discontinued or stopped for about, at least about, or at most about 1 day, 5 days, 7 days, 10 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 13 weeks, 14 weeks, 15 weeks, 16 weeks, 17 weeks, 18 weeks, 19 weeks, 20 weeks, 22 weeks, 24 weeks, 26 weeks, 30 weeks, 35 weeks, 40 weeks, 41 weeks, 42 weeks, 43 weeks, 44 weeks, 45 weeks, 46 weeks, 47 weeks, 48 weeks, 49 weeks, 50 weeks, 51 weeks, 52 weeks, 53 weeks, 54 weeks, 55 weeks, 56 weeks, 57 weeks, 58 weeks, 59 weeks, 60 weeks, 65 weeks, 70 weeks, 75 weeks, 80 weeks, 85 weeks, 90 weeks, 95 weeks, 100 weeks, 104 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, 15 months, 18 months, 21 months, 24 months, 30 months, 36 months, 40 months, 48 months, 50 months, 55 months, 60 months, 65 months, 70 months, 75 months, 80 months, 85 months, 90 months, 95 months, 100 months, 1 year, 1.5 years, 2 years, 2.5 years, 3 years, 3.5 years, 4 years, 4.5 years, 5 years, 5.5 years, 6 years, 6.5 years, 7 years, 7.5 years, 8 years, 8.5 years, 9 years, 9.5 years, 10 years, or more than 10 years. In some embodiments, ERT is stopped at about or at least about 52 weeks after the administration of the recombinant vector of the present disclosure.

(235) In some embodiments, a biomarker (e.g., I2S, I0S6, D2S6, HS, GAG (e.g., total GAG in urine)) and/or hepatosplenomegaly is monitored after ERT treatment is discontinued. For example, in some embodiments, a biomarker (e.g., I2S, I0S6, D2S6, HS, GAG (e.g., total GAG in urine)) and/or hepatosplenomegaly (e.g., size of the liver or spleen) is measured at about, at least about, or every 2 days, 5 days, 7 days, 10 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 13 weeks, 14 weeks, 15 weeks, 16 weeks, 17 weeks, 18 weeks, 19 weeks, 20 weeks, 22 weeks, 24 weeks, 26 weeks, 30 weeks, 35 weeks, 40 weeks, 41 weeks, 42 weeks, 43 weeks, 44 weeks, 45 weeks, 46 weeks, 47 weeks, 48 weeks, 49 weeks, 50 weeks, 51 weeks, 52 weeks, 53 weeks, 54 weeks, 55 weeks, 56 weeks, 57 weeks, 58 weeks, 59 weeks, 60 weeks, 65 weeks, 70 weeks, 75 weeks, 80 weeks, 85 weeks, 90 weeks, 95 weeks, 100 weeks, 104 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, 15 months, 18 months, 21 months, 24 months, 30 months, 36 months, 40 months, 48 months, 50 months, 55 months, 60 months, 65 months, 70 months, 75 months, 80 months, 85 months, 90 months, 95 months, 100 months, 1 year, 1.5 years, 2 years, 2.5 years, 3 years, 3.5 years, 4 years, 4.5 years, 5 years, 5.5 years, 6 years, 6.5 years, 7 years, 7.5 years, 8 years, 8.5 years, 9 years, 9.5 years, 10 years, or more than 10 years after ERT treatment is stopped or discontinued and/or after the recombinant vector of the present disclosure is administered to the subject.

(236) In some embodiments, if a biomarker (e.g., D2S6, I0S6, HS, GAG (e.g., total GAG in urine)) is increased and/or hepatosplenomegaly is increased and/or a biomarker (e.g., I2S) is decreased after ERT treatment is stopped or discontinued, ERT treatment is re-administered to the subject. For example, if a biomarker (e.g., D2S6, I0S6, HS, GAG (e.g., total GAG in urine)) is increased and/or hepatosplenomegaly is increased and/or if a biomarker (e.g., I2S) is decreased by about or by at least about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, or more than 100% (e.g., after a recombinant vector of the present disclosure is administered to the subject) as compared to a reference, ERT treatment is re-administered to the subject (e.g., for a period of time until a biomarker (e.g., D2S6, I0S6, HS, GAG (e.g., total GAG in urine)) is reduced or controlled and/or hepatosplenomegaly is reduced or controlled and/or a biomarker (e.g., I2S) is increased or controlled. In some embodiments, a reference is a control. In some embodiments, a reference is the biomarker level and/or hepatosplenomegaly in a previous biological sample or from an image (e.g., ultrasound) obtained from the subject. In some embodiments, a reference is the biomarker level and/or hepatosplenomegaly from the subject at baseline (e.g., before the recombinant vector of the present disclosure is administered to the subject). In some embodiments, a reference is the biomarker level and/or hepatosplenomegaly in a healthy subject or in a subject who does not have or has not been diagnosed with MPS II. In some embodiments, a reference is the biomarker level and/or hepatosplenomegaly in a subject or group of subjects with MPS II. In some embodiments, a reference is the biomarker level and/or hepatosplenomegaly in a healthy subject or in a subject who does not have or has not been diagnosed with MPS 1. In some embodiments, a reference is the biomarker level and/or hepatosplenomegaly in a subject or group of subjects with MPS I. In some embodiments, a reference is the biomarker level and/or hepatosplenomegaly in a subject or group of subjects who is receiving or has received ERT treatment.

(237) In some embodiments, ERT treatment is discontinued after administration of the recombinant vector of the present disclosure. For example, ERT treatment is stopped after the recombinant vector of the present disclosure is administered to a subject who has been treated with ERT and has anti-IDS Abs levels (e.g., anti-IDS Abs level as a result of ERT treatment). In some embodiments, a subject who has anti-IDS Abs levels has ERT treatment stopped as soon as or immediately after the recombinant vector of the present disclosure is administered to the subject. In some embodiments, anti-IDS Abs levels is determined in a biological sample from a subject (e.g., serum sample). In some embodiments, anti-IDS Abs levels is determined in a biological sample obtained from a subject before the recombinant vector of the present disclosure is administered to the subject. In some embodiments, anti-IDS Abs levels is monitored before and/or after the recombinant vector of the present disclosure is administered to the subject. In some embodiments, if anti-IDS Abs levels is higher than a reference level, ERT treatment is stopped or discontinued. In some embodiments, a reference level is a predetermined level. In some embodiments, a reference level is the anti-IDS Abs level in a previous biological sample obtained from the subject. In some embodiments, a reference level is the anti-IDS Abs level from the subject at baseline (e.g., before the recombinant vector of the present disclosure is administered to the subject). In some embodiments, a reference level is the anti-IDS Abs level in a healthy subject or in a subject who does not have or has not been diagnosed with MPS II. In some embodiments, a reference level is the anti-IDS Abs level in a subject or group of subjects with MPS II. In some embodiments, a reference level is the anti-IDS Abs level in a subject or group of subjects who is receiving or has received ERT treatment. In some embodiments, if the anti-IDS Abs level is higher or increased by about or by at least about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 150%, 250%, 500%, 750%, 1000%, or more than 1000% as compared to a reference level then ERT treatment is discontinued. In some embodiments, if the anti-IDS Abs level is higher or increased by about or by at least about 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 15-fold, 20-fold, 25-fold, 30-fold, 35-fold, 40-fold, 45-fold, 50-fold, 55-fold, 60-fold, 65-fold, 70-fold, 75-fold, 80-fold, 85-fold, 90-fold, 95-fold, 100-fold, 150-fold, 250-fold, 500-fold, 750-fold, 1000-fold, or more than 1000-fold as compared to a reference level then ERT treatment is stopped or discontinued. In some embodiments, anti-IDS Abs level is measured at about, at least about, or every 1 day, 5 days, 7 days, 10 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 13 weeks, 14 weeks, 15 weeks, 16 weeks, 17 weeks, 18 weeks, 19 weeks, 20 weeks, 22 weeks, 24 weeks, 26 weeks, 30 weeks, 35 weeks, 40 weeks, 41 weeks, 42 weeks, 43 weeks, 44 weeks, 45 weeks, 46 weeks, 47 weeks, 48 weeks, 49 weeks, 50 weeks, 51 weeks, 52 weeks, 53 weeks, 54 weeks, 55 weeks, 56 weeks, 57 weeks, 58 weeks, 59 weeks, 60 weeks, 65 weeks, 70 weeks, 75 weeks, 80 weeks, 85 weeks, 90 weeks, 95 weeks, 100 weeks, 104 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, 15 months, 18 months, 21 months, 24 months, 30 months, 36 months, 40 months, 48 months, 50 months, 55 months, 60 months, 65 months, 70 months, 75 months, 80 months, 85 months, 90 months, 95 months, 100 months, 1 year, 1.5 years, 2 years, 2.5 years, 3 years, 3.5 years, 4 years, 4.5 years, 5 years, 5.5 years, 6 years, 6.5 years, 7 years, 7.5 years, 8 years, 8.5 years, 9 years, 9.5 years, 10 years, or more than 10 years after ERT treatment is administered to the subject, after ERT treatment is stopped or discontinued, before a recombinant vector of the present disclosure is administered to the subject and/or after a recombinant vector of the present disclosure is administered to the subject

(238) In some embodiments, efficacy of treatment or monitoring efficacy of treatment (e.g., with an rAAV9 encoding hIDUA) is based on the level of I0S6. In some embodiments, the level of I0S6 is determined from a biological sample from a subject. In some embodiments, the biological sample is plasma. In some embodiments, a decrease in the level of I0S6 after treatment with a recombinant vector of the disclosure (e.g., rAAV9 encoding hIDUA) in comparison with a reference, is indicative of efficacy of treatment. In some embodiments, the reference is a level of I0S6 in a biological sample from the subject obtained prior to administration of a recombinant AAV of the disclosure. In some embodiments, the reference is a predetermined value. In some embodiments, the reference is the level of I0S6 in a biological sample from another subject with MPS I or a population of subjects with MPS I. In some embodiments, the level of I0S6 is decreased after administration of a recombinant AAV of the disclosure as compared to before administration of the rAAV. In some embodiments, the subject was previously treated with ERT prior to rAAV administration and/or received ERT treatment after the rAAV administration. In some embodiments, the decrease in the level of I0S6 is a decrease of about or at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% as compared to the reference. In some embodiments, efficacy of MPS I treatment is an improvement in at least one subtest of the Bayley Scales of Infant and Toddler Development, 3rd Edition (BSID-III) as compared to a reference. In some embodiments, the at least one subtest is age equivalence score, cognitive developmental quotient (DQ), expressive language DQ, receptive language DQ, gross motor DQ, and/or fine motor DQ. In some embodiments, efficacy of MPS I treatment is an improvement in WASI and/or VABS score. In some embodiments, the rAAV9 encoding hIDUA is administered to the human subject in a solution comprising: (a) sodium chloride at a concentration of about 8.77 g/L, (b) magnesium chloride, at a concentration of about 0.244 g/L, (c) potassium chloride at a concentration of about 0.224 g/L, (d) calcium chloride at a concentration of about 0.206 g/L, (e) dextrose at a concentration of about 0.793 g/L, (f) poloxamer 188 at a concentration of about 0.001% (volume/volume), (g) sodium phosphate monobasic monohydrate at a concentration of about 0.0278 g/L, and (h) sodium phosphate dibasic anhydrous at a concentration of about 0.114 g/L.

(239) 5.5.2. Hepatosplenomegaly

(240) In some embodiments, a subject diagnosed with MPS II has hepatosplenomegaly or is experiencing a symptom associated with hepatosplenomegaly. In some embodiments, hepatosplenomegaly is diagnosed by a physical examination. For example, a physician or medical care professional can observe the area around the abdomen for signs of organ enlargement. In some embodiments, a physician or medical care professional feels or palpates the abdomen area of the subject for sensitivity or enlargement of the liver and/or spleen. In some embodiments, a diagnostic test is performed to detect hepatosplenomegaly. For example, hepatosplenomegaly can be detected using a blood test (e.g., liver function test, blood count, and/or tests for clotting factors). In some embodiments, hepatosplenomegaly is detected using an imaging scan such as a computed tomography (CT) scan or ultrasound. In some embodiments, hepatosplenomegaly is detected via a biopsy.

(241) In some embodiments, hepatosplenomegaly is measured before, during, and/or after treatment with a recombinant vector of the present disclosure. In some embodiments, hepatosplenomegaly is measured at different time points before, during, and/or after treatment with a recombinant vector of the present disclosure. In some embodiments, a decrease in hepatosplenomegaly is indicative that the treatment is effective. In some embodiments, assessing or monitoring hepatosplenomegaly is used to determine dosage amount, if dosage is to be increased, if dosage is to be decreased, and/or to determine dosage frequency.

(242) In some embodiments, hepatosplenomegaly is determined before the subject starts treatment with a therapy or treatment of the present disclosure and/or after the subject start treatment with a therapy or treatment of the present disclosure. In some embodiments, hepatosplenomegaly is determined between dosage administrations (e.g., between before the first dose (i.e., before treatment with the recombinant vector of the present disclosure commences) and after the first dose of the recombinant vector of the present disclosure is administered to the subject, between dose 0 and dose 2, between dose 0 and dose 3, between dose 1 and dose 2, between dose 1 and dose 3, and/or between dose 2 and dose 3). In some embodiments, hepatosplenomegaly is determined 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 6 weeks, 8 weeks, 10 weeks, 12 weeks, 14 weeks, 16 weeks, 18 weeks, 20 weeks, 22 weeks, 24 weeks, 26 weeks, 28 weeks, 30 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, 15 months, 18 months, 21 months, 24 months, 30 months, 36 months, 40 months, 48 months, 50 months, 55 months, 60 months, 65 months, 70 months, 75 months, 80 months, 85 months, 90 months, 95 months, 100 months, 1 year, 1.5 years, 2 years, 2.5 years, 3 years, 3.5 years, 4 years, 4.5 years, 5 years, 5.5 years, 6 years, 6.5 years, 7 years, 7.5 years, 8 years, 8.5 years, 9 years, 9.5 years, 10 years, or more than 10 years after a dosage administration or after treatment commences (e.g., after a recombinant vector of the present disclosure is administered to the subject and/or after ERT treatment).

(243) In some embodiments, hepatosplenomegaly (e.g., size of liver of spleen) is decreased by about or at least about 3%, 5%, 7%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 100%, 200%, or more than 200% after a recombinant vector of the present disclosure is administered to the subject. In some embodiments, hepatosplenomegaly is decreased by about or at least about 1.5-fold, 2-fold, 2.5-fold, 3-fold, 5-fold, 7-fold, 10-fold, 15-fold, 20-fold, 25-fold, 30-fold, 35-fold, 40-fold, 45-fold, 50-fold, 55-fold, 60-fold, 65-fold, 70-fold, 75-fold, 80-fold, 85-fold, 90-fold, 95-fold, 97-fold, 100-fold, 200-fold, or more than 200-fold after a recombinant vector of the present disclosure is administered to the subject. In some embodiments, a decrease in hepatosplenomegaly corresponds to a decrease in liver and/or spleen dimension. In some embodiments, a decrease in hepatosplenomegaly corresponds to a decrease in liver and/or spleen mass or diameter. In some embodiments, a decrease in hepatosplenomegaly corresponds to a decrease in liver and/or spleen size. In some embodiments, hepatosplenomegaly decreases a recombinant vector of the present disclosure is administered to the subject and/or between dosage administrations. In some embodiments, hepatosplenomegaly decreases after a recombinant vector of the present disclosure is administered to the subject and/or a dosage administration (e.g., after the first dose, after the second dose, after the third dose, after the fourth dose, after the fifth dose, or after several doses). In some embodiments, hepatosplenomegaly decreases at about, after about, for at least about, or for up to about 1 day, 3 days, 5 days, 7 days, one week, 2 weeks, 3 weeks, 4 weeks, 6 weeks, 8 weeks, 10 weeks, 12 weeks, 14 weeks, 16 weeks, 18 weeks, 20 weeks, 22 weeks, 24 weeks, 26 weeks, 28 weeks, 30 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, 15 months, 18 months, 21 months, 24 months, 30 months, 36 months, 40 months, 48 months, 50 months, 55 months, 60 months, 65 months, 70 months, 75 months, 80 months, 85 months, 90 months, 95 months, 100 months, 1 year, 1.5 years, 2 years, 2.5 years, 3 years, 3.5 years, 4 years, 4.5 years, 5 years, 5.5 years, 6 years, 6.5 years, 7 years, 7.5 years, 8 years, 8.5 years, 9 years, 9.5 years, 10 years, or more than 10 years, after a recombinant vector of the present disclosure is administered to the subject. In some embodiments, a decrease in hepatosplenomegaly is sustained for at least about or for about 1 day, 3 days, 5 days, 7 days, one week, 2 weeks, 3 weeks, 4 weeks, 6 weeks, 8 weeks, 10 weeks, 12 weeks, 14 weeks, 16 weeks, 18 weeks, 20 weeks, 22 weeks, 24 weeks, 26 weeks, 28 weeks, 30 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, 15 months, 18 months, 21 months, 24 months, 30 months, 36 months, 40 months, 48 months, 50 months, 55 months, 60 months, 65 months, 70 months, 75 months, 80 months, 85 months, 90 months, 95 months, 100 months, 1 year, 1.5 years, 2 years, 2.5 years, 3 years, 3.5 years, 4 years, 4.5 years, 5 years, 5.5 years, 6 years, 6.5 years, 7 years, 7.5 years, 8 years, 8.5 years, 9 years, 9.5 years, 10 years, or more than 10 years, after a recombinant vector of the present disclosure is administered to the subject. In some embodiments, the decrease in hepatosplenomegaly is greater in a subject undergoing a treatment of the present disclosure as compared to a decrease in hepatosplenomegaly if the subject was undergoing another treatment used for treating hepatosplenomegaly or MPS II. In some embodiments, the decrease in hepatosplenomegaly is greater in a subject who received treatment of a recombinant vector of the present disclosure as compared to a decrease in hepatosplenomegaly in a comparable subject having a comparable hepatosplenomegaly undergoing another treatment used for treating hepatosplenomegaly or MPS II. In some embodiments, a decrease in hepatosplenomegaly is greater by about or by at least about 3%, 5%, 7%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 100%, 200%, or more than 200% (e.g., as compared to the decrease in hepatosplenomegaly if the subject was undergoing another treatment used for treating hepatosplenomegaly or MPS II).

(244) 5.5.3. Tests for Neurocognitive and Neurodegeneration Function

(245) In certain embodiments, efficacy of treatment with the recombinant vector is monitored by measuring the level of cognitive function in the patient. Cognitive function may be measured by any method known to one of skill in the art. In certain embodiments, cognitive function is measured via a validated instrument for measuring intelligence quotient (IQ). In specific embodiments, IQ is measured by Wechsler Abbreviated Scale of Intelligence, Second Edition (WASI-II). In some embodiments, neurocognition is determined by measuring intelligence quotient (IQ) as measured by Bayley's Infantile Development Scale. In some embodiments, developmental quotient (DQ) is measured using Bayley Scales of Infant Development (BSID-III). In some embodiments, Bayley Scales of Infant and Toddler Development is used to measure motor, cognitive, language, social-emotional, and/or adaptive behavior development in babies, young children, or in a patient of the present disclosure. In some embodiments, efficacy of a treatment of MPS II according to the methods of the present disclosure (e.g., by administering an rAAV encoding hIDS to a subject) is determined by analyzing at least one subtest of BSID-III. In some embodiments, efficacy of a treatment of MPS I according to the methods of the present disclosure (e.g., by administering an rAAV encoding hIDUA to a subject) is determined by analyzing at least one subtest of BSID-III. In some embodiments, efficacy of a treatment of MPS II or MPS I according to the methods of the present disclosure (e.g., by administering an rAAV encoding hIDS or an AAV encoding hIDUA to a subject) is determined by analyzing age equivalence score, cognitive developmental quotient (DQ), expressive language DQ, receptive language DQ, gross motor DQ, and/or fine motor DQ. In some embodiments, the efficacy of MPS II or MPS I treatment is an improvement in at least one subtest of the Bayley Scales of Infant and Toddler Development, 3rd Edition (BSID-III) as compared to a reference. In some embodiments, the at least one subtest is age equivalence score, cognitive developmental quotient (DQ), expressive language DQ, receptive language DQ, gross motor DQ, and/or fine motor DQ. In some embodiments, the improvement is an improvement in DQ of about or at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 17, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, or more than 100. In some embodiments, the age equivalence score is increased by about or at least about 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, 18 months, 24 months, or more than 24 months as compared to a reference. In some embodiments, the reference is the score of the at least one subtest of the BSID-III obtained prior to administration of an rAAV of the present disclosure. In some embodiments, a reference is an average score of at least one subtest of BSID-III obtained from human subjects with MPS II of the same age as the human subject receiving an rAAV of the present disclosure. In some embodiments, a reference is an average score of at least one subtest of BSID-III obtained from human subjects with MPS I of the same age as the human subject receiving an rAAV of the present disclosure. In some embodiments, a level of a biomarker of the present disclosure is indicative of efficacy of an MPS II treatment. For example, in some embodiments, the level of D2S6 in a biological sample from a subject is inversely proportional to the efficacy of MPS II treatment. In some embodiments, a decrease in D2S6 level in a biological sample correlates with an improvement in at least one subtest of BSID-III. In some embodiments, a decrease in I0S6 level in a biological sample correlates with an improvement in at least one subtest of BSID-III. In some embodiments, a decrease in D2S6 level in a biological sample obtained from a subject after an rAAV encoding hIDS is administered to the subject (e.g., as compared to a reference or to the level of D2S6 prior to administration of the rAAV encoding hIDS), correlates with (or is indicative of) an improvement in the age equivalence score of a subject with MPS II. In some embodiments, a decrease in I0S6 level in a biological sample obtained from a subject after an rAAV encoding hIDUA is administered to the subject (e.g., as compared to a reference or to the level of I0S6 prior to administration of the rAAV encoding hIDUA), correlates with (or is indicative of) an improvement in the age equivalence score of a subject with MPS I. In some embodiments, a decrease in D2S6 level in a biological sample obtained from a subject after an rAAV encoding hIDS is administered to the subject (e.g., as compared to a reference or to the level of D2S6 prior to administration of the rAAV encoding hIDS), correlates with (or is indicative of) an improvement in cognitive developmental quotient (DQ), expressive language DQ, receptive language DQ, gross motor DQ, and/or fine motor DQ of a subject with MPS 11. In some embodiments, a decrease in I0S6 level in a biological sample obtained from a subject after an rAAV encoding hIDUA is administered to the subject (e.g., as compared to a reference or to the level of I0S6 prior to administration of the rAAV encoding hIDUA), correlates with (or is indicative of) an improvement in cognitive developmental quotient (DQ), expressive language DQ, receptive language DQ, gross motor DQ, and/or fine motor DQ of a subject with MPS I. In certain embodiments, cognitive function is measured via a validated instrument for measuring memory. In specific embodiments, memory is measured by Hopkins Verbal Learning Test (HVLT). In certain embodiments, cognitive function is measured via a validated instrument for measuring attention. In specific embodiments, attention is measured by Test Of Variables of Attention (TOVA). In certain embodiments, cognitive function is measured via a validated instrument for measuring one or more of IQ, memory, and attention.

(246) In some embodiments, a decrease in a biomarker level (e.g., D2S6, I0S6, HS, GAG (e.g., total GAG in urine)) and/or a decrease in hepatosplenomegaly and/or an increase in a biomarker (e.g., I2S) level is indicative of improved or unchanged neurocognitive assessment (e.g., DQ, IQ, expressive communication, gross motor, receptive communication, and/or fine motor skills). In some embodiments, a decrease in a biomarker level (e.g., D2S6, I0S6, HS, GAG (e.g., total GAG in urine)) and/or a decrease in hepatosplenomegaly and/or an increase in a biomarker level (e.g., I2S) of about or at least about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, or more than 100% as compared to a reference, correlates with an increase (e.g., by about or at least about 1 point, 2 point, 3 points, 4 points, 5 points, 6 points, 7 points, 8 points, 9 points, 10 points, 15 points, 20 points, 25 points, 30 points 35 points, 40 points, 45 points, 50 points, or more than 50 points), an unchanged, or a decrease in neurocognitive assessment (e.g., DQ, expressive communication, gross motor, receptive communication, and/or fine motor skills) by no more than about 30 points, by no more than about 25 points, by no more than about 20 points, by no more than about 15 points, by no more than about 10 points, or by no more than about 5 points. In some embodiments, a decrease in a biomarker level (e.g., D2S6, I0S6, HS, GAG (e.g., total GAG in urine)) and/or a decrease in hepatosplenomegaly and/or an increase in a biomarker level (e.g., I2S) of about or at least about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, or more than 100% (e.g., after a recombinant vector of the present disclosure is administered to the subject) as compared to a reference, correlates with an increase (e.g., by about or at least about 1 month, 2 month, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, 13 months, 14 months, 15 months, 16 months, 17 months, 18 months, 19 months, 20 months, 25 months, 30 months 35 months, 40 months, 45 months, 50 months, or more than 50 months), an unchanged, or a decrease in age equivalence by no more than about 30 months, by no more than about 25 months, by no more than about 20 months, by no more than about 18 months, by no more than about 15 months, by no more than about 14 months, by no more than about 13 months, by no more than about 12 months, by no more than about 11 months, by no more than about 10 months, by no more than about 9 months, by no more than about 8 months, by no more than about 7 months, by no more than about 6 months, by no more than about 5 months, by no more than about 4 months, by no more than about 3 months, by no more than about 2 months, or by no more than about 1 month.

(247) A neurocognitive assessment instrument can be used to determine an indicator such as cognitive age equivalence (AEq) or cognitive developmental quotient (DQ). In some embodiments, the cognitive age equivalence (AEq) of the subject is unchanged or increases in comparison to the baseline level after treatment with a recombinant vector of the present disclosure. An increase relative to the baseline level of the subject can be 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, 15 months 18 months, 20 months, 2 years, 2.5 years, 3 years, or more. In some embodiments, the chronological age of the subject at the time treatment is initiated or escalated is less than about or equal to about 3 months, 6 months, 9 months, 12 months, 18 months, 24 months, 30 months, 36 months, 42 months, 48 months, 60 months, 72 months, 84 months, 96 months, 108 months, 120 months, 5.5 years, 6 years, 6.5 years, 7 years, 7.5 years, 8 years, 8.5 years, 9 years, 9.5 years, 10 years, 10.5 years, 11 years, 11.5 years, 12 years, 12.5 years, 13 years, 14 years, 15 years, 16 years, 17 years, or higher. In some embodiments, the cognitive age equivalence (AEq) before the start of treatment with a recombinant vector of the present disclosure is lower than the baseline level by about, at least about or at most about 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, months, 10 months, 12 months, or more than 12 months. In some embodiments, the cognitive age equivalence (AEq) after the start of treatment with a recombinant vector of the present disclosure is lower than the baseline level by about or at most about 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, months, 10 months, 12 months, or more than 12 months.

(248) In some embodiments, neurodevelopmental function (e.g., AEq or DQ) is determined based on expressive communication, gross motor, receptive communication, and/or fine motor skills. In some embodiments, any one of expressive communication, gross motor, receptive communication, and/or fine motor skills is indicative of AEq and/or DQ. In some embodiments, neurodevelopmental function (e.g., AEq, cognitive developmental quotient (DQ), IQ, expressive communication, gross motor, receptive communication, and/or fine motor skills) of a subject is measured at about, at least about, or every 1 day, 5 days, 7 days, 10 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 13 weeks, 14 weeks, 15 weeks, 16 weeks, 17 weeks, 18 weeks, 19 weeks, 20 weeks, 22 weeks, 24 weeks, 26 weeks, 30 weeks, 35 weeks, 40 weeks, 41 weeks, 42 weeks, 43 weeks, 44 weeks, 45 weeks, 46 weeks, 47 weeks, 48 weeks, 49 weeks, 50 weeks, 51 weeks, 52 weeks, 53 weeks, 54 weeks, 55 weeks, 56 weeks, 57 weeks, 58 weeks, 59 weeks, 60 weeks, 65 weeks, 70 weeks, 75 weeks, 80 weeks, 85 weeks, 90 weeks, 95 weeks, 100 weeks, 104 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, 15 months, 18 months, 21 months, 24 months, 30 months, 36 months, 40 months, 48 months, 50 months, 55 months, 60 months, 65 months, 70 months, 75 months, 80 months, 85 months, 90 months, 95 months, 100 months, 1 year, 1.5 years, 2 years, 2.5 years, 3 years, 3.5 years, 4 years, 4.5 years, 5 years, 5.5 years, 6 years, 6.5 years, 7 years, 7.5 years, 8 years, 8.5 years, 9 years, 9.5 years, 10 years, or more than 10 years after the recombinant vector is administered to the subject.

(249) In some embodiments, treatment with a recombinant vector of the present disclosure (e.g., due to a decrease in a biomarker level (e.g., D2S6, I0S6, HS, GAG (e.g., total GAG in urine)) and/or a decrease in hepatosplenomegaly and/or an increase in a biomarker (e.g., I2S) level) results in an increase in neurocognitive developmental quotient (DQ), AEq, IQ, expressive communication, gross motor, receptive communication, and/or fine motor skills in a patient, e.g., as assessed using Bayley Scales of Infant Development. In some embodiments, treatment with a recombinant vector of the present disclosure (e.g., due to a decrease in a biomarker level (e.g., D2S6, 10S6, HS, GAG (e.g., total GAG in urine)) and/or a decrease in hepatosplenomegaly and/or an increase in a biomarker level (e.g., I2S)) results in unchanged neurocognitive developmental quotient (DQ), AEq, IQ, expressive communication, gross motor, receptive communication, and/or fine motor skills in a patient, e.g., as assessed using Bayley Scales of Infant Development. In some embodiments, the cognitive developmental quotient (DQ), AEq, IQ, expressive communication, gross motor, receptive communication, and/or fine motor skills of a subject is increased, remains unchanged, or is reduced by no more than 30 points, reduced by no more than 25 points, reduced by no more than 20 points, reduced by no more than 15 points, reduced by no more than 10 points, or reduced by no more than 5 points after treatment with a recombinant vector of the present disclosure. In some embodiments, treatment with a recombinant vector of the present disclosure results in an increase (e.g., by about or at least about 1 month, 2 month, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, 13 months, 14 months, 15 months, 16 months, 17 months, 18 months, 19 months, 20 months, 25 months, 30 months 35 months, 40 months, 45 months, 50 months, or more than 50 months), unchanged, or a decrease in age equivalence (AEq) by no more than about 30 months, by no more than about 25 months, by no more than about 20 months, by no more than about 18 months, by no more than about 15 months, by no more than about 14 months, by no more than about 13 months, by no more than about 12 months, by no more than about 11 months, by no more than about 10 months, by no more than about 9 months, by no more than about 8 months, by no more than about 7 months, by no more than about 6 months, by no more than about 5 months, by no more than about 4 months, by no more than about 3 months, by no more than about 2 months, or by no more than about 1 month after a recombinant vector of the present disclosure is administered to the subject. In some embodiments, the cognitive developmental quotient (DQ), AEq, IQ, expressive communication, gross motor, receptive communication, and/or fine motor skills of a subject is increased by about or at least about 1 point, 2 point, 3 points, 4 points, 5 points, 6 points, 7 points, 8 points, 9 points, 10 points, 15 points, 20 points, 25 points, 30 points 35 points, 40 points, 45 points, 50 points, or more than 50 points after treatment with a recombinant vector of the present disclosure (e.g., due to a decrease in a biomarker level (e.g., D2S6, I0S6, HS, GAG (e.g., total GAG in urine)) and/or decrease in hepatosplenomegaly and/or an increase in a biomarker level (e.g., I2S)) as compared to the DQ, AEq, IQ, expressive communication, gross motor, receptive communication, and/or fine motor skills of the subject prior to start of treatment. In some embodiments, the cognitive developmental quotient (DQ), AEq, IQ, expressive communication, gross motor, receptive communication, and/or fine motor skills of a subject remains unchanged or is increased by about or by at least about 1 point, 2 point, 3 points, 4 points, 5 points, 6 points, 7 points, 8 points, 9 points, 10 points, 15 points, 20 points, 25 points, 30 points 35 points, 40 points, 45 points, 50 points, or more than 50 points after about, or after at least about 1 day, 5 days, 7 days, 10 days, 14 days, 21 days, 28 days, one week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, 15 months, 18 months, 21 months, 24 months, 30 months, 36 months, 40 months, 48 months, 50 months, 55 months, 60 months, 65 months, 70 months, 75 months, 80 months, 85 months, 90 months, 95 months, 100 months, 1 year, 1.5 years, 2 years, 2.5 years, 3 years, 3.5 years, 4 years, 4.5 years, 5 years, 5.5 years, 6 years, 6.5 years, 7 years, 7.5 years, 8 years, 8.5 years, 9 years, 9.5 years, 10 years, or more than 10 years after treatment with a recombinant vector of the present disclosure (e.g., after a first dose of the rAAV of the present disclosure is administered to the subject, after several dosages of the rAAV of the present disclosure is administered to the subject, after a last dose of the rAAV of the present disclosure is administered to the subject, after treatment commences with the rAAV of the present disclosure, and/or after termination of treatment with the rAAV of the present disclosure).

(250) In some embodiments, efficacy of treatment with the recombinant vector is monitored by analyzing maladaptive behavior, challenges with toilet training, and/or change in sleep disturbance scale. Maladaptive behaviors and challenges with toilet training are associated with neurodegeneration. As used herein, maladaptive behavior is a measure of an undesirable behavior that interferes with daily function (Sparrow S, Cichetti D, Balla D (2005) Vineland Adaptive Behavior Scales: 2nd Edition. Pearson, Bloomington, IN). In some embodiments, sleep disturbance is determined based on a subject's snoring pattern. In some embodiments, sleep disturbance is determined based on the level of difficulty of breathing during sleep. In some embodiments, a decrease in maladaptive behavior index is indicative of efficacy of treatment with the recombinant vector of the disclosure. In some embodiments, an improvement in toileting skills (e.g., bowel or bladder control) is indicative of efficacy of treatment with the recombinant vector of the disclosure. In some embodiments, an improvement in sleep patterns (e.g., less frequent snoring or improved breathing) is indicative of efficacy of treatment with the recombinant vector of the disclosure.

(251) 5.5.4. Physical Changes

(252) In certain embodiments, efficacy of treatment with the recombinant vector is monitored by measuring physical characteristics associated with lysosomal storage deficiency in the patient. In certain embodiments, the physical characteristics are storage lesions. In certain embodiments, the physical characteristic is short stature. In certain embodiments, the physical characteristic is coarsened facial features. In certain embodiments, the physical characteristic is obstructive sleep apnea. In certain embodiments, the physical characteristic is hearing impairment. In certain embodiments, the physical characteristic is vision impairment. In specific embodiments, the visual impairment is due to corneal clouding. In certain embodiments, the physical characteristic is hydrocephalus. In certain embodiments, the physical characteristic is spinal cord compression. In certain embodiments, the physical characteristic is hepatosplenomegaly. In certain embodiments, the physical characteristics are bone and joint deformities. In certain embodiments, the physical characteristic is cardiac valve disease. In certain embodiments, the physical characteristics are recurrent upper respiratory infections. In certain embodiments, the physical characteristic is carpal tunnel syndrome. In certain embodiments, the physical characteristic is macroglossia (enlarged tongue). In certain embodiments, the physical characteristic is enlarged vocal cords and/or change in voice. Such physical characteristics may be measured by any method known to one of skill in the art.

(253) TABLE-US-00023 TABLEOFSEQUENCES SEQ ID NO: Description Sequence 1 HumanIDSamino MPPPRTGRGLLWLGLVLSSVCVALGSETQANSTTDALNVL acidsequence LIIVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQ QAVCAPSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIP QYFKENGYVTMSVGKVFHPGISSNHTDDSPYSWSFPPYHP SSEKYENTKTCRGPDGELHANLLCPVDVLDVPEGTLPDKQ STEQAIQLLEKMKTSASPFFLAVGYHKPHIPFRYPKEFQK LYPLENITLAPDPEVPDGLPPVAYNPWMDIRQREDVQALN ISVPYGPIPVDFQRKIRQSYFASVSYLDTQVGRLLSALDD LQLANSTIIAFTSDHGWALGEHGEWAKYSNFDVATHVPLI FYVPGRTASLPEAGEKLFPYLDPFDSASQLMEPGRQSMDL VELVSLFPTLAGLAGLQVPPRCPVPSFHVELCREGKNLLK HFRFRDLEEDPYLPGNPRELIAYSQYPRPSDIPQWNSDKP SLKDIKIMGYSIRTIDYRYTVWVGFNPDEFLANFSDIHAG ELYFVDSDPLQDHNMYNDSQGGDLFQLLMP 2 Oligodendrocyte- MEYQILKMSLCLFILLFLTPGILC myelinglycoprotein (hOMG)signal peptide 3 Cellularrepressor MSVRRGRRPARPGTRLSWLLCCSALLSPAAG ofE1A-stimulated genes2(hCREG2) signalpeptide 4 V-setand MEQRNRLGALGYLPPLLLHALLLFVADA transmembrane domaincontaining 2B(hVSTM2B) signalpeptide 5 Protocadherinalpha- MVFSRRGGLGARDLLLWLLLLAAWEVGSG 1(hPCADHA1) signalpeptide 6 FAM19A1(TAFA1) MAMVSAMSWVLYLWISACA signalpeptide 7 VEGF-Asignal MNFLLSWVHWSLALLLYLHHAKWSQA peptide 8 Fibulin-1signal MERAAPSRRVPLPLLLLGGLALLAAGVDA peptide 9 Vitronectinsignal MAPLRPLLILALLAWVALA peptide 10 ComplementFactor MRLLAKIICLMLWAICVA Hsignalpeptide 11 Opticinsignal MRLLAFLSLLALVLQETGT peptide 12 Albuminsignal MKWVTFISLLFLFSSAYS peptide 13 Chymotrypsinogen MAFLWLLSCWALLGTTFG signalpeptide 14 Interleukin-2signal MYRMQLLSCIALILALVTNS peptide 15 Trypsinogen-2 MNLLLILTFVAAAVA signalpeptide 16 AAV1 MAADGYLPDWLEDNLSEGIREWWDLKPGAPKPKANQQKQDDG RGLVLPGYKYLGPFNGLDKGEPVNAADAAALEHDKAYDQQLK AGDNPYLRYNHADAEFQERLQEDTSFGGNLGRAVFQAKKRVL EPLGLVEEGAKTAPGKKRPVEQSPQEPDSSSGIGKTGQQPAK KRLNFGQTGDSESVPDPQPLGEPPATPAAVGPTTMASGGGAP MADNNEGADGVGNASGNWHCDSTWLGDRVITTSTRTWALPTY NNHLYKQISSASTGASNDNHYFGYSTPWGYFDFNRFHCHFSP RDWQRLINNNWGFRPKRLNFKLFNIQVKEVTTNDGVTTIANN LTSTVQVFSDSEYQLPYVLGSAHQGCLPPFPADVFMIPQYGY LTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFTFSYTFEEVP FHSSYAHSQSLDRLMNPLIDQYLYYLNRTQNQSGSAQNKDLL FSRGSPAGMSVQPKNWLPGPCYRQQRVSKTKTDNNNSNFTWT GASKYNLNGRESIINPGTAMASHKDDEDKFFPMSGVMIFGKE SAGASNTALDNVMITDEEEIKATNPVATERFGTVAVNFQSSS TDPATGDVHAMGALPGMVWQDRDVYLQGPIWAKIPHTDGHFH PSPLMGGFGLKNPPPQILIKNTPVPANPPAEFSATKFASFIT QYSTGQVSVEIEWELQKENSKRWNPEVQYTSNYAKSANVDFT VDNNGLYTEPRPIGTRYLTRPL 17 AAV2 MAADGYLPDWLEDTLSEGIRQWWKLKPGPPPPKPAERHKDDS RGLVLPGYKYLGPFNGLDKGEPVNEADAAALEHDKAYDRQLD SGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRVL EPLGLVEEPVKTAPGKKRPVEHSPVEPDSSSGTGKAGQQPAR KRLNFGQTGDADSVPDPQPLGQPPAAPSGLGTNTMATGSGAP MADNNEGADGVGNSSGNWHCDSTWMGDRVITTSTRTWALPTY NNHLYKQISSQSGASNDNHYFGYSTPWGYFDFNRFHCHFSPR DWQRLINNNWGFRPKRLNFKLFNIQVKEVTQNDGTTTIANNL TSTVQVFTDSEYQLPYVLGSAHQGCLPPFPADVFMVPQYGYL TLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFTFSYTFEDVPF HSSYAHSQSLDRLMNPLIDQYLYYLSRTNTPSGTTTQSRLQF SQAGASDIRDQSRNWLPGPCYRQQRVSKTSADNNNSEYSWTG ATKYHLNGRDSLVNPGPAMASHKDDEEKFFPQSGVLIFGKQG SEKTNVDIEKVMITDEEEIRTTNPVATEQYGSVSTNLQRGNR QAATADVNTQGVLPGMVWQDRDVYLQGPIWAKIPHTDGHFHP SPLMGGFGLKHPPPQILIKNTPVPANPSTTFSAAKFASFITQ YSTGQVSVEIEWELQKENSKRWNPEIQYTSNYNKSVNVDFTV DTNGVYSEPRPIGTRYLTRNL 18 AAV3-3 MAADGYLPDWLEDNLSEGIREWWALKPGVPQPKANQQHQDNR RGLVLPGYKYLGPGNGLDKGEPVNEADAAALEHDKAYDQQLK AGDNPYLKYNHADAEFQERLQEDTSFGGNLGRAVFQAKKRIL EPLGLVEEAAKTAPGKKGAVDQSPQEPDSSSGVGKSGKQPAR KRLNFGQTGDSESVPDPQPLGEPPAAPTSLGSNTMASGGGAP MADNNEGADGVGNSSGNWHCDSQWLGDRVITTSTRTWALPTY NNHLYKQISSQSGASNDNHYFGYSTPWGYFDFNRFHCHFSPR DWQRLINNNWGFRPKKLSFKLFNIQVRGVTQNDGTTTIANNL TSTVQVFTDSEYQLPYVLGSAHQGCLPPFPADVFMVPQYGYL TLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFQFSYTFEDVPF HSSYAHSQSLDRLMNPLIDQYLYYLNRTQGTTSGTTNQSRLL FSQAGPQSMSLQARNWLPGPCYRQQRLSKTANDNNNSNFPWT AASKYHLNGRDSLVNPGPAMASHKDDEEKFFPMHGNLIFGKE GTTASNAELDNVMITDEEEIRTINPVATEQYGTVANNLQSSN TAPTTGTVNHQGALPGMVWQDRDVYLQGPIWAKIPHTDGHFH PSPLMGGFGLKHPPPQIMIKNTPVPANPPTTFSPAKFASFIT QYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYNKSVNVDFT VDTNGVYSEPRPIGTRYLTRNL 19 AAV4-4 MTDGYLPDWLEDNLSEGVREWWALQPGAPKPKANQQHQDNAR GLVLPGYKYLGPGNGLDKGEPVNAADAAALEHDKAYDQQLKA GDNPYLKYNHADAEFQQRLQGDTSFGGNLGRAVFQAKKRVLE PLGLVEQAGETAPGKKRPLIESPQQPDSSTGIGKKGKQPAKK KLVFEDETGAGDGPPEGSTSGAMSDDSEMRAAAGGAAVEGGQ GADGVGNASGDWHCDSTWSEGHVTTTSTRTWVLPTYNNHLYK RLGESLQSNTYNGFSTPWGYFDFNRFHCHFSPRDWQRLINNN WGMRPKAMRVKIFNIQVKEVTTSNGETTVANNLTSTVQIFAD SSYELPYVMDAGQEGSLPPFPNDVFMVPQYGYCGLVTGNTSQ QQTDRNAFYCLEYFPSQMLRTGNNFEITYSFEKVPFHSMYAH SQSLDRLMNPLIDQYLWGLQSTTTGTTLNAGTATTNFTKLRP TNFSNFKKNWLPGPSIKQQGFSKTANQNYKIPATGSDSLIKY ETHSTLDGRWSALTPGPPMATAGPADSKFSNSQLIFAGPKQN GNTATVPGTLIFTSEEELAATNATDTDMWGNLPGGDQSNSNL PTVDRLTALGAVPGMVWQNRDIYYQGPIWAKIPHTDGHFHPS PLIGGFGLKHPPPQIFIKNTPVPANPATTFSSTPVNSFITQY STGQVSVQIDWEIQKERSKRWNPEVQFTSNYGQQNSLLWAPD AAGKYTEPRAIGTRYLTHHL 20 AAV5 MSFVDHPPDWLEEVGEGLREFLGLEAGPPKPKPNQQHQDQAR GLVLPGYNYLGPGNGLDRGEPVNRADEVAREHDISYNEQLEA GDNPYLKYNHADAEFQEKLADDTSFGGNLGKAVFQAKKRVLE PFGLVEEGAKTAPTGKRIDDHFPKRKKARTEEDSKPSTSSDA EAGPSGSQQLQIPAQPASSLGADTMSAGGGGPLGDNNQGADG VGNASGDWHCDSTWMGDRVVTKSTRTWVLPSYNNHQYREIKS GSVDGSNANAYFGYSTPWGYFDFNRFHSHWSPRDWQRLINNY WGFRPRSLRVKIFNIQVKEVTVQDSTTTIANNLTSTVQVFTD DDYQLPYVVGNGTEGCLPAFPPQVFTLPQYGYATLNRDNTEN PTERSSFFCLEYFPSKMLRTGNNFEFTYNFEEVPFHSSFAPS QNLFKLANPLVDQYLYRFVSTNNTGGVQFNKNLAGRYANTYK NWFPGPMGRTQGWNLGSGVNRASVSAFATTNRMELEGASYQV PPQPNGMTNNLQGSNTYALENTMIFNSQPANPGTTATYLEGN MLITSESETQPVNRVAYNVGGQMATNNQSSTTAPATGTYNLQ EIVPGSVWMERDVYLQGPIWAKIPETGAHFHPSPAMGGFGLK HPPPMMLIKNTPVPGNITSFSDVPVSSFITQYSTGQVTVEME WELKKENSKRWNPEIQYTNNYNDPQFVDFAPDSTGEYRTTRP IGTRYLTRPL 21 AAV6 MAADGYLPDWLEDNLSEGIREWWDLKPGAPKPKANQQKQDDG RGLVLPGYKYLGPFNGLDKGEPVNAADAAALEHDKAYDQQLK AGDNPYLRYNHADAEFQERLQEDTSFGGNLGRAVFQAKKRVL EPFGLVEEGAKTAPGKKRPVEQSPQEPDSSSGIGKTGQQPAK KRLNFGQTGDSESVPDPQPLGEPPATPAAVGPTTMASGGGAP MADNNEGADGVGNASGNWHCDSTWLGDRVITTSTRTWALPTY NNHLYKQISSASTGASNDNHYFGYSTPWGYFDFNRFHCHFSP RDWQRLINNNWGFRPKRLNFKLFNIQVKEVTTNDGVTTIANN LTSTVQVFSDSEYQLPYVLGSAHQGCLPPFPADVFMIPQYGY LTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFTFSYTFEDVP FHSSYAHSQSLDRLMNPLIDQYLYYLNRTQNQSGSAQNKDLL FSRGSPAGMSVQPKNWLPGPCYRQQRVSKTKTDNNNSNFTWT GASKYNLNGRESIINPGTAMASHKDDKDKFFPMSGVMIFGKE SAGASNTALDNVMITDEEEIKATNPVATERFGTVAVNLQSSS TDPATGDVHVMGALPGMVWQDRDVYLQGPIWAKIPHTDGHFH PSPLMGGFGLKHPPPQILIKNTPVPANPPAEFSATKFASFIT QYSTGQVSVEIEWELQKENSKRWNPEVQYTSNYAKSANVDFT VDNNGLYTEPRPIGTRYLTRPL 22 AAV7 MAADGYLPDWLEDNLSEGIREWWDLKPGAPKPKANQQKQDNG RGLVLPGYKYLGPFNGLDKGEPVNAADAAALEHDKAYDQQLK AGDNPYLRYNHADAEFQERLQEDTSFGGNLGRAVFQAKKRVL EPLGLVEEGAKTAPAKKRPVEPSPQRSPDSSTGIGKKGQQPA RKRLNFGQTGDSESVPDPQPLGEPPAAPSSVGSGTVAAGGGA PMADNNEGADGVGNASGNWHCDSTWLGDRVITTSTRTWALPT YNNHLYKQISSETAGSTNDNTYFGYSTPWGYFDFNRFHCHFS PRDWQRLINNNWGFRPKKLRFKLFNIQVKEVTTNDGVTTIAN NLTSTIQVFSDSEYQLPYVLGSAHQGCLPPFPADVFMIPQYG YLTLNNGSQSVGRSSFYCLEYFPSQMLRTGNNFEFSYSFEDV PFHSSYAHSQSLDRLMNPLIDQYLYYLARTQSNPGGTAGNRE LQFYQGGPSTMAEQAKNWLPGPCFRQQRVSKTLDQNNNSNFA WTGATKYHLNGRNSLVNPGVAMATHKDDEDRFFPSSGVLIFG KTGATNKTTLENVLMTNEEEIRPTNPVATEEYGIVSSNLQAA NTAAQTQVVNNQGALPGMVWQNRDVYLQGPIWAKIPHTDGNF HPSPLMGGFGLKHPPPQILIKNTPVPANPPEVFTPAKFASFI TQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNFEKQTGVDF AVDSQGVYSEPRPIGTRYLTRNL 23 AAV8 MAADGYLPDWLEDNLSEGIREWWALKPGAPKPKANQQKQDDG RGLVLPGYKYLGPFNGLDKGEPVNAADAAALEHDKAYDQQLQ AGDNPYLRYNHADAEFQERLQEDTSFGGNLGRAVFQAKKRVL EPLGLVEEGAKTAPGKKRPVEPSPQRSPDSSTGIGKKGQQPA RKRLNFGQTGDSESVPDPQPLGEPPAAPSGVGPNTMAAGGGA PMADNNEGADGVGSSSGNWHCDSTWLGDRVITTSTRTWALPT YNNHLYKQISNGTSGGATNDNTYFGYSTPWGYFDFNRFHCHF SPRDWQRLINNNWGFRPKRLSFKLFNIQVKEVTQNEGTKTIA NNLTSTIQVFTDSEYQLPYVLGSAHQGCLPPFPADVFMIPQY GYLTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFQFTYTFED VPFHSSYAHSQSLDRLMNPLIDQYLYYLSRTQTTGGTANTQT LGFSQGGPNTMANQAKNWLPGPCYRQQRVSTTTGQNNNSNFA WTAGTKYHLNGRNSLANPGIAMATHKDDEERFFPSNGILIFG KQNAARDNADYSDVMLTSEEEIKTTNPVATEEYGIVADNLQQ QNTAPQIGTVNSQGALPGMVWQNRDVYLQGPIWAKIPHTDGN FHPSPLMGGFGLKHPPPQILIKNTPVPADPPTTFNQSKLNSF ITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYYKSTSVD FAVNTEGVYSEPRPIGTRYLTRNL 24 hu31 MAADGYLPDWLEDTLSEGIRQWWKLKPGPPPPKPAERHKDDS RGLVLPGYKYLGPGNGLDKGEPVNAADAAALEHDKAYDQQLK AGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRLL EPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGSQPAK KKLNFGQTGDTESVPDPQPIGEPPAAPSGVGSLTMASGGGAP VADNNEGADGVGSSSGNWHCDSQWLGDRVITTSTRTWALPTY NNHLYKQISNSTSGGSSNDNAYFGYSTPWGYFDFNRFHCHFS PRDWQRLINNNWGFRPKRLNFKLFNIQVKEVTDNNGVKTIAN NLTSTVQVFTDSDYQLPYVLGSAHEGCLPPFPADVFMIPQYG YLTLNDGGQAVGRSSFYCLEYFPSQMLRTGNNFQFSYEFENV PFHSSYAHSQSLDRLMNPLIDQYLYYLSKTINGSGQNQQTLK FSVAGPSNMAVQGRNYIPGPSYRQQRVSTTVTQNNNSEFAWP GASSWALNGRNSLMNPGPAMASHKEGEDRFFPLSGSLIFGKQ GTGRDNVDADKVMITNEEEIKTTNPVATESYGQVATNHQSAQ AQAQTGWVQNQGILPGMVWQDRDVYLQGPIWAKIPHTDGNFH PSPLMGGFGMKHPPPQILIKNTPVPADPPTAFNKDKLNSFIT QYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYYKSNNVEFA VSTEGVYSEPRPIGTRYLTRNL 25 hu32 MAADGYLPDWLEDTLSEGIRQWWKLKPGPPPPKPAERHKDDS RGLVLPGYKYLGPGNGLDKGEPVNAADAAALEHDKAYDQQLK AGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRLL EPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGSQPAK KKLNFGQTGDTESVPDPQPIGEPPAAPSGVGSLTMASGGGAP VADNNEGADGVGSSSGNWHCDSQWLGDRVITTSTRTWALPTY NNHLYKQISNSTSGGSSNDNAYFGYSTPWGYFDFNRFHCHFS PRDWQRLINNNWGFRPKRLNFKLFNIQVKEVTDNNGVKTIAN NLTSTVQVFTDSDYQLPYVLGSAHEGCLPPFPADVFMIPQYG YLTLNDGSQAVGRSSFYCLEYFPSQMLRTGNNFQFSYEFENV PFHSSYAHSQSLDRLMNPLIDQYLYYLSKTINGSGWNQQTLK FSVAGPSNMAVQGRNYIPGPSYRQQRVSTTVTQNNNSEFAWP GASSWALNGRNSLMNPGPAMASHKEGEDRFFPLSGSLIFGKQ GTGRDNVDADKVMITNEEEIKTTNPVATESYGQVATNHQSAQ AQAQTGWVQNQGILPGMVWQDRDVYLQGPIWAKIPHTDGNFH PSPLMGGFGMKHPPPQILIKNTPVPADPPTAFNKDKLNSFIT QYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYYKSNNVEFA VNTEGVYSEPRPIGTRYLTRNL 26 AAV9 MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNA RGLVLPGYKYLGPGNGLDKGEPVNAADAAALEHDKAYDQQLK AGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRLL EPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAK KRLNFGQTGDTESVPDPQPIGEPPAAPSGVGSLTMASGGGAP VADNNEGADGVGSSSGNWHCDSQWLGDRVITTSTRTWALPTY NNHLYKQISNSTSGGSSNDNAYFGYSTPWGYFDFNRFHCHFS PRDWQRLINNNWGFRPKRLNFKLFNIQVKEVTDNNGVKTIAN NLTSTVQVFTDSDYQLPYVLGSAHEGCLPPFPADVFMIPQYG YLTLNDGSQAVGRSSFYCLEYFPSQMLRTGNNFQFSYEFENV PFHSSYAHSQSLDRLMNPLIDQYLYYLSKTINGSGQNQQTLK FSVAGPSNMAVQGRNYIPGPSYRQQRVSTTVTQNNNSEFAWP GASSWALNGRNSLMNPGPAMASHKEGEDRFFPLSGSLIFGKQ GTGRDNVDADKVMITNEEEIKTTNPVATESYGQVATNHQSAQ AQAQTGWVQNQGILPGMVWQDRDVYLQGPIWAKIPHTDGNFH PSPLMGGFGMKHPPPQILIKNTPVPADPPTAFNKDKLNSFIT QYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYYKSNNVEFA VNTEGVYSEPRPIGTRYLTRNL 27 SP|P22304|IDSHU MPPPRTGRGLLWLGLVLSSVCVALGSETQANSTTDALNVLLI MAN[Homo IVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVC sapiens] APSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKEN GYVTMSVGKVFHPGISSNHTDDSPYSWSFPPYHPSSEKYENT KTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTEQAIQLLE KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPD PEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVDFQR KIRQSYFASVSYLDTQVGRLLSALDDLQLANSTIIAFTSDHG WALGEHGEWAKYSNFDVATHVPLIFYVPGRTASLPEAGEKLF PYLDPFDSASQLMEPGRQSMDLVELVSLFPTLAGLAGLQVPP RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIA YSQYPRPSDIPQWNSDKPSLKDIKIMGYSIRTIDYRYTVWVG FNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLFQ LLMP 28 TR|K6ZGI9_PANT MPPPRTGRGLPWLGLVLSSVCVALGSETQANSTTDALNVLLI R[Pantroglodytes IVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVC (Chimpanzee)] APSRVSFLTGRRPDPTRLYDFNSYWRVHAGNFSTIPQYFKEN GYVTMSVGKVFHPGISSNHTDDSPYSWSFPPYHPSSEKYENT KTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTEQAIQLLE KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPD PEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVDFQR KIRQSYFASVSYLDTQVGRLLSALDDLQLANSTIIAFTSDHG WALGEHGEWAKYSNFDVATHVPLMFYVPGRTASLPEAGEKLF PYLDPFDSASQLMEPGRQSMDLVELVSLFPTLAGLAGLQAPP RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIA YSQYPRPSDIPQWNSDKPSLKDIKIMGYSIRTIDYRYTVWIG FNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLFQ LLMP 29 TR|K7BKV4_PANT MPPPRTGRGLPWLGLVLSSVCVALGSETQANSTTDALNVLLI R[Pantroglodytes IVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVC (Chimpanzee)] APSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKEN GYVTMSVGKVFHPGISSNHTDDSPYSWSFPPYHPSSEKYENT KTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTEQAIQLLE KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPD PEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVDFQR KIRQSYFASVSYLDTQVGRLLSALDDLQLANSTIIAFTSDHG WALGEHGEWAKYSNFDVATHVPLMFYVPGRTASLPEAGEKLF PYLDPFDSASQLMEPGRQSMDLVELVSLFPTLAGLAGLQAPP RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIA YSQYPRPSDIPQWNSDKPSLKDIKIMGYSIRTIDYRYTVWIG FNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLFQ LLMP 30 TR|H9FTX2_MAC MPTPGSGRGFLWLGLVLSSVCVALGCETQANSTTDALNILLI MU[Macaca IVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVC mulatta(Rhesus APSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKEN macaque)] GYVTMSVGKVFHPGITSNHTDDSPYSWSFPPYHPSSEKYENT KTCRGPDGELHANLLCPVDVVDVPEGTLPDKQSTEQAIQLLE KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPD SEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVEFQR KIRQSYFASVSYLDTQVGRLLSALDDLQLANSTIVAFTSDHG WALGEHGEWAKYSNFDVATHVPLMFYVPGRTASLPEAGEKLF PYLDPFDSASELMEPGRQSMDLVELVSLFPTLAGLAGLQVPP RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIA YSQYPRPADFPQWNSDKPSLKDIKIMGYSIRTIDYRYTVWVG FNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLFQ LLMP 31 TRF7EJG2_CALJA MPPPRTSRCLLLLGLVLGSVCVTLGSQAQASSTTDALNVLLI [Callithrixjacchus IVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVC (White-tufted-ear APSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKDN marmoset)] GYVTMSVGKVFHPGISSNHSDDSPYSWSFPPYHPSSEKYENT KTCRGPDGELHANLLCPVDVVDVPEGTLPDKQSTEEAIRLLE KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPD PEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVDFQR KIRQSYFASVSYLDTQVGHLLSALDDLQLANSTIVAFTSDHG WALGEHGEWAKYSNFDVATRVPLMFYVPGRTASLPEADEKLF PYVDPFHSASELMEPGRQSMDLVELVSLFPTLAGLAGLQVPP RCPVPSFHVELCREGKSLLKHFRFHGLEEDPYLPGNPRELIA YSQYPRPADFPQWNSDKPSLKYIKIMGYSIRTVDYRYTVWVG FNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGELFQ SLMP 32 TR|U3DTL8_CALJA MPPPRPSRCLLLLGLVLGSVCVTLGSQAQASSTTDALNVLLI [Callithrixjacchus IVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVC (White-tufted-car APSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKDN marmoset)] GYVTMSVGKVFHPGISSNHSDDSPYSWSFPPYHPSSEKYENT KTCRGPDGELHANLLCPVDVVDVPEGTLPDKQSTEEAIRLLE KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPD PEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVDFQR KIRQSYFASVSYLDTQVGHLLSALDDLQLANSTIVAFTSDHG WALGEHGEWAKYSNFDVATRVPLMFYVPGRTASLPEADEKLF PYVDPFHSASELMEPGRQSMDLVELVSLFPTLAGLAGLQVPP RCPVPSFHVELCREGKSLLKHFRFHGLEEDPYLPGNPRELIA YSQYPRPADFPQWNSDKPSLKYIKIMGYSIRTVDYRYTVWVG FNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGELFQ SLMP 33 TR|G7NRX7_MAC MPTPGSGRGFLWLGLVLSSVCVALGCETQANSTTDALNILLI MU[Macaca IVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVC mulatta(Rhesus APSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKEN macaque)] GYVTMSVGKVFHPGITSNHTDDSPYSWSFPPYHPSSEKYENT KTCRGPDGELHANLLCPVDVVDVPEGTLPDKQSTEQAIQLLE KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPD SEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVEFQR KIRQSYFASVSYLDTQVGRLLSALDDLQLANSTIVAFTSDHG WALGEHGEWAKYSNFDVATHVPLMFYVPGRTASLPEAGEKLF PYLDPFDSASELMEPGRQSMDLVELVSLFPTLAGLAGLQVPP RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIA YSQYPRPADFPQWNSDKPSLKDIKIMGYSIRTIDYRYTVWVG FNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLLQ LLMP 34 TR|G7Q1V9_MAC MPTPGSGRGFLWLGLVLSSVCVALGCETQANSTTDALNILLI FA[Macaca IVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVC fascicularis(Crab- APSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKEN eatingmacaque; GYVTMSVGKVFHPGITSNHTDDSPYSWSFPPYHPSSEKYENT Cynomologous KTCRGPDGELHANLLCPVDVVDVPEGTLPDKQSTEQAIQLLE monkey)] KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPD SEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVEFQR KIRQSYFASVSYLDTQVGHLLSALDDLQLANSTIVAFTSDHG WALGEHGEWAKYSNFDVATHVPLMFYVPGRTASLPEAGEKLF PYLDPFDSASELMEPGRQSMDLVELVSLFPTLAGLAGLQVPP RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIA YSQYPRPADFPQWNSDKPSLKDIKIMGYSIRTIDYRYTVWVG FNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLFQ LLMP 35 TR|H2PX10_PONA MPPPRTGRGLLWLGLVLSSVCVALGSETQADSTTDGLNVLLI B[Pongoabelii IVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVC (Sumatran APSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKEN orangutan)] GYVTMSVGKVFHPGISSNHTDDSPYSWSFPPYHPSSEKYENT KTCRGPDGELHANLIAKKMCWMFPRAPCCDKQSTEQAIQLLE KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPD PEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVDFQQ KIRQSYFASVSYLDTQVGRLLSTLDDLQLANSTIIAFTSDHG WALGEHGEWAKYSNFDVATHVPLMFYVPGRTASLPEAGEKLF PYLDPFDSASELMEPGRQSMDLVELVSLFPTLAGLAGLQVPP RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIA YSQYPRPADIPQWNSDKPSLKDIKIMGYSIRTIDYRYTVWVG FNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLFQ LLMP 36 TR|A0A0D9R4D1_ MPTPGSGRGFLWLGLVLSSVCVALGSETQANSTTDALNILLI CHLSB IVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVC [Chlorocebus APSRVSFLTGRRPDTTRLHNFNSYWRVHAGNFSTIPQYFKEN sabaeus(Green GYVTMSVGKVFHPGITSNHTDDSPYSWSFPPYHPSSEKYENT monkey)] KTCRGPDGELHANLLCPVDVVDVPEGTLPDKQSTEQAIQLLE KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPD SEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVEFQR KIRQSYFASVSYLDTQVGRLLSALDDLQLANSTIVAFTSDHG WALGEHGEWAKYSNFDVATHVPLMFYVPGRTASLPEAGEKLF PYLDPFDSASELMEPGRQSMDLVELVSLFPTLAGLAGLQVPP RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIA YSQYPRPADFPQWNSDKPNLKDIKIMGYSIRTIDYRYTVWVG FNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLFQ LLMP 37 TR|G1RST8|G1RST MSPPRTGQGLLWLGVVLSSVCVAXVTSPKPPSFVDALNVLLI 8_NOMLE IVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVC [Nomascus APSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKEN leucogenys GYVTMSVGKVFHPGISSNHTDDSPYSWSFPPYHPSSXXXXXX (Northernwhite- KTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTEQAIQLLE cheekedgibbon)] KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPD PEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVDFQR KIRQSYFASVSYLDTQVGRLLSALDDLQLANSTIIAFTSDHG WALGEHGEWAKYSNFDVATHVPLMFYVPGRTASLPEAGEKLF PYLDPFDSASELMEPGRQSMDLVELVSLFPTLAGLAGLQVPP RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIA YSQYPRPADIPQWNSDKPSLKDIKIMGYSIRTIDYRYTVWVG FSPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLFQ LLMP 38 UPI0000D9F625 MPTPGSGRGFLWLGLVLSSVCVALGCETQANSTTDALNILLI [Macacamulatta IVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVC (Rhesusmacaque)] APSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKEN GYVTMSVGKVFHPGITSNHTDDSPYSWSFPPYHPSSEKYENT KTCRGPDGELHANLLCPVDVVDVPEGTLPDKQSTEQAIQLLE KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPD SEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVEFQR KIRQSYFASVSYLDTQVGHLLSALDDLQLANSTIVAFTSDHG WALGEHGEWAKYSNFDVATHVPLMFYVPGRTASLPEAGEKLF PYLDPFDSASELMEPGRQSMDLVELVSLFPTLAGLAGLQVPP RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIA YSQYPRPADFPQWNSDKPSLKDIKIMGYSIRTIDYRYTVWVG FNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLLQ LLMP 39 UPI000274358B MPPPRTGRGLLWLGLVLSSVCVALGSETQANSTTDALNVLLI [Panpaniscus IVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVC (Pygmychimpanzee; APSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKEN Bonobo)] GYVTMSVGKVFHPGISSNHTDDSPYSWSFPPYHPSSEKYENT KTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTEQAIRLLE KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPD PEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVDFQR KIRQSYFASVSYLDTQVGRLLSALDDLQLANSTIIAFTSDHG WALGEHGEWAKYSNFDVATHVPLMFYVPGRTASLPEAGEKLF PYLDPFDSASQLMEPGRQSMDLVELVSLFPTLAGLAGLQVPP RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIA YSQYPRPSDIPQWNSDKPSLKDIKIMGYSIRTIDYRYTVWVG FNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLFQ LLMP 40 UPI00027F6FC5 MPTPGSGRGFLWLGLVLSSVCVALGCEMQANSTTDALNILLI [PapioAnubis IVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVC (Olivebaboon)] APSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKEN GYVTMSVGKVFHPGITSNHTDDSPYSWSFPPYHPSSEKYENT KTCRGPDGELHANLLCPVDVVDVPEGTLPDKQSTEQAIQLLE KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPD SEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVEFQR KIRQSYFASVSYLDTQVGRLLSALDDLQLANSTIVAFTSDHG WALGEHGEWAKYSNFDVATHVPLMFYVPGRTASLPEAGEKLF PYLDPFDSASELMEPGRQSMDLVELVSLFPTLAGLAGLQVPP RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIA YSQYPRPADFPQWNSDKPSLKDIKIMGYSIRTIDYRYTVWVG FNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLFQ LLMP 41 UPI00027FAE03 MPPPRTGLCLLLLGLVLGSVCVTLGSQAQANSTTDALNVLLI [Saimiriboliviensis IVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFVQQAVC (Boliviansquirrel APSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKDN monkey)] GYVTMSVGKVFHPGISSNHSDDSPYSWSFPPYHPSSEKYENT KTCRGPDGELHANLLCPVDVVDVPEGTLPDKQSTEEAIRLLK KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPD PEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVDFQR KIRQSYFASVSYLDTQVGHLLSALDDLHLANSTIVAFTSDHG WALGEHGEWAKYSNFDVATRVPLMFYVPGRTASLPETGEKLF PYVDPFHSASELMEPGRQSTDLVELVSLFPTLAGLAGLQVPP RCPVPSFHIELCREGKNLLKHFRFHGLEEDPYLPGNPRELIA YSQYPRPADFPQQNSDKPSLKYIKIMGYSIRTVDYRYTVWVG FNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGELFQ SLMP 42 UPI0003ABBF28 MPTPGSGRGFLWLGLVLSSVCVALGCETQANSTTDALNILLI [Macacafascicularis IVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQEAVC (Crab-eating APSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKEN macaque; GYVTMSVGKVFHPGITSNHTDDSPYSWSFPPYHPSSEKYENT Cynomologous KTCRGPDGELHANLLCPVDVVDVPEGTLPDKQSTEQAIQLLE monkey)] KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPD SEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVEFQR KIRQSYFASVSYLDTQVGRLLSALDDLQLANSTIVAFTSDHG WALGEHGEWAKYSNFDVATHVPLMFYVPGRTASLPEAGEKLF PYLDPFDSASELMEPGRQSMDLVELVSLFPTLAGLAGLQVPP RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIA YSQYPRPADFPQWNSDKPSLKDIKIMGYSIRTIDYRYTVWVG FNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLFQ LLMP 43 UPI000533297F MPTPASGRGFLWLGLVLSSVCVALGSETQANSTTDALNILLI [Rhinopithecus IVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVC roxellana(Golden APSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKEN snub-nosedmonkey; GYVTMSVGKVFHPGITSNHTDDSPYSWSFPPYHPSSEKYENT Pygathrix KTCRGPDGELHANLLCPVDVVDVPEGTLPDKQSTEQAVQLLE roxellana)] KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPD SEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVDFQR KIRQSYFASVSYLDTQVGHLLSALDDLQLANSTIVAFTSDHG WALGEHGEWAKYSNFDVATHVPLMFYVPGRTASLPEAGEKLF PYLDPFDSASELMEPGRQSMDLVELVSLFPTLAGLAGLQVPP RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIA YSQYPRPADFPQWNSDKPSLKDIKIMGYSIRTIDYRYTVWVG FNPDEFLANFSDIHAGELYFVDSDPFQDHNMYNDSQGGDLFQ LLMP 44 UPI0005F40BD2 MPTPASGRGFLWLGLVLRSVCVALGSETQANSTTDALNILLI [Colobusangolensis IVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVC palliates(Peters' TPSHVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKEN Angolancolobus)] GYVTMSVGKVFHPGITSNHTDDSPYSWSFPPYHPSSEKYENT KTCRGPDGELHANLLCPVDVVDVPEGTLPDKQSTEQAIQLLE KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPD SEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVDFQR KIRQSYFASVSYLDTQVGHLLSALDDLQLANSTIVAFTSDHG WALGEHGEWAKYSNFDVATHVPLMFYVPGRTASLPEAGEKLF PYLDPFDSASELMEPGRQSMDLVELVSLFPTLAGLAGLQVPP RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIA YSQYPRPADFPQWNSDKPSLKDIKIMGYSIRTIDYRYTVWVG FNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLFQ LLMP 45 CB7.CI.hIDS.RBG gctgcgcgctcgctcgctcactgaggccgc ccgggcaaagcccgggcgtcgggcgacctt 60 (2)...(131) tggtcgcccggcctcagtgagcgagcgagc 5ITR gcgcagagagggagtggccaactccatcac 120 (199)...(580) taggggttccttgtagttaatgattaaccc CMVIEpromoter gccatgctacttatctaccagggtaatggg 180 (583)...(864) gatcctctagaactatagctagtcgacatt CBpromoter gattattgactagttattaatagtaatcaa 240 ttacggggtcattagttcatagcccatata tggagttccgcgttacataacttacggtaa 300 (837)...(840) atggcccgcctggctgaccgcccaacgacc TATA_signal cccgcccattgacgtcaataatgacgtatg 360 (959)...(1930) ttcccatagtaacgccaatagggactttcc chickenbeta-actin attgacgtcaatgggtggactatttacggt intron 420 aaactgcccacttggcagtacatcaagtgt atcatatgccaagtacgccccctattgacg 480 (1937)...(3589) tcaatgacggtaaatggcccgcctggcatt hIDS atgcccagtacatgaccttatgggactttc 540 ctacttggcagtacatctacgtattagtca tcgctattaccatggtcgaggtgagcccca 600 (3623)...(3749) cgttctgcttcactctccccatctcccccc rabbitglobinpolyA cctccccacccccaattttgtatttattta 660 (3838)...(3967) ttttttaattattttgtgcagcgatggggg 3ITR cggggggggggggggggcgcgcgccaggcg 720 ggggggggcggggcgaggggcggggcgggg cgaggcggagaggtgcggcggcagccaatc 780 agagcggcgcgctccgaaagtttcctttta tggcgaggcggcggcggcggcggccctata 840 aaaagcgaagcgcgcggcgggcggggagtc gctgcgacgctgccttcgccccgtgccccg 900 ctccgccgccgcctcgcgccgcccgccccg gctctgactgaccgcgttactcccacaggt 960 gagcgggcgggacggcccttctcctccggg ctgtaattagcgcttggtttaatgacggct 1020 tgtttcttttctgtggctgcgtgaaagcct tgaggggctccgggagggccctttgtgcgg 1080 ggggagcggctcggggggtgcgtgcgtgtg tgtgtgcgtggggagcgccgcgtgcggctc 1140 cgcgctgcccggcggctgtgagcgctgcgg gcgcggcgcggggctttgtgcgctccgcag 1200 tgtgcgcgaggggagcgcggccgggggcgg tgccccgcggtgcggggggggctgcgaggg 1260 gaacaaaggctgcgtgcggggtgtgtgcgt gggggggtgagcagggggtgtgggcgcgtc 1320 ggtcgggctgcaaccccccctgcacccccc tccccgagttgctgagcacggcccggcttc 1380 gggtgcggggctccgtacggggcgtggcgc ggggctcgccgtgccgggcggggggtggcg 1440 gcaggtgggggtgccgggcggggcggggcc gcctcgggccggggagggctcgggggaggg 1500 gcgcggcggcccccggagcgccggcggctg tcgaggcgcggcgagccgcagccattgcct 1560 tttatggtaatcgtgcgagagggcgcaggg acttcctttgtcccaaatctgtgcggagcc 1620 gaaatctgggaggcgccgccgcaccccctc tagcgggcgcggggcgaagcggtgcggcgc 1680 cggcaggaaggaaatgggcggggagggcct tcgtgcgtcgccgcgccgccgtccccttct 1740 ccctctccagcctcggggctgtccgcgggg ggacggctgccttcgggggggacggggcag 1800 ggcggggttcggcttctggcgtgtgaccgg cggctctagagcctctgctaaccatgttca 1860 tgccttcttctttttcctacagctcctggg caacgtgctggttattgtgctgtctcatca 1920 ttttggcaaagaattcatgccgccaccccg gaccggccgaggccttctctggctgggtct 1980 ggttctgagctccgtctgcgtcgccctcgg atccgaaacgcaggccaactcgaccacaga 2040 tgctctgaacgttcttctcatcatcgtgga tgacctgcgcccctccctgggctgttatgg 2100 ggataagctggtgaggtccccaaatattga ccaactggcatcccacagcctcctcttcca 2160 gaatgcctttgcgcagcaagcagtgtgcgc cccgagccgcgtttctttcctcactggcag 2220 gagacctgacaccacccgcctgtacgactt caactcctactggagggtgcacgctggaaa 2280 cttctccaccatcccccagtacttcaagga gaatggctatgtgaccatgtcggtgggaaa 2340 agtctttcaccctgggatatcttctaacca taccgatgattctccgtatagctggtcttt 2400 tccaccttatcatccttcctctgagaagta tgaaaacactaagacatgtcgagggccaga 2460 tggagaactccatgccaacctgctttgccc tgtggatgtgctggatgttcccgagggcac 2520 cttgcctgacaaacagagcactgagcaagc catacagttgttggaaaagatgaaaacgtc 2580 agccagtcctttcttcctggccgttgggta tcataagccacacatccccttcagataccc 2640 caaggaatttcagaagttgtatcccttgga gaacatcaccctggcccccgatcccgaggt 2700 ccctgatggcctaccccctgtggcctacaa cccctggatggacatcaggcaacgggaaga 2760 cgtccaagccttaaacatcagtgtgccgta tggtccaattcctgtggactttcagcggaa 2820 aatccgccagagctactttgcctctgtgtc atatttggatacacaggtcggccgcctctt 2880 gagtgctttggacgatcttcagctggccaa cagcaccatcattgcatttacctcggatca 2940 tgggtgggctctaggtgaacatggagaatg ggccaaatacagcaattttgatgttgctac 3000 ccatgttcccctgatattctatgttcctgg aaggacggcttcacttccggaggcaggcga 3060 gaagcttttcccttacctcgacccttttga ttccgcctcacagttgatggagccaggcag 3120 gcaatccatggaccttgtggaacttgtgtc tctttttcccacgctggctggacttgcagg 3180 actgcaggttccacctcgctgccccgttcc ttcatttcacgttgagctgtgcagagaagg 3240 caagaaccttctgaagcattttcgattccg tgacttggaagaggatccgtacctccctgg 3300 taatccccgtgaactgattgcctatagcca gtatccccggccttcagacatccctcagtg 3360 gaattctgacaagccgagtttaaaagatat aaagatcatgggctattccatacgcaccat 3420 agactataggtatactgtgtgggttggctt caatcctgatgaatttctagctaacttttc 3480 tgacatccatgcaggggaactgtattttgt ggattctgacccattgcaggatcacaatat 3540 gtataatgattcccaaggtggagatctttt ccagttgttgatgccttgactcgaggacgg 3600 ggtgaactacgcctgaggatccgatctttt tccctctgccaaaaattatggggacatcat 3660 gaagccccttgagcatctgacttctggcta ataaaggaaatttattttcattgcaatagt 3720 gtgttggaattttttgtgtctctcactcgg aagcaattcgttgatctgaatttcgaccac 3780 ccataatacccattaccctggtagataagt agcatggcgggttaatcattaactacaagg 3840 aacccctagtgatggagttggccactccct ctctgcgcgctcgctcgctcactgaggccg 3900 ggcgaccaaaggtcgcccgacgcccgggct ttgcccgggcggcctcagtgagcgagcgag 3960 cgcgcag 3967

6. EXAMPLES

6.1 Example 1: hIDS cDNA

(254) A hIDS cDNA-based vector is constructed comprising a transgene comprising hIDS (SEQ ID NO:1). The transgene also comprises nucleic acids comprising a signal peptide chosen from the group listed in Table 4. Optionally, the vector additionally comprises a promoter.

6.2 Example 2: Substituted hIDS cDNAs

(255) A hIDS cDNA-based vector is constructed comprising a transgene comprising hIDS having amino acid substitutions, deletions, or additions compared to the hIDS sequence of SEQ ID NO:1, e.g., including but not limited to amino acid substitutions selected from corresponding non-conserved residues in orthologs of IDS shown in FIG. 2, with the proviso that such mutations do not include replacement of the cysteine residue at position 84 (C84) which is required for enzyme activity (Millat et al., 1997, Biochem J 326: 243-247); or a mutation that has been identified in severe, severe-intermediate, intermediate, or attenuated MPS II phenotypes e.g., as shown in FIG. 3, or as reported by Sukegawa-Hayasaka et al., 2006, J Inhert Metab Dis 29: 755-761 (reporting attenuated mutants R48P, A85T, W337R, and the truncated mutant Q531X; and severe mutants P86L, S333L, S349I, R468Q, R468L); Millat et al., 1998, BBA 1406: 214-218 (reporting attenuated mutants P480L and P480Q; and severe mutant P86L); and Bonucelli et al., 2001, BBA 1537:233-238, each of which is incorporated by reference herein in its entirety. The transgene also comprises nucleic acids comprising a signal peptide chosen from the group listed in Table 4. Optionally, the vector additionally comprises a promoter.

6.3 Example 3: Treatment of MPS II in Animals Models with hIDS or Substituted hIDS

(256) An hIDS cDNA-based vector is deemed useful for treatment of MPS II when expressed as a transgene. An animal model for MPS II, for example a mouse model described in Garcia et al., 2007, J Inherit Metab Dis 30: 924-34 or Muenzer et al., 2001, Acta Paediatr Suppl 91:98-99 is administered a recombinant vector that encodes hIDS intrathecally at a dose sufficient to deliver and maintain a therapeutically effective concentration of the transgene product in the CSF of the animal. Following treatment, the animal is evaluated for improvement in symptoms consistent with the disease in the particular animal model.

6.4 Example 4: Treatment of MPS II with hIDS or Substituted hIDS

(257) An hIDS cDNA-based vector is deemed useful for treatment of MPS II when expressed as a transgene. A subject presenting with MPS II is administered a cDNA-based vector that encodes hIDS (e.g., such as Construct 1 (see below) intrathecally at a dose sufficient to deliver and maintain a therapeutic concentration of the transgene product in the CSF. Following treatment, the subject is evaluated for improvement in symptoms of MPS II.

6.5 Example 5: A Phase 1/1I Multicenter, Open-Label Study to Evaluate the Safety, Tolerability, and Pharmacodynamics of Construct 1 in Pediatric Subjects with MPS 11 (Hunter Syndrome)

(258) 6.5.1. Synopsis

(259) Investigational Product, Dose, and Route of Administration

(260) Construct 1: AAV9.CB7.hIDS (recombinant adeno-associated virus serotype 9 capsid containing human iduronate-2-sulfatase expression cassette). See FIG. 5.

(261) Product will be delivered as a single intracisternal (IC) dose.

(262) Three dose levels will be evaluated, 1.3?10.sup.10 genome copies (GC)/g brain mass (Dose 1), 6.5?10.sup.10 GC/g brain mass (Dose 2), 2.0?10.sup.10 GC/g brain mass (Dose 3), or 2.9?10.sup.11 GC/g brain mass (Dose 3 Expanded Cohort (EC)). The Dose 3 Cohort receives 2.0?10.sup.11 GC/g brain mass (the number of genome copies as determined by a Poly-A-specific PCR assay) or 2.9?10.sup.11 GC/g brain mass (the number of genome copies as determined by a transgene-specific PCR assay). Total dose administered will account for estimated brain size of study subjects based on their age. Total volume of product administered will not exceed 5 mL.

Objectives

(263) Primary Objective:

(264) To evaluate the safety and tolerability of Construct 1 through 24 weeks following a single IC dose administered to pediatric subjects who have severe MPS II

(265) Secondary Objectives:

(266) To evaluate the long-term safety and tolerability of Construct 1

(267) To evaluate the effect of Construct 1 on biomarkers in cerebrospinal fluid (CSF), plasma, and urine

(268) To evaluate the effect of Construct 1 on neurodevelopmental parameters of cognitive, behavioral, and adaptive function

(269) To evaluate vector shedding in CSF, plasma, and urine

(270) Exploratory Objectives: To evaluate immunogenicity of Construct 1 To explore the effect of Construct 1 on physical changes to the CNS To explore the effect of Construct 1 on systemic manifestations of disease To explore the effect of Construct 1 on auditory capacity To explore the effect of Construct 1 on biomarkers in plasma and urine in subjects who temporarily discontinue IV ERT (ELAPRASE?) To explore the effect of Construct 1 on quality of life (QOL) and sleep measures.

(271) Study Design and Methodology

(272) This is a Phase I/II, first-in-human, multicenter, open-label, single arm dose escalation study of Construct 1. No control group is included. Approximately 6 pediatric subjects who have severe MPS II could be enrolled into 2 dose cohorts, 1.3?10.sup.10 GC/g brain mass (Dose 1) or 6.5?10.sup.10 GC/g brain mass (Dose 2) and will receive a single dose of Construct 1 administered by IC injection. Safety will be the primary focus for the initial 24 weeks after treatment (primary study period). Following completion of the primary study period, subjects will continue to be assessed (safety and efficacy) for up to a total of 104 weeks following treatment with Construct 1. At the end of the study, subjects are invited to participate in a long-term follow-up study.

(273) The first 3 eligible subjects will be enrolled into the Dose 1 cohort (1.3?10.sup.10 GC/g brain mass). After Construct 1 administration to the first subject, there will be an 8-week observation period for safety. The Internal Safety Committee (ISC) will review the safety data obtained during the first 8 weeks (including data obtained during the Week 8 visit) for this subject, and if there are no safety concerns, the 2.sup.nd subject may be enrolled. The same process will be used to enroll the 3.sup.rd subject. If no safety review trigger (SRT) event is observed, all available safety data for the Dose 1 cohort obtained up to and including the Week 8 visit for the 3.sup.rd subject will be evaluated by the Independent Data Monitoring Committee (IDMC). If the decision is to proceed to the second dose (6.5?10.sup.10 GC/g brain mass), the subsequent 2 subjects will follow the same dosing scheme as the initial dose cohort with dosing of each subsequent subject occurring after all safety data obtained during the first 8 weeks (including data obtained during the Week 8 visit) for the last dosed subject have been reviewed. The ISC will review all subject safety data obtained up to and including the Week 2 visit of the 2.sup.nd subject and may determine that it is safe to proceed with dosing of the 3.sup.rd subject immediately after this assessment. All available safety data for the Dose 2 cohort will be evaluated by the IDMC after the Week 8 visit for the 3 subject in the Dose 2 cohort.

(274) Potential subjects will be screened up to 35 days prior to dosing to determine eligibility for the study. Those subjects who meet the eligibility criteria will be admitted to the hospital between Day ?2 and the morning of Day 1 (according to institutional practice), and baseline assessments will be performed pre-dose. Subjects will receive a single IC dose of Construct 1 on Day 1 and will remain in the hospital for approximately 30-36 hours after dosing for observation. Subsequent assessments in the primary study period (i.e., through Week 24) will be performed weekly through Week 4 and at Weeks 8, 12, 16, 20, and 24. After the primary study period, visits will be at Weeks 28, 32, 40, 48, 52, 56, 64, 78, and 104. The Week 12, 40, and 64 visits may be performed by a home health nurse. The Week 20 and 28 assessments will be limited to evaluation of AEs and concomitant therapies by telephone contact.

(275) All subjects will initially receive immune suppression (IS) in the study based on findings of potential immunogenicity in the nonclinical safety/toxicology study conducted in animals and will include corticosteroids (methylprednisolone 10 mg/kg intravenously [IV] once on Day 1 predose and oral prednisone starting at 0.5 mg/kg/day on Day 2 with gradual tapering and discontinuation by Week 12), tacrolimus (1 mg twice daily [BID] by mouth [PO] Day 2 to Week 24 with target blood level of 4-8 ng/mL and tapering over 8 weeks between Week 24 and 32) and sirolimus (a loading dose of 1 mg/m.sup.2 every 4 hours?3 doses on Day ?2 and then from Day ?1: sirolimus 0.5 mg/m.sup.2/day divided in BID dosing with target blood level of 4-8 ng/ml until Week 48). Neurologic assessments and tacrolimus/sirolimus blood level monitoring will be conducted. The doses of sirolimus and tacrolimus will be adjusted to maintain blood levels in the target range.

(276) No IS therapy is planned after Week 48. If IS is required after Week 48 to control a clinically-relevant immune response, the appropriate immunosuppressive regimen will be determined by the principal investigator (PI), in discussion with the Medical Monitor and Sponsor, as clinically indicated.

(277) Efficacy assessments will include neurocognitive function, auditory capacity, brain MRI, liver and spleen size, and measurements of levels of pharmacodynamic (PD) biomarkers in CSF, plasma, and urine. Neurocognitive or adaptive scales performed as part of subjects' standard of care while participating in the trial may also be collected, as determined by the study sponsor after discussing with the site.

(278) Endpoints

(279) Primary Endpoints: Safety through Week 24: AEs and serious adverse events (SAEs)

(280) Secondary Endpoints: Safety through Week 104: AE reporting, laboratory evaluations, vital signs, ECGs, physical examinations, and neurologic assessments Biomarkers in CSF (GAGs, I2S activity), plasma (GAGs, I2S activity), and urine (GAGs) Neurodevelopmental parameters of cognitive, behavioral, and adaptive function: Bayley Scales of Infant and Toddler Development, 3.sup.rd Edition (BSID-III) (Bayley, 2005, Scales of Infant and Toddler Development, 3rd Ed., Springer, New York, NY) or Kaufman Assessment Battery for Children, 2.sup.nd Edition (KABC-1I) (Kaufman, 2004, Kaufman Assessment Battery for Children, 2nd Ed.) Vineland Adaptive Behavior Scales, 2nd Edition, Comprehensive Interview Form (VABS-II)(Sparrow et al., 2005, Vineland Adaptive Behavior Scales, 2nd Ed.) Vector concentration in CSF, plasma, and urine by quantitative polymerase chain reaction (PCR) to Construct 1 deoxyribonucleic acid (DNA)

(281) Exploratory Endpoints: Immunogenicity measurements Neutralizing antibody titers to AAV9 and binding antibody titers to I2S in CSF and serum Enzyme-linked immunospot (ELISPOT) assay: T-cell response to AAV9 and I2S Flow cytometry: AAV- and I2S-specific regulatory T cells CNS structural abnormalities assessed by magnetic resonance imaging (MRI) of the brain Liver and spleen size assessed by MRI and ultrasound of the abdomen Auditory capacity changes measured by auditory brainstem response (ABR) testing Plasma and urinary GAGs in subjects who temporarily discontinue IV ERT (ELAPRASE?) PedsQL (Version 4) Global impression of sleep scale

(282) The total duration of the study may be 104 weeks post-dose with a primary safety evaluation time point of 24 weeks. Screening may take up to 35 days.

(283) Diagnosis and Criteria for Inclusion and Exclusion

(284) To be eligible to participate in this study, a subject must meet all the following inclusion criteria: 1. The subject's legal guardian(s) is(are) willing and able to provide written, signed informed consent after the nature of the study has been explained, and prior to any research-related procedures. 2. Is a male 3. Meets one of the following criteria: a. Has a documented diagnosis of MPS II AND is ?4 months to <5 years of age AND a has a neurocognitive testing score>55 and ?77 (BSID-III or KABC-II), OR b. Has a documented diagnosis of MPS II AND is ?4 months and <5 years of age AND has a decline of ?1 standard deviation on sequential neurocognitive testing (BSID-III or KABC-II) and a testing score>55, OR c. Has a relative diagnosed with severe MPS 11 who has the same IDS mutation as the subject AND in the opinion of a geneticist has inherited a severe form of MPS II 4. Has sufficient auditory and visual capacity, with or without aids, to complete the required protocol testing, and be compliant with wearing the aid, if applicable, on testing days

(285) Subjects who meet any of the following exclusion criteria will not be eligible to participate in the study: 1. Has a contraindication for an IC injection, including any of the following. a. Review of baseline MRI testing by the team of neuroradiologists/neurosurgeons participating in study (1 per site) shows a contraindication for an IC injection b. History of prior head/neck surgery, which resulted in a contraindication to IC injection, based on review of available information by the team of neuroradiologists/neurosurgeons participating in study c. Has any contraindication to computed tomography (CT), contrast agent, or to general anesthesia d. Has any contraindication to MRJ or gadolinium e. Has estimated glomerular filtration rate (eGFR)<30 mL/min/1.73 m.sup.2 2. Has any condition that would contraindicate treatment with prednisone, tacrolimus or sirolimus 3. Has any neurocognitive deficit not attributable to MPS II or diagnosis of a neuropsychiatric condition that may in the opinion of the PI confound interpretation of study results 4. Has any contraindication to lumbar puncture 5. Has a ventricular shunt 6. Has undergone hematopoietic stem cell transplantation (HSCT) 7. Has had prior treatment with an AAV-based gene therapy product 8. Has received idursulfase [ELAPRASE?] via intrathecal (IT) administration 9. Has received idursulfase [ELAPRASE?] IV and experienced a serious hypersensitivity reaction, including anaphylaxis, deemed related to IV idursulfase [ELAPRASE?] administration. 10. Has received any investigational product within 30 days of Day 1 or 5 half-lives before signing of the Informed Consent Form (ICF), whichever is longer 11. Has any history of lymphoma or history of another cancer, other than squamous cell or basal cell carcinoma of the skin, that has not been in full remission for at least 3 months before screening 12. Has a platelet count<100,000 per microliter (?L) 13. Has aminotransferase (ALT) or aspartate aminotransferase (AST)>3?ULN or total bilirubin>1.5?ULN at screening unless the subject has a previously known history of Gilbert's syndrome and a fractionated bilirubin that shows conjugated bilirubin<35% of total bilirubin 14. Uncontrolled hypertension (systolic blood pressure [BP]>180 mmHg, diastolic BP>100 mmHg) despite maximal medical treatment 15. Has a history of human immunodeficiency virus (HIV) or hepatitis B or hepatitis C virus infection, or positive screening tests for hepatitis B surface antigen or hepatitis B core antibody, or hepatitis C or HIV antibodies 16. Is a first-degree family member of a clinical site employee or any other individual involved with the conduct of the study or is a clinical site employee or other individual involved with the conduct of the study 17. Has a clinically significant ECG abnormality that, in the opinion of the PI, would compromise the subject's safety 18. Has a serious or unstable medical or psychological condition that, in the opinion of the PI, would compromise the subject's safety or successful participation in the study or interpretation of study results 19. Has uncontrolled seizures that in opinion of the PI would put the subject at undue risk
Exclusion criteria related to immunosuppressive therapy: 20. Has a history of a hypersensitivity reaction to tacrolimus, sirolimus, or prednisone 21. Has a history of a primary immunodeficiency (e.g., common variable immunodeficiency syndrome), splenectomy, or any underlying condition that predisposes the subject to infection 22. Has herpes zoster (VZV), cytomegalovirus (CMV), or Epstein-Barr virus (EBV) infection that has not completely resolved at least 12 weeks prior to screening 23. Has any infection requiring hospitalization or treatment with parenteral anti-infectives not resolved at least 8 weeks prior to Visit 2 24. Has any active infection requiring oral anti-infectives (including antivirals) within 10 days prior to Visit 2 25. Has a history of active tuberculosis (TB) or a positive Quantiferon-TB Gold test during screening 26. Has any live vaccine within 8 weeks prior to signing the ICF 27. Had major surgery within 8 weeks before signing the ICF or major surgery planned during the study period 28. Anticipate the need for adenoidectomy or tonsillectomy within 6 months of enrollment 29. Has an absolute neutrophil count<1.3?10.sup.3/?L 30. Has any condition or laboratory abnormality that the PI believes would not be appropriate for immunosuppressive therapy

(286) Statistical Methods

(287) All data will be presented in subject data listings. Categorical variables will be summarized using frequencies and percentages, and continuous variables will be summarized using descriptive statistics (n, mean, standard deviation, median, minimum, and maximum). Graphical displays will be presented as appropriate. Safety and PD endpoints will be reported by dose group and may also be reported for the 2 dose groups combined.

(288) Sample Size and Power Calculation: No formal calculation was performed to determine sample size.

(289) 6.5.2. Abbreviations and Terms

(290) TABLE-US-00024 TABLE 8 Abbreviations and Specialist Terms Abbreviation Term AAV Adeno-associated virus AAV9 AAV vector of serotype 9 AE(s) Adverse event(s) ALP Alkaline phosphatase ALT Alanine aminotransferase AST Aspartate aminotransferase BBB Blood-brain barrier BID Twice a day BP Blood pressure BSID Bayley Scales of Infant and Toddler Development BSL Biosafety level CB7 Hybrid C4 and CB (chicken beta actin promoter) CBC Complete blood count cDNA Consensus DNA CFR Code of Federal Regulations CI Confidence interval CMV Cytomegalovirus CNS Central nervous system CoA Certificate of analysis CRF Case Report Form CSF Cerebrospinal fluid CT Computed tomography CTA Clinical Trial Agreement CTCAE Common Terminology Criteria for Adverse Events CZ Crystal Zenith? DLT(s) Dose-limiting toxicity(ies) DNA Deoxyribonucleic acid DRG Dorsal root ganglia EBV Epstein-Barr virus ECG Electrocardiogram EDC Electronic Data Capture eGFR Estimated glomerular filtration rate ELISA Enzyme-Linked Immunosorbent Assay ELISPOT Enzyme-linked immunospot EOS End of Study ERT Enzyme replacement therapy ET Early Termination FDA US Food and Drug Administration GAG(s) Glycosaminoglycan(s) GAN Giant Axonal Neuropathy GO Genome copies GCP Good Clinical Practice GLP Good Laboratory Practice GM3 Monosialodihexosylganglioside HDL High-density lipoprotein Hep hepatitis Hex Hexosaminidase hIDS Human iduronate-2-sulfatase HIPAA Health Insurance Portability and Accounting Act HIV Human immunodeficiency virus HSCT Hematopoietic stem cell transplantation I2S Iduronate-2-sulfatase IB Investigators Brochure IC Intracisternal(ly) ICF Informed Consent Form ICH International Council for Harmonisation ICV Intracerebroventricular IDMC Independent Data Monitoring Committee IDS Iduronate-2-sulfatase gene IEC(s) Independent Ethics Committee(s) IgG Immunoglobulin G IND Investigation New Drug IP Investigational product IQ Intelligence quotient IRB Institutional Review Board IS immune suppression/immunosuppression TT Intrathecal(ly) ITR(s) Inverted terminal repeat(s) IV Intravenous(ly) KABC Kaufman Assessment Battery for Children KIDS Kinder Infant Development Scale KSPD Kyoto Scale of Psychological Development LDL Low-density lipoprotein LIMP2 Lysosomal membrane protein MED Minimum effective dose MedDRA Medical Dictionary of Regulatory Activities MMF Mycophenolate mofetil MPS I Mucopolysaccharidosis type I MPS II Mucopolysaccharidosis type II MPS III Sanfilippo syndrome MPS VII Mucopolysaccharidosis type VII MRI Magnetic resonance imaging MTD Maximum tolerated dose mTORC1 Mammalian/mechanistic target of rapamycin complex 1 N Number in sample NAB Neutralizing antibody NCI National Cancer Institute NHP(s) Non-buman primate(s) NIH National Institutes of Health NOAEL No-observable-adverse-effect level PBMC(s) Peripheral blood mononuclear cell(s) PCR Polymerase chain reaction PD Pharmacodynamic(s) PgP P-glycoprotein PI Principal Investigator PML Progressive multifocal leukoencephalopathy PO By mouth/orally PT Prothrombin time or Preferred Term PTT Partial thromboplastin time PVAN Polyoma virus-associated nephropathy QD Daily qPCR Quantitative polymerase chain reaction RBC Red blood cell RG1 Risk Group 1 Construct 1 Recombinant adeno-associated virus serotype 9 capsid containing human iduronate-2-sulfatase expression cassette SAE(s) Serious adverse event(s) SAP Statistical analysis plan SDV Source document verification SMA Spinal Muscular Atrophy SOC System Organ Class SRT Safety review trigger TB Tuberculosis TEAE(s) Treatment-emergent adverse event(s) Treg Regulatory T cell ULN Upper limit of normal U.S. United States US Ultrasound USMs Urgent safety measures VZV Varicella zoster virus WBC White blood cell (count) WHO World Health Organization

(291) 6.2.3. Investigational Plan

(292) Endpoints

(293) Primary Endpoints Safety through Week 24: AEs and SAEs

(294) Secondary Endpoints Safety through Week 104: AE reporting, laboratory evaluations, vital signs, electrocardiograms (ECGs), physical examinations, and neurologic assessments Biomarkers in CSF (GAGs, I2S activity), plasma (GAGs, I2S activity), and urine (GAGs) Neurodevelopmental parameters of cognitive, behavioral, and adaptive function: Bayley Scales of Infant and Toddler Development, 3rd Edition (BSID-III) (Bayley, 2005, Scales of Infant and Toddler Development, 3rd Ed.) or Kaufman Assessment Battery for Children, 2nd Edition (KABC-II) (Kaufman, 2004, Kaufman Assessment Battery for Children, 2nd Ed.) Vineland Adaptive Behavior Scales, 2nd Edition, Comprehensive Interview Form (VABS-II)(Sparrow et al., 2005, Vineland Adaptive Behavior Scales, 2nd Ed.) Vector concentration in CSF, plasma, and urine by quantitative polymerase chain reaction (PCR) to Construct 1 DNA

(295) Exploratory Endpoints Immunogenicity measurements Neutralizing antibody titers to AAV9 and binding antibody titers to I2S in CSF and serum Enzyme-linked immunospot (ELISPOT) assay: T-cell response to AAV9 and I2S Flow cytometry: AAV- and I2S-specific regulatory T cells CNS structural abnormalities assessed by MRI of the brain Liver and spleen size assessed by MRI of the abdomen Auditory capacity changes measured by auditory brainstem response (ABR) testing Plasma and urinary GAGss in subjects who temporarily discontinue IV ERT (ELAPRASE?) PedsQL (Version 4) Global impression of sleep scale

(296) Study Design

(297) This is a Phase I/II, first-in-human, multicenter, open-label, single arm dose escalation study of Construct 1. Approximately 6 pediatric subjects with severe MPS II could be enrolled into 2 dose cohorts, 1.3?10.sup.10 GC/g brain mass (Dose 1) or 6.5-10.sup.10 GC/g brain mass (Dose 2), and will receive a single dose of Construct 1 administered by IC injection. Safety will be the primary focus for the initial 24 weeks after treatment (primary study period). Following completion of the primary study period, subjects will continue to be assessed (safety and efficacy) for up to a total of 104 weeks following treatment with Construct 1. At the end of the study, all subjects will be invited to participate in a long-term follow-up study.

(298) Potential subjects will be screened up to 35 days prior to dosing to determine eligibility for the study. Those subjects who meet the eligibility criteria will be admitted to the hospital between Day ?2 and the morning of Day 1 (according to institutional practice), and baseline assessments will be performed pre-dose. Subjects will receive a single IC dose of Construct 1 on Day 1 and will remain in the hospital for approximately 30 to 36 hours after dosing for observation. Subsequent assessments in the primary study period (i.e., through Week 24) will be performed weekly through Week 4 and at Weeks 8, 12, 16, 20, and 24. After the primary study period, visits will be at Weeks 28, 32, 40, 48, 52, 56, 64, 78, and 104. The Week 12, 40, and 64 visits may be performed by a home health nurse. The Week 20 and 28 assessments will be limited to evaluation of AEs and concomitant therapies by telephone contact.

(299) All subjects will initially receive IS in the study based on findings in the nonclinical studies. IS therapy will include corticosteroids (methylprednisolone 10 mg/kg IV once on Day 1 predose and oral prednisone starting at 0.5 mg/kg/day on Day 2 with gradual tapering and discontinuation by Week 12), tacrolimus (1 mg twice daily [BID] by mouth [PO] Day 2 to Week 24 with target blood level of 4-8 ng/mL and tapering over 8 weeks between Week 24 and 32), and sirolimus (a loading dose of 1 mg/m.sup.2 every 4 hours?3 doses on Day ?2 and then from Day ?1: sirolimus 0.5 mg/m.sup.2/day divided in twice a day dosing with target blood level of 4-8 ng/ml until Week 48). Neurologic assessments and tacrolimus/sirolimus blood level monitoring will be conducted. The doses of sirolimus and tacrolimus will be adjusted to maintain blood levels in the target range.

(300) No IS therapy is planned after Week 48. If IS is required after Week 48 to control a clinically relevant immune response, the appropriate immunosuppressive regimen will be determined by the principal investigator (PI), in discussion with the Medical Monitor and Sponsor, as clinically indicated.

(301) The safety and tolerability of Construct 1 will be monitored through assessment of AEs and serious adverse events (SAEs), chemistry, hematology, urinalysis, markers of CSF inflammation, immunogenicity, vector shedding (vector concentration), vital signs, electrocardiograms (ECGs), and physical examinations including neurological assessments.

(302) Efficacy assessments will include neurocognitive and adaptive function, auditory capacity, brain MRI, liver and spleen size, measurements of levels of PD biomarkers in CSF, plasma, and urine.

(303) 6.5.4. Subject Population and Selection

(304) Selection of Study Population

(305) Approximately 6 pediatric subjects ages?4 months to <5 years who have documented neurocognitive deficits due to MPS II or who have a genotype and family history consistent with an inherited form of severe MPS II will be treated with investigational product (IP).

(306) Inclusion Criteria

(307) To be eligible to participate in this study, a subject must meet all the following criteria: 1. The subject's legal guardian is (are) willing and able to provide written, signed informed consent after the nature of the study has been explained, and prior to any research-related procedures. 2. Is a male 3. Meets one of the following criteria: a. Has a documented diagnosis of MPS II AND is ?4 months to <5 years of age AND a has a neurocognitive testing score>55 and ?77 (BSID-III or KABC-II), OR b. Has a documented diagnosis of MPS II AND is ?4 months and <5 years of age AND has a decline of ?1 standard deviation on sequential neurocognitive testing (BSID-III or KABC-II) and a testing score>55, OR c. Has relative diagnosed with severe MPS II carrying the same/DS mutation as the subject AND in the opinion of a geneticist has inherited a severe form of MPS II 4. Has sufficient auditory and visual capacity, with or without aids, to complete the required protocol testing, and be compliant with wearing the aid, if applicable, on testing days.

(308) Exclusion Criteria

(309) A subject who meets any of the following exclusion criteria will not be eligible to participate in the study: 1. Has a contraindication for an IC injection, including any of the following: a. Review of baseline MRI testing by the team of neuroradiologists/neurosurgeons participating in study (1 per site) shows a contraindication for an IC injection b. History of prior head/neck surgery, which resulted in a contraindication to IC injection, based on review of available information by the team of neuroradiologists/neurosurgeons participating in study c. Has any contraindication to computed tomography (CT), contrast agent or general anesthesia d. Has any contraindication to MRI or gadolinium e. Has estimated glomerular filtration rate (eGFR)<30 mL/min/1.73 m.sup.2 2. Has any condition that would contraindicate treatment with prednisone, tacrolimus, or sirolimus. 3. Has any neurocognitive deficit not attributable to MPS II or diagnosis of a neuropsychiatric condition that may in the opinion of the PI confound interpretation of study results. 4. Has any contraindication to lumbar puncture 5. Has a ventricular shunt 6. Has undergone hematopoietic stem cell transplantation (HSCT). 7. Has had prior treatment with an AAV-based gene therapy product. 8. Has received idursulfase via intrathecal (IT) administration 9. Has received IV idursulfase [ELAPRASE?] and experienced a serious hypersensitivity reaction, including anaphylaxis, deemed related to IV idursulfase [ELAPRASE?] administration. 10. Has received any investigational product within 30 days of Day 1 or 5 half-lives before signing of the Informed Consent Form (ICF), whichever is longer 11. Has any history of lymphoma or history of another cancer, other than squamous cell or basal cell carcinoma of the skin, that has not been in full remission for at least 3 months before screening. 12. Platelet count<100,000 per microliter (?L) 13. Has aminotransferase (ALT) or aspartate aminotransferase (AST)>3?ULN or total bilirubin>1.5?/ULN at screening unless the subject has a previously known history of Gilbert's syndrome and a fractionated bilirubin that shows conjugated bilirubin<35% of total bilirubin. 14. Uncontrolled hypertension (systolic blood pressure [BP]>180 mmHg, diastolic BP>100 mmHg) despite maximal medical treatment. 15. Has a history of human immunodeficiency virus (HIV) or hepatitis B or hepatitis C virus infection, or positive screening tests for hepatitis B surface antigen or hepatitis B core antibody, or hepatitis C or HIV antibodies. 16. Is a first-degree family member of a clinical site employee or any other individual involved with the conduct of the study or is a clinical site employee or other individual involved with the conduct of the study. 17. Has a clinically significant ECG abnormality that, in the opinion of the PI, would compromise the subject's safety. 18. Has a serious or unstable medical or psychological condition that, in the opinion of the PI, would compromise the subject's safety or successful participation in the study or interpretation of study results. 19. Has uncontrolled seizures that in opinion of the PI would put the subject at undue risk.
Exclusion Criteria Related to Immunosuppressive Therapy: 20. A history of a hypersensitivity reaction to tacrolimus, sirolimus, or prednisone 21. A history of a primary immunodeficiency (e.g., common variable immunodeficiency syndrome), splenectomy, or any underlying condition that predisposes the subject to infection 22. Herpes zoster (VZV), cytomegalovirus (CMV), or Epstein-Barr virus (EBV) infection that has not completely resolved at least 12 weeks prior to screening 23. Any infection requiring hospitalization or treatment with parenteral anti-infectives not resolved at least 8 weeks prior to Visit 2 24. Any active infection requiring oral anti-infectives (including antivirals) within 10 days prior to Visit 2 25. History of active tuberculosis (TB) or a positive Quantiferon-TB Gold test during screening 26. Any live vaccine within 8 weeks prior to signing the ICF 27. Major surgery within 8 weeks before signing the ICF or major surgery planned during the study period 28. Anticipate the need for adenoidectomy or tonsillectomy within 6 months of enrollment 29. Absolute neutrophil count<1.3?10.sup.3/?L 30. Any condition or laboratory abnormality that the PI believes would not be appropriate for immunosuppressive therapy

(310) 6.5.5. Treatments

(311) Treatments Administered

(312) The investigational product (IP), Construct 1 (see FIG. 5), will be given as a single dose IC administration. Two dose levels: 1.3?10.sup.10 GC/g brain mass (Dose 1) or 6.5?10.sup.10 GC/g brain mass (Dose 2). Total dose administered (total GC) will be adjusted to account for differences in brain size by age. Total volume of product administered will not exceed 5 mL.

(313) No reference therapy will be administered during this study. IS therapy will be given in addition to IP, as described below.

(314) Investigational Product

(315) Construct 1 is a non-replicating recombinant AAV of serotype 9 capsid containing an hIDS expression cassette.

(316) TABLE-US-00025 Product Construct 1 Gene hIDS Control CB7 promoter, chicken beta actin intron, rabbit beta- Elements: globin polyadenylation signal AAV 9 AAV = adeno-associated virus; CB = chicken beta-actin; hIDS = human iduronate-2-sulfatase

(317) Construct 1 is a non-replicating recombinant AAV9 vector that allows for efficient expression of the human iduronate-2-sulfatase (hIDS) product in the central nervous system (CNS) following intrathecal (IT) administration. The vector genome contains an hIDS expression cassette flanked by AAV2 inverted terminal repeats (ITRs). Expression from the cassette is driven by a CB7 promoter, a hybrid between a cytomegalovirus (CMV) immediate-early enhancer and the chicken ?-actin promoter. Transcription from this promoter is enhanced by the presence of the chicken ?-actin intron (CI). The polyadenylation signal for the expression cassette is from the rabbit ?-globin (RBG) gene. A schematic representation of Construct 1 is illustrated in FIG. 5.

(318) The final IP is supplied as a frozen solution of the AAV vector active ingredient (AAV9.CB7.hIDS) in modified Elliott's B? solution with 0.001% Pluronic? F68, filled into 2-mL in CRYSTAL ZENITH? (CZ) vials, and sealed with a latex-free rubber stopper and aluminum flip-off seal. In some embodiments, the AAV vector active ingredient (AAV9.CB7.hIDS) is supplied in a solution containing 8.77 g/L sodium chloride, 0.244 g/L magnesium chloride, 0.0278 g/L sodium phosphate monobasic monohydrate, 0.114 g/L sodium phosphate dibasic anhydrous, 0.224 g/L potassium chloride, 0.206 g/L calcium chloride, 0.793 g/L dextrose, 0.001% poloxamer 188, pH 7.26. Vials should be stored at ??60? C. The concentration (in GC/mL) of each IP lot will be reported in the Certificate of Analysis (CoA). Detailed dosing instructions, based on the product concentration, will be provided in the Administration Manual.

(319) Immunosuppressive Therapy

(320) Corticosteroids In the morning of vector administration (Day 1 predose), subjects will receive methylprednisolone 10 mg/kg IV (maximum of 500 mg) over at least 30 minutes. The methylprednisolone should be administered before the lumbar puncture and IC injection of IP. Premedication with acetaminophen and an antihistamine is optional and at the discretion of the investigator. On Day 2, oral prednisone will be started with the goal to discontinue prednisone by Week 12. The dose of prednisone will be as follows: Day 2 to the end of Week 2: 0.5 mg/kg/day Week 3 and 4: 0.35 mg/kg/day Week 5-8: 0.2 mg/kg/day Week 9-12: 0.1 mg/kg Prednisone will be discontinued after Week 12. The exact dose of prednisone can be adjusted to the next higher clinically practical dose.

(321) Sirolimus 2 days prior to vector administration (Day ?2): a loading dose of sirolimus 1 mg/m.sup.2 every 4 hours?3 doses will be administered From Day ?1: sirolimus 0.5 mg/m.sup.2/day divided in twice a day dosing with target blood level of 4-8 ng/ml Sirolimus will be discontinued after the Week 48 visit.

(322) Tacrolimus Tacrolimus will be started on Day 2 (the day following IP administration) at a dose of 1 mg twice daily and adjusted to achieve a blood level 4-8 ng/mL for 24 Weeks. Starting at Week 24 visit, tacrolimus will be tapered off over 8 weeks. At Week 24 the dose will be decreased by approximately 50%. At Week 28 the dose will be further decreased by approximately 50%. Tacrolimus will be discontinued at Week 32. Tacrolimus and sirolimus blood level monitoring will be conducted. Dosing adjustments are discussed in the disclosure.

(323) Method of Assigning Subjects to Treatment

(324) Eligible subjects will be enrolled and assigned sequentially to a dose cohort with the initial 3 subjects assigned to get 1.3?10.sup.10 GC/g brain mass; the subsequent 3 subjects will be assigned to get 6.5?10.sup.10 GC/g brain mass pending review of safety data by the IDMC.

(325) Dosing Considerations

(326) Investigational Product

(327) A description of the plan to sequentially dose subjects, including review of safety data between individual subjects and after each cohort has been dosed at any dose level is disclosed in the disclosure (e.g., [00237] to [00265]; [00175] to [00186]).

(328) Immunosuppressive Therapy

(329) Prednisone dosing will start at 0.5 mg/kg/day and will be gradually tapered off by the Week 12 visit.

(330) Tacrolimus dose adjustments will be made to maintain whole blood trough concentrations within 4 to 8 ng/mL for the first 24 Weeks. At Week 24 the dose will be decreased by approximately 50%. At Week 28 the dose will be further decreased by approximately 50%. Tacrolimus will be discontinued at Week 32. Sirolimus dose adjustments will be made to maintain whole blood trough concentrations within 4 to 8 ng/mL. In most subjects, dose adjustments can be based on the equation: new dose=current dose?(target concentration/current concentration). Subjects should continue on the new maintenance dose for at least 7 to 14 days before further dosage adjustment with concentration monitoring.

(331) The following medications and procedures are prohibited: No IT ERT is allowed within 6 months of screening. Any investigational product within the 30 days or 5 half-lives, whichever is longer, prior to signing the ICF or at any time during the study (through Week 104) Live vaccines should be avoided while on sirolimus and/or tacrolimus Strong inhibitors of CYP3A4 and/or P-glycoprotein (PgP) (such as ketoconazole, voriconazole, itraconazole, posaconazole, erythromycin, telithromycin or clarithromycin) or strong inducers of CYP3A4 and or Pgp (such as rifampin or rifabutin) should be avoided while on sirolimus and/or tacrolimus Grapefruit juice inhibits CYP3A-enzymes resulting in increased tacrolimus and sirolimus whole blood trough concentrations. Subjects should avoid eating grapefruit or drinking grapefruit juice with tacrolimus and/or sirolimus.

(332) Permitted Medications and Procedures

(333) Subjects will be permitted to remain on a stable regimen of IV ERT as well as any supportive measures (e.g., physical therapy). According to local hospital standard of care, subjects will be permitted to receive medication to prevent claustrophobia during MRI and receive general anesthesia for lumbar puncture, MRI, and neuroconduction studies (ABRs or sensory evoked potentials).

(334) Medications other than that described above, which are considered necessary for the subject's safety and wellbeing (e.g., for hypertension), may be given at the discretion of the Investigator in accordance with local standard of care and recorded in the appropriate sections of the CRF.

6.6 Example 6: A Phase I/II Multicenter, Open-Label Study to Evaluate the Safety, Tolerability, and Pharmacodynamics of Construct 1 in Pediatric Subjects with MPS II (Hunter Syndrome)

(335) As described above, Construct 1 is AAV9.CB7.hIDS (recombinant adeno-associated virus serotype 9 capsid containing human iduronate-2-sulfatase expression cassette). See FIG. 5, and Example 5.

(336) Construct 1 will be delivered as a single intracisternal (IC) or intracerebroventricular (ICV) dose.

(337) Two dose levels will be evaluated, 1.3?10.sup.10 genome copies (GC)/g brain mass (Dose 1) and 6.5?10.sup.10 GC/g brain mass (Dose 2). Total dose administered will account for estimated brain mass of study subjects based on their screening magnetic resonance imaging (MRI). The total volume of product administered will not exceed 10% of the total CSF volume (estimated to be ?50 mL in infant brain and ?150 mL in adult brain).

(338) 6.6.1. Objectives:

(339) Primary Objective To evaluate the safety and tolerability of Construct 1 through 24 weeks following a single IC, or ICV if IC is contraindicated, dose administered to pediatric subjects who have severe MPS II

(340) Secondary Objectives: To evaluate the long-term safety and tolerability of Construct 1 To evaluate the effect of Construct 1 on biomarkers in cerebrospinal fluid (CSF), plasma, and urine To evaluate the effect of Construct 1 on neurodevelopmental parameters of cognitive, behavioral, and adaptive function To evaluate vector shedding in CSF, serum, and urine

(341) Exploratory Objectives: To evaluate immunogenicity of Construct 1 To explore the effect of Construct 1 on CNS imaging To explore the effect of Construct 1 on systemic manifestations of disease To explore the effect of Construct 1 on auditory capacity To explore the effect of Construct 1 on biomarkers in plasma and urine in subjects who temporarily discontinue intravenous (IV) ERT (ELAPRASE?) To explore the effect of Construct 1 on quality of life (QOL) To explore the effect of Construct 1 on sleep measures To explore the effect of Construct 1 on clinician reported outcome To explore the effect of Construct Ion caregiver reported outcome

(342) 6.6.2. Study Design and Methodology

(343) This is a Phase I/II, first-in-human, multicenter, open-label, single arm dose escalation study of Construct 1. No control group is included. Approximately 6 pediatric subjects who have severe MPS II could be enrolled into 2 dose cohorts, 1.3?10.sup.10 GC/g brain mass (Dose 1) or 6.5?10.sup.10 GC/g brain mass (Dose 2) and will receive a single dose of Construct 1 administered by IC or ICV injection. Safety will be the primary focus for the initial 24 weeks after treatment (primary study period). Following completion of the primary study period, subjects will continue to be assessed (safety and efficacy) for up to a total of 104 weeks following treatment with Construct 1. At the end of the study, subjects will be invited to participate in a long-term follow-up study.

(344) The first 3 eligible subjects will be enrolled into the Dose 1 cohort (1.3?10.sup.10 GC/g brain mass). After Construct 1 administration to the first subject, there will be an 8-week observation period for safety. The Internal Safety Committee (ISC) will review the safety data obtained during the first 8 weeks of the study according to the ISC Charter (including data obtained during the Week 8 visit) for this subject, and if there are no safety concerns, the 2nd subject may be enrolled. The same process will be used to enroll the 3rd subject. Informed consent and screening activities for the next subject may proceed during the observation period for the preceding subject.

(345) If no safety review trigger (SRT) event is observed, all available safety data for the Dose 1 cohort obtained up to and including the Week 8 visit for the 3rd subject will be evaluated by the Independent Data Monitoring Committee (IDMC). If the decision is to proceed to the second dose cohort (6.5?10.sup.10 GC/g brain mass), the subsequent 2 subjects will follow the same dosing scheme as the initial dose cohort. The ISC will review all subject safety data obtained up to and including the Week 2 visit of the 2nd subject in the Dose 2 cohort and may determine that it is safe to proceed with dosing of the 3rd subject immediately after this assessment. All available safety data for the Dose 2 cohort will be evaluated by the IDMC after the Week 8 visit for the 3rd subject in the Dose 2 cohort. With approval of the IDMC, additional subjects may be dosed in a Dose 2 Expanded Cohort as long as study drug is available, and there is Sponsor approval and no safety event that warrants suspension of enrollment as per either the ISC or the IDMC. Each subject in the Expanded Cohort will be dosed in a staggered fashion at intervals of at least 2 weeks.

(346) At any given IDMC meeting, whether planned at the conclusion of a dose cohort or called for by an SRT, the IDMC may recommend stopping the trial, dose additional subjects at the current dose, proceed to the next dose cohort, or proceed at a lower dose. Once 8 weeks of data are available from the last Dose 2 cohort subject, and if none of the Dose 2 cohort subjects had an SRT event, then enrollment in the study will be considered completed: enrollment into the Expanded Cohort may continue as stipulated above. Once the last subject enrolled in the Expanded Cohort completes the Week 2 visit, all safety data for the Expanded Cohort including data from the last subject's Week 2 visit will be evaluated by the IDMC.

(347) If any event meets the criteria of a Stopping Rule, dosing of any new subjects will be suspended until a complete review of all safety data by REGENXBIO and the external IDMC has been performed.

(348) Potential subjects will be screened up to 35 days prior to dosing to determine eligibility for the study; screening assessments performed after signing the Informed Consent Form (ICF) but outside of this window may be acceptable as determined by the principal investigator and approved by the Medical Monitor. Assessments performed outside the screening window will be repeated as deemed necessary by the Medical Monitor. Subjects may be rescreened for the study one time if initially failing to enroll; Sponsor approval to rescreen the subject will be required. Rescreening can occur after at least 3 months have elapsed from the time of the subject's initial screen failure.

(349) Those subjects who meet the eligibility criteria will be admitted to the hospital between Day ?2 and the morning of Day 1 (according to institutional practice), and baseline assessments will be performed pre-dose. Subjects will receive a single IC or ICV dose of Construct 1 on Day 1 and will remain in the hospital overnight and for approximately 1-2 days after dosing for observation. Subjects will be discharged after the principal investigator concludes that prolongation of hospitalization beyond two overnight stays is not necessary. Subsequent assessments in the primary study period (i.e., through Week 24) will be performed weekly through Week 4 and at Weeks 8, 12, 16, 20, and 24. After the primary study period, visits will be at Weeks 28, 32, 40, 48, 52, 56, 60, 64, 78, and 104. The Week 64 visit will be performed only for subjects who discontinue IV ERT. The Week 20 and 28 assessments will be limited to evaluation of adverse events (AEs) and concomitant therapies by telephone contact.

(350) All subjects will initially receive immune suppression (IS) in the study to minimize the risk of any immune mediated reaction against tissues expressing the transgene as well as minimize any risk associated with the formation or increase of antibodies to IDS which may decrease efficacy. The IS regimen will include corticosteroids (methylprednisolone 10 mg/kg IV once on Day 1 predose and oral prednisone starting at 0.5 mg/kg/day on Day 2 with gradual tapering and discontinuation by Week 12), tacrolimus (0.05 mg/kg twice daily [BID] by mouth [PO] Day 2 to Week 24 with dose adjustments made to obtain a target blood level of 2-4 ng/ml and tapering over 8 weeks between Week 24 and 32) and sirolimus (a loading dose of 1 mg/m.sup.2 every 4 hours?3 doses on Day ?2 and then from Day ?1: sirolimus 0.5 mg/m.sup.2/day divided in BID dosing with target blood level of 1-3 ng/ml until Week 48). Neurologic assessments and tacrolimus/sirolimus blood level monitoring will be conducted. The doses of sirolimus and tacrolimus will be adjusted to maintain blood levels in the target range.

(351) No IS therapy is planned after Week 48. If IS were required after Week 48 to control a clinically-relevant immune response, the appropriate immunosuppressive regimen will be determined by the principal investigator (PI), in discussion with the Medical Monitor and Sponsor, as clinically indicated.

(352) Given the histopathological findings in the dorsal root ganglia and associated axonopathy observed in the nonclinical safety/toxicology studies and the potential safety risks with the IC administration procedure, close neurological monitoring, including focused neurological assessments and somatosensory evoked potential (SSEP) testing will be employed.

(353) Since animal data suggest that there may be systemic benefits of IC and ICV Construct 1 administration, subjects who are on IV idursulfase (ELAPRASE?) may be offered the option to discontinue ERT after the Week 52 visit. The decision to discontinue ERT will be at the clinical judgement of the PI and as agreed with the study sponsor. Additional information that may be useful for the decision to stop ERT are trough measurements (based on ERT dosing) of plasma I2S and plasma and urine GAGs up to the Week 52 visit, and measurement of the liver and spleen size by ultrasound. The Week 52, 56, 60, 64 and 78 visits will include additional monitoring of the subject's plasma I2S and plasma and urine GAGs levels in subjects who elect to discontinue ERT. Subjects who discontinue IV ERT will have an additional abdominal ultrasound at Week 64 to perform measurement of the liver and spleen size. IV ERT will be restarted if any of following criteria are met: increase in urinary GAGs levels 2 times above the level measured at the Week 52 visit, or an increase of liver diameter>20% above the Week 52 value, or any change in other safety parameters deemed by the internal safety committee and/or the IDMC to warrant a restart of IV ERT. However, subjects may restart ERT at any time, if deemed necessary by the PI.

(354) The safety and tolerability of Construct 1 will be monitored through assessment of AEs and serious adverse events (SAEs), chemistry, hematology, urinalysis, markers of CSF inflammation, immunogenicity, vector shedding (vector concentration), vital signs, electrocardiograms (ECGs), SSEP testing, and physical examinations including neurological assessments. Serial PCR (polymerase chain reaction) for detection of circulating viral genomes (EBV and CMV) will also be performed while subjects are receiving IS.

(355) Efficacy assessments will include measurements of levels of pharmacodynamic (PD) biomarkers (GAGs and I2S in CSF and plasma, leukocyte I2S enzyme activity, and GAGs in urine), as well as on neurocognitive function, auditory capacity, brain MRI, liver and spleen size, and cardiac evaluation by echocardiogram. Neurocognitive or adaptive assessments performed as part of subjects' standard of care while participating in the trial may also be collected, as determined by the study sponsor after discussing with the site.

(356) 6.6.3. Endpoints

(357) Primary Endpoints: Safety through Week 24: AEs and SAEs

(358) Secondary Endpoints: Safety through Week 104: AE reporting, laboratory evaluations, vital signs, ECGs, physical examinations, and neurologic assessments Biomarkers in CSF (GAGs, I2S), plasma (GAGs, I2S), and urine (GAGs) Neurodevelopmental parameters of cognitive, behavioral, and adaptive function: Bayley Scales of Infant and Toddler Development, 3rd Edition (BSID-III) (Bayley, 2005, Scales of Infant and Toddler Development, 3rd Ed.) or Kaufman Assessment Battery for Children, 2nd Edition (KABC-II) (Kaufman, 2004, Kaufman Assessment Battery for Children, 2nd Ed.) Vineland Adaptive Behavior Scales, 2nd Edition, Expanded Interview Form (VABS-II) (Sparrow et al., 2005, Vineland Adaptive Behavior Scales, 2nd Ed.) Vector concentration in CSF, serum, and urine by quantitative polymerase chain reaction (PCR) to Construct 1 deoxyribonucleic acid (DNA)

(359) Exploratory Endpoints: Immunogenicity Measurements Neutralizing antibody titers to AAV9 and binding antibody titers to I2S in CSF and serum Enzyme-linked immunospot (ELISPOT) assay: T-cell response to AAV9 and I2S Flow cytometry: AAV- and I2S-specific regulatory T cells CNS structural abnormalities assessed by MRI of the brain Liver and spleen size assessed by ultrasound of the abdomen Cardiac evaluation by echocardiogram for valvular disease and left ventricular mass index Auditory capacity changes measured by auditory brainstem response (ABR) testing or behavioral audiometry and otoacoustic emissions testing Plasma and urinary GAGs in subjects who temporarily discontinue IV ERT (ELAPRASE@) PedsQL Sleep assessment (Ferreira et al., 2009, Sleep Medicine; 10(4):457-463) Clinical Assessment of Disease Caregiver Assessment of Disease Activities of Daily Living (Tanjuakio et al. 2015, Mol Genet Metab, 114(2):161-169; Kato et al., 2007, Brain Dev, 29(5): 298-305) Burden of Illness

(360) 6.6.4. Number of Subjects Planned and Study Duration

(361) Up to 12 subjects will be enrolled. 3 subjects in Dose 1 cohort 3 subjects in Dose 2 cohort Up to 6 subjects in Dose 2 Expanded Cohort The IDMC may recommend adding additional subjects.

(362) The total duration of the study will be 104 weeks post-dose with a primary safety evaluation time point of 24 weeks. Screening may take up to 35 days.

(363) 6.6.5. Diagnosis and Criteria for Inclusion and Exclusion:

(364) The following information about the affected relative will be collected, if available, after relative informed consent has been obtained: Demographics (age, sex) Medical and surgical histories (e.g., cardiac disease, carpal tunnel syndrome, hip dysplasia or subluxation, etc.) Age at diagnosis of severe MPS II and how diagnosis was made Genotyping results Results of neurodevelopmental testing, including cognition, speech and language, fine motor and gross motor (if available and diagnosis of severe MPS II was done through neurodevelopmental testing) Results of brain MRI Treatment for MPS II, including ERT or HSCT Current concomitant medications

(365) Subjects may be rescreened for the study one time if initially failing to enroll; Sponsor approval to rescreen the subject will be required. Rescreening can occur after at least 3 months have elapsed from the time of the subject's initial screen failure. Participants who are rescreened are required to sign a new ICF. All screening procedures will be repeated, with the exception of MRI, for which retesting will be decided by the neuroradiologist/neurosurgeon.

(366) To be eligible to participate in this study, a subject must meet all the following inclusion criteria: 1. The subject's legal guardian(s) is (are) willing and able to provide written, signed informed consent after the nature of the study has been explained, and prior to any research-related procedures. 2. Is a male?4 months to <5 years of age 3. Meets any of the following criteria: a. Has a documented diagnosis of MPS II AND has a neurocognitive testing score?77 (BSID-III or KABC-II), OR b. Has a documented diagnosis of MPS II AND has a decline of ?1 standard deviation on serial neurocognitive testing administered between 3 to 36 months apart (BSID-III or KABC-II), OR c. Has a relative clinically diagnosed with severe MPS II who has the same IDS mutation as the subject AND the subject in the opinion of a geneticist has inherited a severe form of MPS II, OR d. Has documented mutation(s) in IDS that in the opinion of a geneticist is always known to result in a neuronopathic phenotype [e.g., a complete deletion or large deletion (e.g., spanning?1 exon), or recombination] AND in the opinion of a clinician has a severe form of MPS II 4. Has sufficient auditory and visual capacity, with or without aids, to complete the required protocol testing, and be compliant with wearing the aid, if applicable, on testing days

(367) Subjects who meet any of the following exclusion criteria will not be eligible to participate in the study: 1. Has a contraindication for an IC or ICV injection, including any of the following: a. Review of baseline MRI testing by the team of neuroradiologists/neurosurgeons participating in study (1 neuroradiologist or neurosurgeon per site) shows a contraindication for an IC or an ICV injection b. History of prior head/neck surgery, which resulted in a contraindication to both IC and ICV injection, based on review of available information by the team of neuroradiologists/neurosurgeons participating in study c. Has any contraindication to computed tomography, contrast agent, or to general anesthesia d. Has any contraindication to MRI or gadolinium e. Has renal insufficiency as determined by an estimated glomerular filtration rate (eGFR)<30 mL/min/1.73 m.sup.2, based on creatinine. If laboratory determines that creatinine is less than the lower limit of assay validation or detection then the lowest limit cutoff value will be used to estimate eGFR f. Has previously experienced a clinically significant intracranial bleed that, in the opinion of the investigator and team of neuroradiologists/neurosurgeons, is a contraindication to IC and ICV injection 2. Has any condition that would contraindicate treatment with prednisone, tacrolimus or sirolimus 3. Has any neurocognitive deficit not attributable to MPS II or diagnosis of a neuropsychiatric condition that may in the opinion of the PI confound interpretation of study results 4. Has any contraindication to lumbar puncture 5. Has a (cerebral) ventricular shunt that in the opinion of the site neuroradiologist/neurosurgeon and through discussion with the Medical Monitor, may impact the administration and proper dosing of the subject 6. Has undergone HSCT 7. Has had prior treatment with an AAV-based gene therapy product a 8. Has received idursulfase (ELAPRASE?) via intrathecal (IT) administration within 4 months of signing the ICF 9. Has received idursulfase (ELAPRASE?) IV and experienced a serious hypersensitivity reaction, including anaphylaxis, deemed related to IV idursulfase (ELAPRASE?) administration. If currently receiving IV idursulfase and has had dose interruptions or a dose regimen different than weekly, then discussion with REGENXBIO Medical Monitor is needed. 10. Has received any investigational product within 30 days of Day 1 or 5 half-lives before signing of the ICF, whichever is longer 11. Has any history of lymphoma or history of another cancer, other than squamous cell or basal cell carcinoma of the skin, that has not been in full remission for at least 1 year before screening 12. Has a platelet count<100,000 per microliter (?L) 13. Has aminotransferase (ALT) or aspartate aminotransferase (AST)>3?ULN or total bilirubin>1.5?ULN at screening unless the subject has a previously known history of Gilbert's syndrome 14. Uncontrolled hypertension despite medical treatment, defined for children?17 years of age to be systolic blood pressure or diastolic blood pressure>99th percentile plus 5 mmHg based on normative standards for age, sex, and height 15. Has a history of human immunodeficiency virus (HIV) or hepatitis B or hepatitis C virus infection, or positive screening tests for hepatitis B surface antigen or hepatitis B core antibody, or hepatitis C or HIV antibodies 16. Is a first-degree family member of a clinical site employee or any other individual involved with the conduct of the study or is a clinical site employee or other individual involved with the conduct of the study 17. Has a clinically significant ECG abnormality that, in the opinion of the PI, would compromise the subject's safety 18. Has a serious or unstable medical or psychological condition that, in the opinion of the PI, would compromise the subject's safety or successful participation in the study or interpretation of study results 19. Has uncontrolled seizures that in opinion of the PI would put the subject at undue risk

(368) Exclusion Criteria Related to Immunosuppressive Therapy: 20. Has a history of a hypersensitivity reaction to tacrolimus, sirolimus, or prednisone 21. Has a history of a primary immunodeficiency (e.g., common variable immunodeficiency syndrome), splenectomy, or any underlying condition that predisposes the subject to infection 22. Has herpes zoster (VZV), cytomegalovirus (CMV), or Epstein Barr virus (EBV) infection that has not completely resolved at least 12 weeks prior to screening 23. Has any infection requiring hospitalization or treatment with parenteral anti-infectives not resolved at least 8 weeks prior to Visit 2 24. Has any active infection requiring oral anti-infectives (including antivirals) within 10 days prior to Visit 2 25. Has a history of active tuberculosis (TB) or a positive Quantiferon-TB Gold test during screening 26. Has received any live vaccine within 4 weeks prior to Day ?2 27. Had major surgery within 8 weeks before signing the ICF or major surgery planned during the study period 28. Anticipate the need for adenoidectomy or tonsillectomy within 6 months of enrollment. If adenoidectomy or tonsillectomy is anticipated it should be performed prior to screening. 29. Has an absolute neutrophil count<1.0?10.sup.3/?L 30. Has any condition or laboratory abnormality that the PI believes would not be appropriate for immunosuppressive therapy

(369) 6.6.6. Proposed Dose

(370) Construct 1 will be preferentially administered as a single IC injection, or as a single ICV injection should IC administration prove difficult or potentially unsafe, to allow direct delivery of the vector to the target tissue within the confined CSF compartment. Although cervical puncture (C1-C2) is a routine clinical procedure used for contrast administration for myelography, image-assisted suboccipital puncture is proposed as the IC clinical route of administration. This replicates the route of administration used in the nonclinical studies and is considered advantageous over the C1-C2 puncture in the intended patient population because patients with MPS II have a high incidence of abnormal narrowing of the C1-C2 IT space, which substantially increases the risks associated with a C1-C2 puncture. Prior to the procedure, each subject will have a magnetic resonance imaging (MRI) of the area reviewed by a team of neuroradiologists/neurosurgeons participating in the study. If it is not considered safe to proceed with an IC injection, then the subject will be considered for ICV injection. ICV injection is a commonly used route for ventriculoperitoneal shunt placement in pediatric and adult individuals and, more recently, CNS drug administration (Drake et al., 2000, Childs Nerv Syst. 16(10-11):800-804; Cohen et al., 2017, Pediatric Neurology, 67:23-25; Slavc et al., 2018, Mol Genetics and Metabolism, 124:184-188). Image-assisted single ICV injection, as proposed in this protocol, is comparable to stereotactic brain biopsy, which has also become a routine neurosurgical intervention with the advent of precise MRI and computed tomography (CT) technology.

(371) From pharmacology studies conducted in MPS II mice with Construct 1, it has been shown that the biodistribution and transgene expression profiles of AAV9 vector-based products are comparable for ICV and IC routes, supporting the use of ICV as an alternative route of administration should IC administration prove difficult or potentially unsafe. Further details of the IC and ICV procedures are outlined in their respective Administration Manual.

(372) The total volume of product administered will not exceed 10% of the total CSF volume (estimated to be ?50 mL in infant brain and ?150 mL in adult brain).

(373) Because of the relatively rapid brain growth that occurs early in a developing child, the total dose of Construct 1 administered IC or ICV depends on the estimated brain mass derived from the study subject's screening MRI. The study subject's estimated brain volume from their MRI will be converted to brain mass and used to calculate the exact dose to be administered, as presented in Table 5, Section 5.3.2.

(374) 6.6.7. Immunosuppressive Therapy

(375) Corticosteroids In the morning of vector administration (Day 1 predose), subjects will receive methylprednisolone 10 mg/kg IV (maximum of 500 mg) over at least 30 minutes. The methylprednisolone should be administered before the lumbar puncture and IC or ICV injection of IP. Premedication with acetaminophen and an antihistamine is optional and at the discretion of the investigator. On Day 2, oral prednisone will be started with the goal to discontinue prednisone by Week 12. The dose of prednisone will be as follows: Day 2 to the end of Week 2: 0.5 mg/kg/day Week 3 and 4: 0.35 mg/kg/day Week 5-8: 0.2 mg/kg/day Week 9-12: 0.1 mg/kg Prednisone will be discontinued after Week 12. The exact dose of prednisone can be adjusted to the next higher clinically practical dose.

(376) Sirolimus 2 days prior to vector administration (Day ?2): a loading dose of sirolimus 1 mg/m.sup.2 every 4 hours?3 doses will be administered From Day ?1: sirolimus 0.5 mg/m.sup.2/day divided in twice a day dosing with target blood level of 1-3 ng/ml Sirolimus will be discontinued after the Week 48 visit.

(377) Tacrolimus Tacrolimus will be started on Day 2 (the day following IP administration) at a dose of 0.05 mg/kg twice daily and adjusted to achieve a blood level 2-4 ng/mL for 24 Weeks. Starting at Week 24 visit, tacrolimus will be tapered off over 8 weeks. At Week 24, the dose will be decreased by approximately 50%. At Week 28, the dose will be further decreased by approximately 50%. Tacrolimus will be discontinued at Week 32. Tacrolimus and sirolimus blood level monitoring will be conducted.

(378) Dosing Adjustments

(379) Prednisone dosing will start at 0.5 mg/kg/day and will be gradually tapered off by the Week 12 visit.

(380) Tacrolimus dose adjustments will be made to maintain whole blood trough concentrations within 2-4 ng/mL for the first 24 Weeks. At Week 24, the dose will be decreased by approximately 50%. At Week 28, the dose will be further decreased by approximately 50%. Tacrolimus will be discontinued at Week 32. Sirolimus dose adjustments will be made to maintain whole blood trough concentrations within 1-3 ng/mL. Dose adjustments should be performed by a clinical pharmacist. Subjects should continue on the new maintenance dose for at least 7 to 14 days before further dosage adjustment with concentration monitoring.

(381) Pneumocystis carinii pneumonia (PCP) prophylaxis with trimethoprim/sulfamethoxazole (Bactrim?; BACTRIM? USPI, 2013) will be given three times a week (example dosing schedule; Monday, Wednesday, Friday) at a dose of 5 mg/kg beginning on Day ?2 and continuing until Week 48. Refer to the prescribing information for risks associated with trimethoprim/sulfamethoxazole use (BACTRIM? USPI, 2013). For patients with sulfa allergies, alternative medications can include pentamidine, dapsone, and atovaquone.

(382) Antifungal prophylaxis is to be initiated if the ANC is <500 mm.sup.3. The treatment regimen will be determined through local site standard of care in consultation with appropriate subspecialists.

(383) The concomitant use of Rapamune with a calcineurin inhibitor may increase the risk of calcineurin inhibitor-induced thrombotic microangiopathies. Thrombotic microangiopathies (TMA) are a group of disorders characterized by thrombocytopenia, microangiopathic hemolytic anemia, and variable organ system involvement.

(384) This may present severe thrombocytopenia (<30?10.sup.9/L), microangiopathic hemolytic anemia characterized by schistocytes on the blood smear, increased reticulocyte count (>120?10.sup.9/L), elevated lactate dehydrogenase level (LDH), and signs of skin and mucosal hemorrhage, weakness, and dyspnea. Treatment includes discontinuation of tacrolimus and possible initiation of plasma exchange.

(385) If rising CMV or EBV viral genomes are detected during serial testing, the decision to decrease IS or begin antiviral therapy will be determined through local site standard of care in consultation with appropriate subspecialists.

(386) 6.6.8. Prohibited Medications and Procedures

(387) The following medications and procedures are prohibited: No IT ERT is allowed within 4 months of signing the ICF. Any investigational product within the 30 days or 5 half-lives, whichever is longer, prior to signing the ICF or at any time during the study (through Week 104) Live vaccines should be avoided while on sirolimus and/or tacrolimus Strong inhibitors of CYP3A4 and/or P-glycoprotein (PgP) (such as ketoconazole, voriconazole, itraconazole, posaconazole, erythromycin, telithromycin or clarithromycin) or strong inducers of CYP3A4 and or Pgp (such as rifampin or rifabutin) should be avoided while on sirolimus and/or tacrolimus Grapefruit juice inhibits CYP3A-enzymes resulting in increased tacrolimus and sirolimus whole blood trough concentrations. Subjects should avoid eating grapefruit or drinking grapefruit juice with tacrolimus and/or sirolimus.

(388) 6.6.9. Permitted Medications and Procedures

(389) Subjects will be permitted to remain on a stable regimen of IV ERT as well as any supportive measures (e.g., physical therapy). According to local hospital standard of care, subjects will be permitted to receive medication to prevent claustrophobia during MRI and receive general anesthesia for lumbar puncture, MRI, and neuroconduction studies (ABRs or SSEP).

(390) Medications other than that described above, which are considered necessary for the subject's safety and wellbeing (e.g., for hypertension), may be given at the discretion of the Investigator in accordance with local standard of care and recorded in the appropriate sections of the CRF.

(391) 6.6.10. Efficacy Assessments

(392) Biomarkers CSF: GAGs, I2S Plasma: GAGs, I2S. For subjects treated with weekly IV ERT, plasma biomarkers are to be collected at trough, defined as at least 96 hours after ERT infusion up until the start of the subsequent infusion Leukocyte I2S enzyme activity. For subjects treated with weekly IV ERT, whole blood is to be collected at trough, defined as at least 96 hours after ERT infusion up until the start of the subsequent infusion Urine: GAGs. For subjects treated with weekly IV ERT, urine GAGs are to be collected at trough, defined as at least 96 hours after ERT infusion up until the start of the subsequent infusion

(393) Neurodevelopmental parameters of cognitive, behavioral, and adaptive function: Bayley Scales of Infant and Toddler Development, 3rd Edition (BSID-III) or Kaufman Assessment Battery for Children, 2nd Edition (KABC-II) Vineland Adaptive Behavior Scales, 2nd Edition, Expanded Interview Form (VABS-II) Other neurocognitive or adaptive assessments performed as part of subjects' standard of care while participating in the trial may also be collected, as determined by the study sponsor after discussing with the site

(394) Imaging Assessments MRI of the brain will be performed at certain visits. Estimated glomerular filtration rate (eGFR) must be documented prior to the screening MRI with gadolinium. The investigator must consult with the Medical Monitor before proceeding with the screening MRI if the eGFR is <30 mL/min/1.73 m.sup.2 Abdominal ultrasounds will be performed at certain visits to document craniocaudal liver diameter at the midclavicular line (Kratzer et al., 2003, J. Ultrasound Med. 22:1155-1161) and spleen volume calculated using the prolate ellipsoid formula (0.52?length?anteroposterior dimension?width) 2-D echocardiogram will be performed at certain visits to evaluate for valvular disease and left ventricular mass index. Auditory capacity changes will be measured by behavioral audiometry and otoacoustic emissions testing; if behavioral audiometry is not feasible, then ABR testing will be completed. Auditory capacity will be assessed at certain visits; an additional assessment is permitted at the Week 24 visit if deemed clinically necessary by the investigator. QOL assessments using PedsQL Sleep assessment Clinical Assessment of Disease Caregiver Assessment of Disease ADL Burden of Illness

(395) 6.6.11. Clinical Laboratory Tests

(396) The following CSF safety laboratory and antibody tests will be assessed: Markers of CSF inflammation: CSF pressure, erythrocyte cell count, WBC count with differential, total protein, and glucose Immune Response Monitoring: neutralizing antibodies to AAV9 and binding antibodies to I2S Vector concentration (gPCR): Construct 1 concentrations

(397) The following clinical laboratory tests will be assessed: Chemistry: glucose, blood urea nitrogen, creatinine, sodium, potassium, chloride, carbon dioxide, calcium, magnesium, phosphorus, total protein, albumin, total bilirubin, direct bilirubin, alkaline phosphatase (ALP), ALT, AST, gamma glutamyl-transferase, and creatine kinase Lipid panel: total cholesterol, low-density lipoprotein (LDL) cholesterol, high-density lipoprotein (HDL) cholesterol, and triglycerides Hematology: CBC with differential and platelet count, including hematocrit, hemoglobin, red blood cell (RBC), WBC, platelet, neutrophil, lymphocyte, monocyte, eosinophil, and basophil counts Coagulation: prothrombin time (PT) and partial thromboplastin time (PTT) Urinalysis: dipstick for glucose, ketones, protein, and blood (if warranted, a microscopic evaluation will be completed) Immunogenicity measurements: neutralizing antibodies to AAV9 and binding antibodies to I2S; ELISPOT assay: T-cell response to AAV9 and I2S; flow cytometry for AAV and I2S specific regulatory T cells Vector concentration (qPCR): Construct 1 concentrations in serum and urine Viral testing for serology and genome detection: VZV: Ab titer (baseline) EBV and CMV: PCR testing for viral genome (baseline and serially) Hepatitis B surface antigen, hepatitis B core antibody, anti-hepatitis C, and HIV: only for screening purposes Quantiferon-Gold_TB Plus: only for screening purposes. Plasma biomarkers Urine biomarkers

(398) Laboratory reports will be made available to the PI in a timely manner to ensure appropriate clinical review. The PI is responsible for reviewing and signing all laboratory reports.

(399) 6.6.12. Vital Signs and Electrocardiogram

(400) Assessment of vital signs (systolic/diastolic BP, pulse rate, temperature, and respiratory rate), head circumference, height, weight, and ECGs will be obtained/performed at visits.

(401) 6.6.13. Neurologic Assessments

(402) Neurologic assessments should include the following: Level of consciousness Cranial nerve testing Motor function Sensory function Coordination and gait

(403) SSEP testing will also be performed at selected time points. Additional details on protocol requirements for SSEP testing can be found in the SSEP Manual.

6.7 Example 7: MPS II Murine Model Study

(404) MPS II or Hunter syndrome is caused by a deficiency of iduronate-2-sulfatase (I2S) leading to an accumulation of glycosaminoglycans (GAGs) in tissues. Severe MPS II results in irreversible neurocognitive decline and behavioral symptoms that are not addressed by intravenously administered enzyme replacement therapy with recombinant I2S enzyme. Construct 1 is a recombinant adeno-associated virus serotype 9 capsid (AAV9) containing a human iduronate-2-sulfatase expression cassette (AAV9.CB7.hIDS). In an MPS II murine model, Construct 1 administered into the cerebrospinal fluid (CSF) demonstrated dose-dependent I2S activity, reduced GAG levels, amelioration of storage pathology in the central nervous system and improved neurobehavioral function. Vector distribution and reduced GAG levels were observed in peripheral organs, as well as normalization of liver size and weight.

6.8 Example 8: A Phase 1/2, First-In-Human, Multicenter, Open-Label. Dose Escalation Trial

(405) Mucopolysaccharidosis Type II (MPS II) is a rare, X-linked recessive disease caused by a deficiency in the lysosomal enzyme iduronate-2-sulfatase (I2S) leading to an accumulation of glycosaminoglycans (GAGs), including heparin sulfate (HS) in tissues which ultimately results in cell, tissue, and organ dysfunction. In severe forms of the disease, early developmental milestones may be met, but developmental delay is readily apparent by 18 to 24 months. Patients with MPS II continue to have significant difficulties despite the availability of systemic enzyme replacement therapy which does not address manifestations of the disease in the central nervous system (CNS) such as impaired cognitive development. Specific treatment to address the neurological manifestations of MPS II and prevent or stabilize cognitive decline remains a significant unmet medical need. Key biomarkers of I2S enzymatic activity in MPS I1 patients include its substrate HS, which has been shown to correlate with neurocognitive manifestations of the disorder.

(406) In an ongoing phase 1/2, first-in-human, multicenter, open-label, dose escalation trial, Construct 1 has been administered as a one-time injection using a single intracisternal injection into the cisterna magna of participants with severe MPS II ages 4 months to 5 years. Construct 1 is designed to deliver the gene that encodes the I2S enzyme direct to the CNS using the AAV9 vector, aimed to provide a permanent source of secreted I2S beyond the blood-brain barrier, allowing for long-term cross correction of cells throughout the CNS.

(407) Patients must have met any of the following inclusion criteria: a) a documented diagnosis of MPS II and a neurocognitive testing score?77 (Bayley or Kaufman); b) a documented diagnosis of MPS II and a decline of ?1 standard deviation on serial neurocognitive testing administered between 3 to 36 months apart (Bayley or Kaufman); c) a relative clinically diagnosed with severe MPS II who has the same IDS mutation as the subject and in the opinion of a geneticist has inherited a severe form of MPS II; or d) a documented mutation(s) in IDS that in the opinion of a geneticist is always known to result in a neuronopathic phenotype and in the opinion of a clinician has a severe form of MPS II. Patient must be ?4 months to <5 years of age.

(408) Exclusion criteria included: patient having contraindications for intracisternal injection, intracerebroventricular injection, or lumbar puncture; contraindications for immunosuppressive therapy; neurocognitive deficit not attributable to MPS II or diagnosis of a neuropsychiatric condition; patients having a (cerebral) ventricular shunt that may impact the proper dosing of the subject; subjects that received hematopoietic stem cell transplantation; subjects that had prior treatment with an AAV-based gene therapy product; subjects that received ELAPRASE? via intrathecal (IT) administration within 4 months of signing the ICF or experienced a serious hypersensitivity reaction to ELAPRASE?; subjects that received any investigational product within 30 days of Day 1 or 5 half-lives before signing the ICF, whichever is longer; subjects that have a platelet count<100,000 per microliter (?L), absolute neutrophil count<1.3?10.sup.3/?L, or aminotransferase (ALT) or aspartate aminotransferase (AST)>3?upper limit of normal (ULN) or total bilirubin>1.5?ULN at screening unless the subject has a previously known history of Gilbert's syndrome.

(409) Assessments included safety and tolerability up to 104 weeks; CSF, plasma and urine biomarkers; immunogenicity; neurodevelopmental scales (Bayley Scales of Infant and Toddler Development or Kaufman Assessment Battery for Children, and Vineland Adaptive Behavior Scales); audiometry; imaging of the brain, liver and spleen; and clinician- and patient-reported outcome measures.

(410) A total of 8 patients have been dosed with either 1.3?10.sup.10 genome copies per gram (GC/g) of brain mass (Cohort 1) or 6.5?10.sup.10 GC/g of brain mass (Cohort 2). The ages of the patients range from 5 months to 59 months. At least 3 patients completed immunosuppression regimen in Cohort 1 with 64, 78, and 104 follow-up weeks and at least 1 patient completed immunosuppression regimen in Cohort 2 with 56 follow up weeks as presented in Table 9. Mutations among the patients included 3 missense, 2 gene inversion, and 3 frameshift. In Cohort 1 and Cohort 2 of the Phase 1/2 study, eight patients were dosed intracistermally at ages ranging from 5 months to 59 months with 3 patients dosed at 1.3?10.sup.10 genome copies per gram (GC/g) of brain mass and 4 patients dosed at 6.5?10.sup.10 genome copies per gram (GC/g) of brain mass. Cohort 3 of the Phase 1/2 study also includes Cohort 3 with patients dosed at 2.0?10.sup.11 genome copies per gram (GC/g) of brain mass. In some cases, Cohort 3 of the Phase 1/2 study can also include another Cohort with patients dosed at 2.9?10.sup.11 genome copies per gram (GC/g) of brain mass. The number of genome copies in the dose of 2.0?10.sup.11 GC/g brain mass was determined based on a Poly-A-specific PCR assay and the weight of brain mass was determined by MRI. The number of genome copies in the dose of 2.9?10.sup.11 GC/g brain mass was determined based on a transgene-specific PCR assay and the weight of brain mass was determined by MRI. Construct 1 administration has been well tolerated in all six patients in Cohort 1 and Cohort 2, with no drug-related serious adverse events (SAEs) reported. Per protocol, patients received a 48 week immunosuppression regimen to minimize the potential for immune-mediated reactions with 4 patients (3 from Cohort 1 and 1 from Cohort 2) completing the immunosuppression regimen.

(411) TABLE-US-00026 TABLE 9 Cohort 1 and Cohort 2 Overview Dose (GC/g brain Follow-Up Immunosuppression ERT (IV) Patient mass) (weeks) Regimen Status status.sup. 1 1.3 ? 10.sup.10 104 Complete Weekly 2 1.3 ? 10.sup.10 78 Complete Discontinued 3 1.3 ? 10.sup.10 64 Complete Discontinued 4 6.5 ? 10.sup.10 56 Complete Weekly 5 6.5 ? 10.sup.10 32 Tapering Weekly 6 6.5 ? 10.sup.10 24 Tapering Naive 7 6.5 ? 10.sup.10 8 Active Weekly 8 6.5 ? 10.sup.10 4 Active Na?ve .sup.ERT can be discontinued after week 52

(412) A total of 13 patients participated in a Phase 1/2 trial (FIG. 22). Previous studies found that a widespread CNS and systemic biodistribution was observed in non-human primates after IC administration of Construct 1 (FIG. 23). Patients (3 patients) in cohort 1 were dosed with 1.3?10.sup.10 genome copies per gram (GC/g) of brain mass of Construct 1, patients (7 patients) in cohort 2 were dosed with 6.5?10.sup.10 GC/g of brain mass of Construct 1, and patients (3 patients) in cohort 3 were dosed with 2.9?10.sup.11 GC/g of brain mass of Construct 1 (cohort 3 was previously reported as 2.0?10.sup.10 GC/g of brain mass based on a Poly-A-specific PCR assay, which is equivalent to 2.9?10.sup.11 GC/g of brain mass using a transgene-specific PCR assay). Participant ages at dosing ranged from 5 months to 59 months. IDS mutations among severe MIPS II trial participants included missense, gene inversion, and frameshift. Follow-up included 104 weeks for participants in cohort 1, 8-104 weeks for participants in cohort 2, and 8-36 weeks for participants in cohort 3.

(413) Immunosuppression discontinued (e.g., after 52 weeks) in all eligible participants (n=8) as follows: three participants completed immunosuppression regimen in cohort 1; 5 participants completed immunosuppression regimen in cohort 2 (while 2 are active); and 3 participants in cohort 3 are active for immunosuppression regimen. The ERT (IV) status were as follows: 1 weekly and 2 discontinued for cohort 1; 4 weekly, 1 discontinued, and 2 na?ve for cohort 2; and 3 weekly for cohort 3. Results showed that no SAEs related to the study has been identified. CSF HS levels were determined at different time points and results showed dose-dependent reductions in Cohorts 1-3 at Weeks 8 and 24 (FIGS. 24A-24B). Further, the majority of participants in all three cohorts demonstrated decreased CSF HS at last time point available. The HS D2S6 disaccharide level was determined at different time points and results showed dose-dependent reductions in Cohorts 1-3 at Week 8 and 24, with Cohort 3 participants approaching normal levels (FIGS. 25A-25B). Results showed that the majority of participants in all three cohorts demonstrated decreased CSF D2S6 at last time point available. Further, samples from the subjects showed measurable CSF I2S protein concentration in cohort 2 and 3 participants after Construct 1 administration (range 834-4830 pg/mL).

(414) Patients were evaluated for safety, tolerability, and efficacy for 104 weeks after dosing. Assessments include biomarkers in the CSF, plasma and urine: neurodevelopmental scales (Bayley Scales of Infant and Toddler DevelopmentBSID, Vineland Adaptive Behavior ScalesVABS): audiometry; imaging of the brain, liver and spleen; immune response assays; and clinician- and patient-reported outcome measures. Participants were assessed using the BSID-III cognitive, expressive and receptive language, and fine and gross motor subtests (e.g., FIG. 26A and FIG. 27A (cohort 1 and cohort 2 respectively) show data for BSID-III cognitive subtest, FIG. 26B and FIG. 27B (cohort 1 and cohort 2 respectively) show data for expressive language subtest, and FIG. 26C and FIG. 27C (cohort 1 and cohort 2 respectively) show data for fine motor subtest). It was observed that for cohort 1, 3 participants with cognitive function above ?2 standard deviations (SD) at baseline remained within 2 SD at the last assessment on the cognition, expressive language and fine motor subtests, and that another participant acquired skills on the expressive language subtest. For cohort 2, minimal skill acquisition was demonstrated in cognition for 2 participants (AEq increase of 2-3 months) and in expressive language for another participant (AEq increase of 5 months). The participants were also tested for maladaptive behavior (undesirable behaviors that interfere with daily function) and toileting skills using Vineland Adaptive Behavior Scales-II (VABS-II). Maladaptive behaviors and challenges with toilet training are associated with neurodegeneration. Results showed that 4 participants (3 with cognitive function<?2SD at baseline) showed a reduction in maladaptive behaviors (FIG. 28A), and 4 participants (2 with cognitive function below <?2SD at baseline) showed an improvement in toileting skills (FIG. 28B). Further, participants were subjected to a sleep breathing subtest and it was found that 10 of 11 participants (5 with cognitive function<?2SD) showed improved sleep breathing following Construct 1 administration. The sleep breathing subtest detects sleep disturbances in children, such as snoring and difficulty breathing during sleep, which can be due to airway abnormalities, respiratory mechanisms and CNS involvement. To analyze systemic effects, plasma I2S protein concentration and urine total GAGs were determined at different timepoints. It was found that increased plasma I2S protein concentration was demonstrated in the majority of participants after Construct 1 administration (FIG. 29A). It was also found that urine GAG levels showed evidence of systemic effect of Construct 1 independent of ERT treatment (FIG. 29B). For example, for ERT Na?ve participants, a notable decline was demonstrated in urine GAGs in one of two participants through last time point available; for ERT withdrawal, total urine GAGs following ERT withdrawal remained relatively consistent with total urine GAGs prior to ERT withdrawal; and for ERT continuation, total urine GAGs decreased in all participants at the last time point available (FIG. 29B).

(415) The primary outcome for the Phase 1/2 study include safety measures to determine the number of patients with treatment-related adverse events and serious adverse events with the time frame of 24 weeks.

(416) The secondary outcome include safety measures to determine the number of patients with treatment-related adverse events and serious adverse events with the time frame of 104 weeks; biomarker measurement to determine change from baseline in Glycosaminoglycan levels (ng/mL) measured at baseline, Week 2, Week 4, Week 8, Week 24, Week 48, Week 56, Week 104; biomarker measurement to determine change from baseline in iduronate-2-sulfatase activity measured at baseline Week 1, Week 2, Week 4, Week 8, Week 24, Week 32, Week 48, Week 56, Week 104; change from baseline in neurodevelopment parameters of cognitive, behavioral and adaptive function as measured by the Bayley Scales of Infant and Toddler Development, 3rd Edition (BSID-III) or Kaufman Assessment Battery for Children, 2nd Edition (KABC-II). Based on their mean age equivalence score on the Vineland Adaptive Behavior Scales (outcome #7), the child will be assessed using either the BSID-III (for scores of <36 months or </=42 months and unable to complete the KABC-II) OR the KABC-II (for scores of >/=36 months) measured at baseline, Week 48, Week 78, Week 104; change from baseline in neurodevelopment parameters of cognitive, behavioral and adaptive function as measured by the Mullen Scales of Early Learning (MSEL) measured at baseline, Week 48, Week 78, Week 104; and change from baseline in neurodevelopment parameters of cognitive, behavioral and adaptive function as measured by the Vineland Adaptive Behavior Scales, 2nd Edition (VABS-II), Comprehensive Interview Form measured at baseline, Week 48, Week 78, Week 104.

(417) Data and safety summary: Construct 1 is well-tolerated with no drug-related serious adverse events (SAEs) as observed in eight patients. Time of post-administration follow-up ranges from four weeks to two years. All four patients that reached 48-weeks of follow-up completed the immunosuppression regimen, per study protocol. Six of the patients were receiving weekly, intravenous enzyme replacement therapy (ERT) at the time of enrollment; two of these patients have since discontinued ERT.

(418) CNS biomarker data: in MPS II patients, high amounts of HS accumulate in the CNS, closely correlating with neurocognitive decline. Biomarker data from patients in Cohort 1 and Cohort 2 showed signals of I2S enzyme activity in the CNS following one-time administration of Construct 1. Heparan sulfate (HS) and D2S6, a component of HS, are glycosaminoglycans (GAGs) that are key biomarkers of I2S enzyme activity and were measured in the cerebrospinal fluid (CSF) at baseline and after administration of Construct 1. I2S enzyme cleaves sulfates from HS in the lysosome and absence of I2S causes long chains of fully sulfated D2S6 to accumulate in HS. As such, quantitative measurement of D2S6 is reflective of I2S enzyme activity level. I2S6 and D2S6 are products of heparinase digestion as illustrated in FIG. 7. Elevated levels of HS and D2S6 correlate closely with the neuronopathic phenotype of MPS II. HS levels in the first six patients in Cohorts 1 and 2 demonstrated consistent reductions in the CSF up to 2 years following Construct 1 administration, with median reductions from baseline of 30.3% at Week 8 and 35.8% at the last timepoint available for each patient (p-value is 0.03 obtained from Wilcoxon signed rank test) (see FIG. 8). Similarly, these patients demonstrated consistent reductions of D2S6 up to 2 years following Construct 1 administration, with median reductions from baseline of 44.2% at Week 8 and 39.2% at the last timepoint available for each patient. In addition, I2S enzyme concentration in the CSF, which was undetectable in all patients prior to dosing, was measurable in patients from Cohort 2 after Construct 1 administration (range 1170-1940 pg/mL) (see FIG. 8). Change in CSF HS disaccharide D2S6 in Cohort 1 and Cohort 2 patients was determined (see FIG. 9). The median change from baseline at week 8 (N=6) was 44.2% and the p-value was 0.03 and the median change from baseline at the last available timepoint (N=6) was 39.2% as determined by Wilcoxon signed rank test (see FIG. 9). The D2S6 disaccharide clearly differentiated between severe, attenuated and normal patients; study patients showed consistent decrease in CSF D2S6 into the attenuated range.

(419) Neurocognitive development data: patients in Cohorts 1 and 2 demonstrated continued neurocognitive development up to two years after Construct 1 administration. Five patients in Cohorts 1 and 2 reached at least 6 months of follow-up since Construct 1 administration, and of those five patients, three continued to demonstrate neurocognitive development within a normal range, according to the Bayley Scales1 (see FIGS. 10A-10C).). Further, data interpretation from the firt in human (FIH) trial of Construct 1 using DQ and AEq were shown to be consistent (FIGS. 10B-10C), indicating that 75% of the patients who started treatment before the onset of development decline continued to demonstrate neurocognitive development above ?2SD of normal as of >6-month follow-up and the cognitively declined patient at baseline demonstrated relative stabilized and continued to acquire expressive and receptive language skills. In brief, mock data were generated from raw, standard and AEq scores in the BSID-III manual for subjects between 4 and 42 months of age with normal, below and above 1SD (1 standard deviation) from normal, and below and above 2SD (2 standard deviations) from normal developmental status. Raw score, AEq, and DQ were derived to correspond to a mean scale score, and 1 and 2 SDs from the mean. The scores were fitted with a quadratic or linear regression line to approximate the range of the normal distribution. The fitted?1SD and ?2SD lines using the data from the BSID-III manual for cognitive domain were then applied to Construct 1 longitudinal BSID-III data to track change over time and to evaluate treatment efficacy. Two patients entered the study with significant delay in neurocognitive development at baseline. After Construct 1 administration, one of these patients demonstrated ongoing neurocognitive development, and both patients continued to acquire expressive and receptive language skills based on the Bayley Scales. Continued language and/or motor skills acquisition was observed in all patients with greater than 6 months follow-up (see FIGS. 11A-li D).

(420) Systemic biomarker data and clinical efficacy: patients in Cohorts 1 and 2 demonstrated evidence of I2S enzyme activity in plasma and urine following administration of Construct 1. Five of six patients demonstrated increased I2S enzyme concentration levels in plasma over time (see FIG. 12). Six of eight patients dosed with Construct 1 were receiving ERT at the time of enrollment in the study. All six of these patients showed decreased total GAG levels in urine up to two years following Construct 1 administration (see FIG. 13). Notably, two patients in Cohort 2 who were na?ve to ERT demonstrated rapid reductions in urine total GAG levels following Construct 1 administration (see FIG. 14). One patient who never received ERT, demonstrated clear reduction in liver and spleen dimensions 24 weeks after receiving Construct 1 (see Table 10). Dimensions of liver and spleen can be measured using ultrasound (see FIG. 15). A decrease in liver diameter (10%) and spleen volume (77%) in patient 6 who is ERT na?ve was observed by abdominal ultrasound 24 weeks after Construct 1 administration (see Table 10).

(421) TABLE-US-00027 TABLE 10 Liver and Spleen Dimensions Liver Spleen Spleen Spleen Follow-Up Diameter Length Height Width Patient (weeks) (cm) (cm) (cm) (cm) Patient 6 Screening 12.0 9.0 6.0 7.7 (Cohort 2) Patient 6 24 10.8 7.6 4.0 3.2 (Cohort 2)

(422) Conclusion: Construct 1 has been well-tolerated in patients with MPS I1 following one-time intracisternal administration (8 patients showed no SAE related to Construct 1); immunosuppression discontinued in 4 patients according to protocol; treatment with Construct 1 resulted in a consistent and sustained reduction in CSF levels of heparan sulfate, a key biomarker of I2S enzyme activity in MPS II, as consistent reductions in HS in the CSF was observed up to 2 years; CSF I2S enzyme concentration was measurable in all Cohort 2 patients; continued cognitive development was observed in 4 of 5 patients with >6 months of follow-up; continued language and/or motor skills acquisition was observed in patients with >6 months of follow-up; continued acquisition of cognitive and/or language skills was observed in patients with cognitive delay prior to dosing; plasma I2S enzyme levels increased in 5 of 6 patients; rapid urine GAG reduction was observed in ERT na?ve patients; decreased liver and spleen dimensions was observed in ERT na?ve patient; absence of urine GAG rebound in the 2 patients who have discontinued ERT; and improvement in neurocognitive parameters correlate with decline in D2S6 marker.

6.9 Example 9: A Phase 1/II Multicenter, Open-Label Study to Evaluate the Safety, Tolerability, and Pharmacodynamics of Construct 1 in Children 5 Years of Age and Older with MPS II (Hunter Syndrome)

(423) 6.9.1. Synopsis

(424) Study Design

(425) This is a Phase I/II, multicenter, open-label, single arm study of Construct 1. No control group is included. Approximately 6 children (?5 years to <18 years of age) who have severe (neuronopathic) MPS II could be enrolled into a single dose cohort of 6.5?10.sup.10 GC/g brain mass and will receive a single dose of Construct 1 administered by IC or ICV injection.

(426) Primary Objectives To evaluate the safety and tolerability of Construct 1 through 24 weeks following a single IC dose, or ICV dose if the IC route is contraindicated, administered to older (?5 years) children who have neuronopathic MPS II

(427) Secondary Objectives To evaluate immunogenicity of Construct 1 To explore the effect of Construct 1 on CNS imaging To explore the effect of Construct 1 on systemic manifestations of disease To explore the effect of Construct 1 on biomarkers in plasma and urine in participants who discontinue IV ERT (ELAPRASE?) To explore the effect of Construct 1 on quality of life (QOL) To explore the effect of Construct 1 on sleep measures To explore the effect of Construct 1 on clinician reported outcome To explore the effect of Construct 1 on caregiver reported outcome To use video recording to capture everyday function To explore the effect of Construct 1 on fine motor dexterity

(428) Diagnosis and Main Criteria for Inclusion:

(429) To be eligible to participate in this study, a participant must be a male?5 years to <18 years of age with: a documented diagnosis of MPS II with neurocognitive decline, or a documented mutation(s) in IDS known to result in a neuronopathic form of MPS II, or a documented mutation(s) in IDS identical to that of a relative with neuronopathic MPS II.

(430) In addition, the participant must be able to safely receive an IC or ICV injection and immunosuppression.

(431) Investigational Product, Dosage and Mode of Administration

(432) Construct 1: AAV9.CB7.hIDS (recombinant adeno-associated virus serotype 9 capsid containing human iduronate-2-sulfatase expression cassette). See FIG. 5.

(433) Product will be delivered as a single IC or ICV dose.

(434) One dose level will be evaluated, 6.5?10.sup.10 GC/g brain mass. Total dose administered will account for estimated brain size of study participants based on their screening MRI. Total volume of product administered will not exceed 10% of estimated CSF volume.

(435) 6.9.2. Criteria for Evaluation Safety and Efficacy

(436) Primary Endpoints Safety through Week 24: AEs and SAEs

(437) Secondary Endpoints Safety through Week 104: AEs and SAEs Biomarkers in CSF (GAGs, I2S), plasma (GAGs, I2S), and urine (GAGs) Neurodevelopmental parameters of cognitive, behavioral, and adaptive function: Bayley Scales of Infant and Toddler Development, 3rd Edition (BSID-III) (Bayley, 2005, Scales of Infant and Toddler Development, 3rd Ed.) Mullen Scales of Early Learning (MSEL) (Mullen, Circle Pines, MN: American Guidance Service Inc.; 1995) Vineland Adaptive Behavior Scales, 2nd Edition, Expanded Interview Form (VABS-II) (Sparrow et al., 2005, Vineland Adaptive Behavior Scales, 2nd Ed.)

(438) Exploratory Endpoints Immunogenicity measurements Neutralizing antibody titers to AAV9 and binding antibody titers to I2S in CSF and serum Enzyme-linked immunospot (ELISPOT) assay: T-cell response to AAV9 and I2S CNS structural abnormalities assessed by MRI of the brain Liver and spleen size assessed by ultrasound of the abdomen Cardiac evaluation by echocardiogram for valvular disease and left ventricular mass index Median nerve motor and sensory distal conduction velocity and latency Plasma and urinary GAGs in participants who discontinue IV ERT (ELAPRASE?) PedsQL Sleep assessment (Sleep Disturbance Scale for ChildrenSDSC) (Ferreira et al., 2009, Sleep Medicine; 10(4):457-463) Clinician Global Impression of Severity and Clinician Global Impression of Change Caregiver Global Impression of Severity and Caregiver Global Impression of Change Activities of Daily Living (Tanjuakio et al. 2015, Mol Genet Metab, 114(2):161-169; Kato et al., 2007, Brain Dev, 29(5): 298-305) Pediatric Evaluation of Disability Inventory Computer Adaptive Test (PEDI CAT) 9-Hole Peg Test Functional performance as captured by video

(439) Statistical Methods

(440) All data will be analyzed using descriptive statistics. Categorical variables will be summarized using frequencies and percentages. Continuous variables will be summarized using number of non-missing observations, mean, standard deviation, median, minimum, and maximum). Graphical displays will be presented as appropriate. Participant data listings will also be presented.

(441) Sample Size and Power Calculation

(442) No formal calculation was performed to determine sample size.

(443) 6.9.3. List of Abbreviations and Definitions of Terms

(444) TABLE-US-00028 TABLE 11 Abbreviations and Specialist Terms Abbreviation or Specialist Term Explanation AAV Adeno-associated virus AAV9 Adeno-associated virus serotype 9 ABR Auditory brainstem response (s) ADL Activities of Daily Living AE Adverse event AESI Adverse event of special interest ALP Alkaline phosphatase ALT Alanine aminotransferase ANC Absolute neutrophil count APB Abductor pollicis brevis AST Aspartate aminotransferase BBB Blood-brain barrier BID Twice a day BP Blood Pressure BSID Bayley Scales of Infant and Toddler Development BSL Biosafety level BUN Blood urea nitrogen CB7 Hybrid C4 and CB (chicken beta actin promoter) CBC Complete blood count CFR Code of Federal Regulations CGI-C Clinician Global Impression Scale for change CGI-S Clinician Global Impression Scale for severity CI Confidence Interval CIOMS Council for International Organizations of Medical Sciences CMV Cytomegalovirus CNS Central nervous system CoA Certificate of Analysis CRF Case report form CRO Contract research organization CSF Cerebrospinal fluid CT Computed tomography CTA Clinical Trial Agreement CTCAE Common Terminology Criteria for Adverse Events CZ Crystal Zenith? DLT Dose-limiting toxicity DNA Deoxyribonucleic acid DRG Dorsal root ganglia DS Dermatan sulfate ECG Electrocardiogram ED Early discontinuation (visit) EDC Electronic data capture eGFR Estimated glomerular filtration rate ELISA Enzyme-Linked Immunosorbent Assay ELISPOT Enzyme-Linked immunospot EOS End of Study ERT Enzyme Replacement Therapy EU European Union FDA Food and Drug Administration FIM Family Impact Module G gram GAG(s) Glycosaminoglycan(s) GC Genome copies GCP Good Clinical Practice GLP Good Laboratory Practice HBsAg Hepatitis B surface antigen HCV Hepatitis C virus Hep Hepatitis hIDS Human iduronate-2-sulfatase gene HIPAA Health Insurance Portability and Accounting Act HIV Human immunodeficiency virus HS Heparan Sulfate HSCT Hematopoietic stem cell transplantation IB Investigator's brochure IC Intracisternal ICF Informed consent form ICH International Conference on Harmonisation ICV Intracerebroventricular IDMC Independent Data Monitoring Committee IDS Iduronate-2-sulfatase gene IEC Independent Ethics Committee (s) IgG Immunoglobulin G IMP Investigational medicinal product IND Investigational New Drug INR International normalized ratio IP Investigational Product IRB/IEC Institutional review board/independent ethics committee IS Immune Suppression ISC Internal Safety Committee IT Intrathecal(ly) ITRs Inverted terminal repeats IV Intravenous(ly) LDH Lactate dehydrogenase level LDL Low-density lipoprotein LFT Liver function tests MED Minimum effective dose MedDRA Medical Dictionary for Regulatory Activities mL Milliliter MPS I Mucopolysaccharidosis type II MPS VII Mucopolysaccharidosis type VII MRI Magnetic resonance imaging MSEL Mullen Scales of Early Learning MTD Maximum tolerated dose NAb Neutralizing antibody NHP Non-human primates NIH National Institutes of Health NIMP Non-investigational medicinal product OAE Otoacoustic emission PBMC Peripheral blood mononuclear cell PCP Pneumocystis carinii pneumonia PCR Polymerase chain reaction PD Pharmacodynamic PEDI-CAT Pediatric Evaluation of Disability Inventory Computer Adaptive Test PHI Protected health information PI Principal Investigator PML Progressive multifocal leukoencephalopathy PK Pharmacokinetic PO By mouth/orally PT Prothrombin time, (MedDRA) preferred term PTT Partial thromboplastin time PVAN Polyoma virus-associated nephropathy QD Daily QOL Quality of Life qPCR Quantitative polymerase chain reaction RBC Red blood cell Construct 1 Recombinant adeno-associated virus serotype 9 capsid containing human iduronate-2-sulfatase expression cassette RNA Ribonucleic acid SAE Serious adverse event SAP Statistical Analysis Plan SD Standard deviation SDSC Sleep Disturbance Scale for Children SDV Source data verification SNAP Sensory nerve action potential SOC (MedDRA) System Organ Class SRT Safety Review Trigger SSEP Somatosensory evoked potential SUSAR Suspected unexpected serious adverse reaction TB Tuberculosis TEAE Treatment-emergent adverse event TMA Thrombotic microangiopathies Treg Regulatory T cell ULN Upper limit of normal US United States VABS Vineland Adaptive Behavior Scales VAS Visual Analog Scale VZV Varicella zoster virus WBC White blood cell WHO World Health Organization

(445) 6.9.4. Overall Study Design

(446) This is a Phase I/II, multicenter, open-label, single arm study of Construct 1. No control group is included. Approximately 6 children (?5 years to <18 years of age) who have severe (neuronopathic) MPS I1 could be enrolled into a single dose cohort of 6.5?10.sup.10 GC/g brain mass and will receive a single dose of Construct 1 administered by IC or ICV injection. Safety will be the primary focus for the initial 24 weeks after treatment (primary study period). Following completion of the primary study period, participants continue to be assessed (safety and efficacy) for up to a total of 104 weeks following treatment with Construct 1 (FIG. 10A). At the end of the study, participants will be invited to participate in a long-term follow-up study.

(447) The first 2 eligible participants will be enrolled in a staggered fashion. After Construct 1 administration to the first participant, there will be an 8-week observation period for safety. The Internal Safety Committee (ISC) will review the safety data obtained during the first 8 weeks of the study according to the ISC Charter (including data obtained during the Week 8 visit) for this participant, and if there are no safety concerns, the 2.sup.nd participant may be dosed. Informed consent and screening activities for the 2.sup.nd participant may proceed during the observation period for the first participant.

(448) If no safety review trigger (SRT) event is observed, all available safety data for the first 2 participants obtained up to and including the Week 8 visit for the 2.sup.nd participant will be evaluated by the Independent Data Monitoring Committee (IDMC). If the decision is to proceed, the next 4 participants may be enrolled.

(449) All available safety data will be evaluated by the IDMC after the Week 8 visit for the 6.sup.th participant and at intervals stipulated within the study-specific IDMC Charter.

(450) At any given IDMC meeting, whether planned or called for by an SRT, the IDMC may recommend stopping the trial, delaying the dosing of additional participants, or proceeding at a lower dose. Once 8 weeks of data are available from the 6.sup.th participant, then enrollment in the study will be completed.

(451) If any event meets the criteria of a prespecified Stopping Rule, dosing of any new participants will be suspended until a complete review of all safety data by REGENXBIO and the external IDMC has been performed.

(452) Those participants who meet the eligibility criteria will be admitted to the hospital between Day ?2 and the morning of Day 1 (according to institutional practice), and baseline assessments will be performed pre-dose. Participants will receive a single IC or ICV dose of Construct 1 on Day 1 and will remain in the hospital overnight after dosing for observation. Participants will be discharged after the principal investigator concludes that the participant is ready for discharge and prolongation of hospitalization is not necessary. Subsequent assessments in the primary study period (i.e., through Week 24) will be performed at Weeks 1, 2, 3, 4, 12, and 24. The Weeks 8 and 16 assessments will be limited to evaluation of adverse events (AEs) and concomitant therapies by telephone contact. After the primary study period, visits will be at Weeks 38, 52, 64, 78, and 104. The Week 30 visit will be performed only for participants who discontinue IV ERT starting at Week 24.

(453) Because of the brain growth that occurs in children and differences in brain growth that may occur in MPS II, the total dose of Construct 1 administered IC or ICV will be calculated from the estimated brain mass derived from the study participant's screening MRI. The study participant's estimated brain volume from their MRI will be converted to brain mass and used to calculate the exact dose to be administered, as presented in Table 12.

(454) TABLE-US-00029 TABLE 12 Total Dose Administered by Brain Mass Brain Mass (in g) Target Brain Mass Dose: Total GC Min Max (in g) (6.5 ? 10.sup.10 GC/g brain mass) 801 900 850 5.5 ? 10.sup.13 901 1050 975 6.3 ? 10.sup.13 1051 1200 1125 7.3 ? 10.sup.13 1201 1300 8.5 ? 10.sup.13 1. Obtain participant brain volume in cm.sup.3 from screening MRI. 2. Convert participant's MRI brain volume to brain mass: brain mass=(brain volume in cm.sup.3)?1.046 g/cm.sup.3 (brain density taken from (Hasgall et al, 2018, Tissue Properties, Density. [cited 4 Nov. 2019]. In: IT'IS Database for Thermal and Electromagnetic Parameters of Biological Tissues, Version 4.0, 15 May 2018 [Internet]. Zurich: IT'IS Foundation. c2010). 3. Identify appropriate dose in Table 12 above.

(455) Construct 1 is intended for investigational use only by selected investigators familiar with the information in the investigator's brochure for Construct 1 and experienced in conducting clinical trials. Construct 1 may only be administered to human participants enrolled in clinical trials sponsored/approved by the Sponsor and who have provided formal written consent.

(456) 6.9.5. Inclusion Criteria

(457) Participants are eligible to be included in the study only if all of the following criteria apply: 1. The participant's legal guardian(s) is (are) willing and able to provide written, signed informed consent after the nature of the study has been explained, and prior to any research-related procedures. 2. Is a male?5 years to <18 years of age 3. Meets any of the following criteria: a. Has a documented diagnosis of MPS II AND a neurocognitive testing score?1? standard deviation (SD) from the test normative mean (BSID-III: 77 and MSEL Visual Reception: 35), OR b. Has a documented diagnosis of MPS II AND has a decline of ?1 standard deviation on serial neurocognitive testing administered between 3 to 36 months apart (BSID-III Cognitive or MSEL Visual Reception), OR c. Has a relative clinically diagnosed with neuronopathic MPS II who has the same IDS mutation as the participant AND the participant in the opinion of a geneticist has inherited a neuronopathic form of MPS IL, OR d. Has documented mutation(s) in IDS that in the opinion of a geneticist is known to result in a neuronopathic phenotype AND in the opinion of a clinician has a neuronopathic form of MPS II

(458) 6.9.6. Exclusion Criteria

(459) Participants are excluded from the study if any of the following criteria apply: 1. Has a contraindication for an IC and ICV injection, including any of the following: a. Review of baseline MRI testing by the team of neuroradiologists/neurosurgeons participating in study shows a contraindication for an IC and an ICV injection b. History of prior head/neck surgery, which resulted in a contraindication to both IC and ICV injection, based on review of available information by the team of neuroradiologists/neurosurgeons participating in study c. Has any contraindication to general anesthesia d. Has any contraindication to MRI or gadolinium e. Has renal insufficiency as determined by an estimated glomerular filtration rate (eGFR)<30 mL/min/1.73 m.sup.2, based on creatinine. If laboratory determines that creatinine is less than the lower limit of assay validation or detection then the lowest limit cutoff value will be used to estimate eGFR. f. Has previously experienced a clinically significant intracranial bleed that, in the opinion of the investigator and team of neuroradiologists/neurosurgeons, is a contraindication to IC and ICV injection g. Has an elevated intracranial pressure (?30 cm H.sub.2O) 2. Has any condition that would contraindicate treatment with prednisone, tacrolimus or sirolimus 3. Has any neurocognitive deficit not attributable to MPS II or diagnosis of a neuropsychiatric condition that may in the opinion of the PI confound interpretation of study results 4. Has any contraindication to lumbar puncture 5. Has a (cerebral) ventricular shunt that in the opinion of the site neuroradiologist/neurosurgeon and through discussion with the Medical Monitor, may impact the administration and proper dosing of the participant 6. Has had prior treatment with an AAV-based gene therapy product 7. Is receiving idursulfase (ELAPRASE?) via intrathecal (IT) administration at the time of ICF. The participant must agree to discontinue IT idursulfase for the duration of the study, starting immediately after signing the ICF 8. Has received idursulfase (ELAPRASE?) IV and experienced a serious hypersensitivity reaction, including anaphylaxis, deemed related to IV idursulfase (ELAPRASE?) administration 9. Is failing to respond to idursulfase (ELAPRASE?) IV due to neutralizing anti-IDS antibodies, documented as increasing urine GAG levels; the participant may enroll if he has received immune modulation and is currently responsive to IV idursulfase (ELAPRASE?) 10. Has received any investigational product within 30 days of Day 1 or 5 half-lives before signing of the ICF, whichever is longer 11. Has any history of lymphoma or history of another cancer, other than squamous cell or basal cell carcinoma of the skin, that has not been in full remission for at least 1 year before screening 12. Has a platelet count<100,000 per microliter (?L) 13. Has aminotransferase (ALT) or aspartate aminotransferase (AST)>3?ULN or total bilirubin>1.5?ULN at screening unless the participant has a previously known history of Gilbert's syndrome 14. Has a history of human immunodeficiency virus (HIV) or hepatitis B or hepatitis C virus infection, or positive screening tests for hepatitis B surface antigen or hepatitis B core antibody, or hepatitis C or HIV antibodies 15. Is a first-degree family member of a clinical site employee or any other individual involved with the conduct of the study or is a clinical site employee or other individual involved with the conduct of the study 16. Has a clinically significant ECG abnormality that, in the opinion of the PI, would compromise the participant's safety 17. Has a serious or unstable medical or psychological condition that, in the opinion of the PI, would compromise the participant's safety in the study 18. Has uncontrolled seizures that in opinion of the PI would put the participant at undue risk 19. Has a history of a hypersensitivity reaction to tacrolimus, sirolimus, or prednisone 20. Has a history of a primary immunodeficiency (e.g., common variable immunodeficiency syndrome), splenectomy, or any underlying condition that predisposes the participant to infection 21. Has herpes zoster (VZV), cytomegalovirus (CMV), or Epstein-Barr virus (EBV) infection that has not completely resolved at least 12 weeks prior to screening 22. Has any infection requiring hospitalization or treatment with parenteral anti-infectives not resolved at least 8 weeks prior to Visit 2 23. Has any active infection requiring oral anti-infectives (including antivirals) within 10 days prior to Visit 2 24. Has a history of active tuberculosis (TB) or a positive Quantiferon-TB Gold test during screening 25. Has any live vaccine within 4 weeks prior to Day ?2 26. Had major surgery within 8 weeks before signing the ICF or major surgery planned during the study period 27. Anticipate the need for adenoidectomy or tonsillectomy within 6 months of enrollment. If adenoidectomy or tonsillectomy is anticipated, it should be performed prior to screening. 28. Has an absolute neutrophil count<1.0?10.sup.3/?L 29. Has any condition or laboratory abnormality that the PI believes would not be appropriate for immunosuppressive therapy.

(460) 6.9.7. Immunosuppressive Therapy

(461) Corticosteroids In the morning of vector administration (Day 1 pre-dose), participants will receive methylprednisolone 10 mg/kg IV (maximum of 500 mg) over at least 30 minutes. The methylprednisolone should be administered before the lumbar puncture and IC injection of IP. Premedication with acetaminophen and an antihistamine is optional and at the discretion of the investigator. On Day 2, oral prednisolone will be started with the goal to discontinue prednisolone by Week 12. The dose of prednisolone will be as follows: Day 2 to the end of Week 2: 0.5 mg/kg/day Week 3 and 4: 0.35 mg/kg/day Week 5-8: 0.2 mg/kg/day Week 9-12: 0.1 mg/kg Prednisolone will be discontinued after Week 12. The exact dose of prednisolone can be adjusted to the next higher clinically practical dose.

(462) Sirolimus 2 days prior to vector administration (Day ?2): a loading dose of sirolimus 1 mg/m.sup.2 every 4 hours?3 doses will be administered From Day ?1: sirolimus 0.5 mg/m.sup.2/day divided in twice a day dosing with target blood level of 1-3 ng/ml Sirolimus will be discontinued after the Week 48 visit.

(463) Tacrolimus Tacrolimus will be started on Day 2 (the day following IP administration) at a dose of 0.05 mg/kg twice daily and adjusted to achieve a blood level 2-4 ng/mL for 24 Weeks. Starting at Week 24 visit, tacrolimus will be tapered off over 8 weeks. At Week 24 the dose will be decreased by approximately 50%. At Week 28 the dose will be further decreased by approximately 50%. Tacrolimus will be discontinued at Week 32. Tacrolimus and sirolimus blood level monitoring will be conducted.

(464) Tacrolimus dose adjustments will be made to maintain whole blood trough concentrations within 2-4 ng/mL for the first 24 Weeks. At Week 24 the dose will be decreased by approximately 50%. At Week 28 the dose will be further decreased by approximately 50%. Tacrolimus will be discontinued at Week 32. Sirolimus dose adjustments will be made to maintain whole blood trough concentrations within 1-3 ng/mL. Dose adjustments should be performed by a clinical pharmacist. Participants should continue on the new maintenance dose for at least 7 to 14 days before further dosage adjustment with concentration monitoring.

(465) Immunosuppressant drug accountability, IS dispensation, sirolimus and tacrolimus whole blood trough concentrations will be completed by the investigator during routine study visits.

(466) No IS therapy is planned after Week 48. If IS were required after Week 48 to control a clinically-relevant immune response, the appropriate immunosuppressive regimen will be determined by the PI, in discussion with the Medical Monitor and Sponsor, as clinically indicated.

(467) Pneumocystis carinii pneumonia (PCP) prophylaxis with trimethoprim/sulfamethoxazole (Septra?; Bactrim?) (SEPTRA? USPI, 2018; BACTRIM? USPI, 2013) will be given three times a week (example dosing schedule; Monday, Wednesday, Friday) at a dose of 5 mg/kg beginning on Day ?2 and continuing until Week 48. Refer to the prescribing information for risks associated with trimethoprim/sulfamethoxazole use (BACTRIM? USPI, 2013). For patients with sulfa allergies, alternative medications can include pentamidine, dapsone, and atovaquone.

(468) Antifungal prophylaxis is to be initiated if the ANC is <500 mm.sup.3. The treatment regimen will be determined through local site standard of care in consultation with appropriate subspecialists.

(469) The concomitant use of Rapamune with a calcineurin inhibitor may increase the risk of calcineurin inhibitor-induced thrombotic microangiopathies. Thrombotic microangiopathies (TMA) are a group of disorders characterized by thrombocytopenia, microangiopathic hemolytic anemia, and variable organ system involvement.

(470) This may present severe thrombocytopenia (<30?10.sup.9/L), microangiopathic hemolytic anemia characterized by schistocytes on the blood smear, increased reticulocyte count (>120?10.sup.9/L), elevated lactate dehydrogenase level (LDH), and signs of skin and mucosal hemorrhage, weakness, and dyspnea. Treatment includes discontinuation of tacrolimus and possible initiation of plasma exchange.

(471) If rising CMV or EBV viral genomes are detected during serial testing, the decision to decrease IS or begin antiviral therapy will be determined through local site standard of care in consultation with appropriate subspecialists.

6.10 Example 10: A Phase I/II Multicenter, Open-Label Study to Evaluate the Safety, Tolerability, and Pharmacodynamics of Construct 1 in Pediatric Subjects with NIPS II (Hunter Syndrome)

(472) 6.10.1. Synopsis

(473) Study Design

(474) This is a Phase I/II, first-in-human, multicenter, open-label, single arm dose escalation study of Construct 1. No control group is included. Approximately 12 or 18 pediatric subjects (or up to 18 pediatric subjects) who have severe MPS II could be enrolled into 3 dose cohorts, 1.3?10.sup.10 GC/g brain mass (Dose 1), 6.5?10.sup.10 GC/g brain mass (Dose 2), 2.0?10.sup.11 GC/g brain mass (Dose 3; the number of genome copies was determined based on a Poly-A assay), or 2.9?10.sup.11 GC/g brain mass (Dose 3 EC; the number of genome copies was determined based on a transgene specific assay) and will receive a single dose of Construct 1 administered by IC or ICV injection. The Dose 3 Expanded Cohort (EC) receives 2.9?10.sup.11 GC/g brain mass (dose calculated using a transgene-specific assay), a dose equivalent to Dose 3, which was estimated using a PolyA-specific assay. In some cases, the effective dose for both Dose 3 and Dose 3 EC are the same. Safety will be the primary focus for the initial 24 weeks after treatment (primary study period). Following completion of the primary study period, subjects continue to be assessed (safety and efficacy) for up to a total of 104 weeks following treatment with Construct 1. At the end of the study, subjects will be invited to participate in a long-term follow-up study.

(475) The first 3 eligible subjects will be enrolled into the Dose 1 cohort (1.3?10.sup.10 GC/g brain mass). After Construct 1 administration to the first subject, there will be an 8-week observation period for safety. The Internal Safety Committee (ISC) will review the safety data obtained during the first 8 weeks of the study according to the ISC Charter (including data obtained during the Week 8 visit) for this subject, and if there are no safety concerns, the 2nd subject may be enrolled. The same process will be used to enroll the 3rd subject. Informed consent and screening activities for the next subject may proceed during the observation period for the preceding subject.

(476) If no safety review trigger (SRT) event is observed, all available safety data for the Dose 1 cohort obtained up to and including the Week 8 visit for the 3rd subject will be evaluated by the Independent Data Monitoring Committee (IDMC). If the decision is to proceed to the second dose cohort (6.5?10.sup.10 GC/g brain mass), the subsequent 2 subjects will follow the same dosing scheme as the initial dose cohort. The ISC will review all subject safety data obtained up to and including the Week 2 visit of the 2nd subject in the Dose 2 cohort and may determine that it is safe to proceed with dosing of the 3rd subject immediately after this assessment. All available safety data for the Dose 2 cohort will be evaluated by the IDMC after the Week 8 visit for the 3rd subject in the Dose 2 cohort.

(477) With approval of the IDMC, up to 6 subjects may be dosed in a Dose 2 Expanded Cohort as long as study drug is available, and there is Sponsor approval and no safety event that warrants suspension of enrollment as per either the ISC or the IDMC.

(478) If no safety review trigger (SRT) event is observed and the IDMC provides approval, a third dose cohort (2.0?10.sup.11 GC/g brain mass) will begin enrollment. In some cases, an additional Dose 3 Expanded Cohort (EC) receives 2.9?10.sup.11 GC/g brain mass. The ISC will review all available safety data for the first subject dosed up to and including the Week 8 visit. If there are no safety concerns, the second subject will be dosed. The ISC will review all subject safety data obtained up to and including the Week 2 visit of the 2.sup.nd subject in the Dose 3 cohort and may determine that it is safe to proceed with dosing of the 3.sup.rd subject immediately after this assessment.

(479) At any given IDMC meeting, whether planned at the conclusion of a dose cohort or called for by an SRT, the IDMC may recommend stopping the trial, dose additional subjects at the current dose, proceed to the next dose cohort, or proceed at a lower dose. Once 8 weeks of data are available from the subject of Dose 3 cohort, all safety data up to and including the 3.sup.rd subject's Week 8 visit will be evaluated by the IDMC. With approval of the IDMC, up to 3 additional subjects may be dosed in Dose 3 EC in a similarly staggered fashion: 8-week observation period with ISC review after first subject dosed, 2-week observation period after second subject dosed, IDMC review after data from the Week 8 visit of 3.sup.d subject becomes available.

(480) If any event meets the criteria of a Stopping Rule (refer to the table below), dosing of any new subjects will be suspended until a complete review of all safety data has been performed.

(481) TABLE-US-00030 Safety Review Trigger Event Safety Review Action Any of the following Stopping Dosing of any new subjects is suspended Rules is met until a complete review of all safety data Any death has been performed. Any Grade 4 or 5 AE, The IDMC provides a recommendation on regardless of relationship to whether to enroll additional subjects. treatment Two or more Grade 3 AEs in the same subject considered possibly or probably related to Construct 1, the administration procedure or IS (by the PI) ALT or AST ?3 ? ULN and total bilirubin ?2 ? ULN and no other reason can be found to explain the changes observed Any event of CNS hemorrhage, stroke, or acute paralysis that the PI considers to be related to either Construct 1 or the injection procedure Any Grade 3 AE An Internal Safety Committee (ISC) Any report by the PI of reviews all available safety data. If safety technical issues with the concerns arise while a cohort is enrolling, Construct I administration they may ask the IDMC to review and procedure that may warrant make a recommendation on whether to modifications to the procedure keep enrolling subjects in that cohort. or instruments

(482) The subjects who meet the eligibility criteria are admitted to the hospital between Day 2 and the morning of Day 1 (according to institutional practice), and baseline assessments are performed pre-dose. Subjects receive a single IC or ICV dose of Construct 1 on Day 1 and remain in the hospital overnight and for approximately 1-2 days after dosing for observation. Subjects are discharged after the principal investigator (PI) concludes that prolongation of hospitalization beyond two overnight stays is not necessary. Subsequent assessments in the primary study period (i.e., through Week 24) are performed weekly through Week 4 and at Weeks 8, 12, 16, 20, and 24. After the primary study period, visits are at Weeks 28, 32, 40, 48, 52, 56, 60, 64, 78, and 104. The Week 64 visit are performed only for subjects who discontinue IV ERT. The Week 20 and 28 assessments are limited to evaluation of adverse events (AEs) and concomitant therapies by telephone contact.

(483) Findings in non-human primates (NHPs) showed histological findings of dorsal root ganglion neuronopathy and associated axonopathy which were partially immune mediated as demonstrated by the presence of inflammatory cells in the DRG and partial attenuation of axonopathy by immunosuppression (IS). For these reasons, all subjects initially receive immune suppression (IS) in the study to minimize the risk of any immune mediated reaction against tissues expressing the transgene as well as minimize any risk associated with the formation or increase of antibodies to IDS which may decrease efficacy. The IS regimen include corticosteroids (methylprednisolone 10 mg/kg IV once on Day 1 predose and oral prednisone starting at 0.5 mg/kg/day on Day 2 with gradual tapering and discontinuation by Week 12), tacrolimus (0.05 mg/kg twice daily [BID] by mouth [PO] Day 2 to Week 24 with dose adjustments made to obtain a target blood level of 2-4 ng/ml and tapering over 8 weeks between Week 24 and 32) and sirolimus (a loading dose of 1 mg/m.sup.2 every 4 hours?3 doses on Day 2 and then from Day 1: sirolimus 0.5 mg/m.sup.2/day divided in BID dosing with target blood level of 1-3 ng/ml until Week 48). Neurologic assessments and tacrolimus/sirolimus blood level monitoring are conducted as per Table A. The doses of sirolimus and tacrolimus are adjusted to maintain blood levels in the target range

(484) No IS therapy is planned after Week 48. If IS were required after Week 48 to control a clinically relevant immune response, the appropriate immunosuppressive regimen is determined by the principal investigator (PI), in discussion with the Medical Monitor and Sponsor, as clinically indicated.

(485) Given the histopathological findings in the dorsal root ganglia and associated axonopathy observed in the nonclinical safety/toxicology studies and the potential safety risks with the IC administration procedure, close neurological monitoring, including focused neurological assessments and somatosensory evoked potential (SSEP) testing is employed as listed in Table A.

(486) If treatment with Construct 1 shows IDS activity in plasma, as suggested in animal studies, subjects who are on IV idursulfase (Elaprase?) may be offered the option to discontinue ERT after the Week 24 visit. The decision to discontinue ERT is at the clinical judgement of the PI and as agreed with the study sponsor. Additional information that may be useful for the decision to stop ERT are trough measurements (based on ERT dosing) of plasma I2S and plasma and urine GAGs up to the Week 24 visit, and measurement of the liver and spleen size by ultrasound. The Week 52, 56, 60, 64 and 78 visits include additional monitoring of the subject's plasma I2S and plasma and urine GAGs levels in subjects who elect to discontinue ERT. Subjects who discontinue IV ERT have an additional abdominal ultrasound at Weeks 32 and 64 to perform measurement of the liver and spleen size. IV ERT restarted if any of following criteria are met: increase in urinary GAGs levels 2 times above the level measured at the Week 24 visit, or an increase of liver diameter>20% above the Week 24 value, or any change in other safety parameters deemed by the internal safety committee and/or the IDMC to warrant a restart of IV ERT. However, subjects may restart ERT at any time, if deemed necessary by the PI.

(487) The safety and tolerability of Construct 1 is monitored through assessment of AEs and serious adverse events (SAEs), chemistry, hematology, urinalysis, markers of CSF inflammation, immunogenicity, vector shedding (vector concentration), vital signs, electrocardiograms (ECGs), SSEP testing, and physical examinations including neurological assessments. Serial PCR (polymerase chain reaction) for detection of circulating viral genomes (EBV and CMV) is performed while subjects are receiving IS according to the schedule in Table A.

(488) Efficacy assessments include measurements of levels of pharmacodynamic (PD) biomarkers (GAGs and I2S in CSF and plasma, and GAGs in urine), as well as on neurocognitive function, auditory capacity, brain MRI, liver and spleen size, and cardiac evaluation by echocardiogram. Neurocognitive or adaptive assessments performed as part of subjects' standard of care while participating in the trial may also be collected, as determined by the study sponsor after discussing with the site.

(489) Primary Objectives

(490) To evaluate the safety and tolerability of Construct 1 through 24 weeks following a single IC, or ICV if IC is contraindicated, dose administered to pediatric subjects who have severe MPS II. AEs and SAEs are determined trough week 24.

(491) Secondary Objectives To evaluate the long-term safety and tolerability of Construct 1. Safety through Week 104: AE reporting, laboratory evaluations, vital signs, ECGs, physical examinations, and neurologic assessments. To evaluate the effect of Construct 1 on biomarkers in CSF (GAGs, I2S), plasma (GAGs, I2S), and urine (GAGs) To evaluate the effect of Construct 1 on neurodevelopmental parameters of cognitive, behavioral, and adaptive function Bayley Scales of Infant and Toddler Development, 3rd Edition (BSID-III) (Bayley, 2005) or Kaufman Assessment Battery for Children, 2nd Edition (KABC-II) (Kaufman, 2004) Vineland Adaptive Behavior Scales, 2nd Edition, Expanded Interview Form (VABS-II) (Sparrow et al., 2005)

(492) To evaluate vector shedding in CSF, serum, and urine (e.g., by quantitative polymerase chain reaction (PCR) to Construct 1 deoxyribonucleic acid (DNA)).

(493) Exploratory Objectives To evaluate immunogenicity of Construct 1 (e.g., by determining antibody titers to AAV9 and I2S in CSF and serum; and/or by using enzyme-linked immunospot (ELISPOT) assay: T-cell response to AAV9 and I2S) To explore the effect of Construct 1 on CNS imaging. CNS structural abnormalities assessed by MRI of the brain Liver and spleen size assessed by ultrasound of the abdomen Cardiac evaluation by echocardiogram for valvular disease and left ventricular mass index To explore the effect of Construct 1 on systemic manifestations of disease To explore the effect of Construct 1 on auditory capacity. Auditory capacity changes measured by auditory brainstem response (ABR) and, if feasible, by behavioral audiometry. Tympanometry accompany both BAUD and ABR assessments To explore the effect of Construct 1 on biomarkers in plasma and urine in subjects who temporarily discontinue IV ERT (ELAPRASE?) To explore the effect of Construct 1 on quality of life (QOL) To explore the effect of Construct 1 on sleep measures (Ferreira et al., 2009) To explore the effect of Construct 1 on clinician reported outcome To explore the effect of Construct 1 on caregiver reported outcome Activities of Daily Living (Tanjuakio J., 2015; Kato et al., 2007) Burden of Illness

(494) Number of Subjects Planned and Study Duration:

(495) Up to 18 subjects are enrolled. For example, 3 subjects in Dose 1 cohort; 3 subjects in Dose 2 cohort and up to 6 subjects in Dose 2 Expanded Cohort; 3 subjects in Dose 3 cohort and up to 3 subjects in Dose 3 Expanded Cohort. Total dose administered (total GC) is adjusted to account for differences in brain mass as estimated from each subject's screening MRI. A transgene-specific PCR assay for vector quantification of Construct 1 results in a different number of genome copies than a Poly-A PCR assay for the same dose (refer to Table B). In some cases, a transgene specific PCR assay is implemented to quantify the product concentration and dose. When testing the same Construct 1 samples, the transgene-specific PCR assay results in values approximately 50% higher than the dose obtained from a Poly-A PCR assay. Therefore, a dose of 2.0?10.sup.11 GC/g using the Poly-A PCR assay for calculating the number of genome copies is equivalent to a dose of 2.9?10.sup.11 GC/g using the transgene specific PCR assay for calculating the number of genome copies. The total volume of product administered does not exceed 10% of the total CSF volume (estimated to be ?50 mL in infant brain and ?150 mL in adult brain). The IDMC may recommend adding additional subjects in any dose cohort. In some cases, the total duration of the study is 104 weeks post-dose with a primary safety evaluation time point of 24 weeks. Screening may take up to 35 days.

(496) TABLE-US-00031 TABLE B Construct 1 Dose Cohorts (Total GC/g brain mass) Dose level Poly-A PCR Assay Transgene-Specific PCR Assay 1 1.3 ? 10.sup.10 1.9 ? 10.sup.10 2 6.5 ? 10.sup.10 9.6 ? 10.sup.10 3 2.0 ? 10.sup.11 2.9 ? 10.sup.11

(497) Diagnosis and Main Criteria for Inclusion:

(498) To be eligible to participate in this study, a subject must meet all the following inclusion criteria: 1. The subject's legal guardian(s) is (are) willing and able to provide written, signed informed consent after the nature of the study has been explained, and prior to any research-related procedures. 2. Is a male?4 months to <5 years of age 3. Meets any of the following criteria: a) Has a documented diagnosis of MPS II AND has a neurocognitive testing score?77 (BSID-III or KABC-II), OR b) Has a documented diagnosis of MPS II AND has a decline of ?1 standard deviation on serial neurocognitive testing administered between 3 to 36 months apart (BSID-III or KABC-II), OR c) Has a relative clinically diagnosed with severe MPS II who has the same IDS mutation as the subject AND the subject in the opinion of a geneticist has inherited a severe form of MPS II, OR d) Has documented mutation(s) in IDS that in the opinion of a geneticist is always known to result in a neuronopathic phenotype [e.g., a complete deletion or large deletion (e.g., spanning?1 exon), or recombination] AND in the opinion of a clinician has a severe form of MPS II 4. Has sufficient auditory and visual capacity, with or without aids, to complete the required protocol testing, and be compliant with wearing the aid, if applicable, on testing days

(499) Diagnosis and Main Criteria for Exclusion:

(500) Subjects who meet any of the following exclusion criteria will not be eligible to participate in the study: 1. Has a contraindication for an IC or ICV injection, including any of the following: a) Review of baseline MRI testing by the team of neuroradiologists/neurosurgeons participating in study (1 neuroradiologist or neurosurgeon per site) shows a contraindication for an IC or an ICV injection b) History of prior head/neck surgery, which resulted in a contraindication to both IC and ICV injection, based on review of available information by the team of neuroradiologists/neurosurgeons participating in study c) Has any contraindication to computed tomography, contrast agent, or to general anesthesia d) Has any contraindication to MRI or gadolinium e) Has renal insufficiency as determined by an estimated glomerular filtration rate (eGFR)<30 mL/min/1.73 m2, based on creatinine. If laboratory determines that creatinine is less than the lower limit of assay validation or detection then the lowest limit cutoff value will be used to estimate eGFR f) Has previously experienced a clinically significant intracranial bleed that, in the opinion of the investigator and team of neuroradiologists/neurosurgeons, is a contraindication to IC and ICV injection 2. Has any condition that would contraindicate treatment with prednisone, tacrolimus or sirolimus 3. Has any neurocognitive deficit not attributable to MPS II or diagnosis of a neuropsychiatric condition that may in the opinion of the PI confound interpretation of study results 4. Has any contraindication to lumbar puncture 5. Has a (cerebral) ventricular shunt that in the opinion of the site neuroradiologist/neurosurgeon and through discussion with the Medical Monitor, may impact the administration and proper dosing of the subject 6. Has undergone HSCT 7. Has had prior treatment with an AAV-based gene therapy product 8. Has received idursulfase (ELAPRASE?) via intrathecal (IT) administration within 4 months of signing the ICF 9. Has received idursulfase (ELAPRASE?) IV and experienced a serious hypersensitivity reaction, including anaphylaxis, deemed related to IV idursulfase (ELAPRASE?) administration. If currently receiving IV idursulfase and has had dose interruptions or a dose regimen different than weekly, then discussion with REGENXBIO Medical Monitor is needed. 10. Has received any investigational product within 30 days of Day 1 or 5 half-lives before signing of the ICF, whichever is longer 11. Has any history of lymphoma or history of another cancer, other than squamous cell or basal cell carcinoma of the skin, that has not been in full remission for at least 1 year before screening 12. Has a platelet count<100,000 per microliter (?L) 13. Has aminotransferase (ALT) or aspartate aminotransferase (AST)>3?ULN or total bilirubin>1.5?ULN at screening unless the subject has a previously known history of Gilbert's syndrome 14. Uncontrolled hypertension despite medical treatment, defined for children?17 years of age to be systolic blood pressure or diastolic blood pressure>99th percentile plus 5 mmHg based on normative standards for age, sex, and height 15. Has a history of human immunodeficiency virus (HIV) or hepatitis B or hepatitis C virus infection, or positive screening tests for hepatitis B surface antigen or hepatitis B core antibody, or hepatitis C or HIV antibodies 16. Is a first-degree family member of a clinical site employee or any other individual involved with the conduct of the study or is a clinical site employee or other individual involved with the conduct of the study 17. Has a clinically significant ECG abnormality that, in the opinion of the PI, would compromise the subject's safety 18. Has a serious or unstable medical or psychological condition that, in the opinion of the PI, would compromise the subject's safety or successful participation in the study or interpretation of study results 19. Has uncontrolled seizures that in opinion of the PI would put the subject at undue risk

(501) Exclusion Criteria Related to Immunosuppressive Therapy: 20. Has a history of a hypersensitivity reaction to tacrolimus, sirolimus, or prednisone 21. Has a history of a primary immunodeficiency (e.g., common variable immunodeficiency syndrome), splenectomy, or any underlying condition that predisposes the subject to infection 22. Has herpes zoster (VZV), cytomegalovirus (CMV), or Epstein-Barr virus (EBV) infection that has not completely resolved at least 12 weeks prior to screening 23. Has any infection requiring hospitalization or treatment with parenteral anti-infectives not resolved at least 8 weeks prior to Visit 2 24. Has any active infection requiring oral anti-infectives (including antivirals) within 10 days prior to Visit 2 25. Has a history of active tuberculosis (TB) or a positive Quantiferon-TB Gold test during screening 26. Has received any live vaccine within 4 weeks prior to Day 2 27. Had major surgery within 8 weeks before signing the ICF or major surgery planned during the study period 28. Anticipate the need for adenoidectomy or tonsillectomy within 6 months of enrollment. If adenoidectomy or tonsillectomy is anticipated it should be performed prior to screening. 29. Has an absolute neutrophil count<1.0?10.sup.1/?L 30. Has any condition or laboratory abnormality that the PI believes would not be appropriate for immunosuppressive therapy

Size and Power Calculation

(502) Three to nine subjects at each dose cohort and up to 18 subjects are enrolled to assess the safety and tolerability of Construct 1 and explore the effect of Consruct 1 across 3 dose levels on biomarkers and clinical efficacy endpoints.

(503) TABLE-US-00032 TABLE A Study Flow Chart: Schedule of Events Gene Therapy Study Inpatient Interval Screening Administration Visits (Weeks) Study Visit Number 1 2.sup.a 3 4 5 6 7 8 9 10 11 12 13 15 16 17 18 19 20 21 EOS/22 ET.sup.b Uns.sup.c Study Visit Window (Days) ?3 ?3 ?3 ?3 ?3 ?3 ?7 ?7 ?7 ?7 ?7 ?7 ?7 ?14 ?14 ?14 ?14 ?14 ?14 Study Day or Week D ?35 to ?2 D ?2 D1 (Pre) D1 (Post).sup.d D2.sup.e 1 2 3 4 8 12 16 20.sup.g 24 28.sup.g 32 40 48 52 56 60 64.sup.f 78 104 General Procedures and Assessments Informed Consent X.sup.y Confirm Eligibility X X Medical History X X X Concomitant Medications X X X X X X X X X X X X X X X X X X X X X X X X X Physical Examination.sup.h X X X X X X X X Targeted Physical Examination.sup.h X X X X X X X X X X X X X X X X.sup.i Neurologic Assessment.sup.h X X X X X X X X X X X X Anesthesiologist Examination.sup.j X X Somatosensory Evoked Potentials.sup.k X X X X X Vital Signs X X X X X X X X X X X X X X X X X X X X X X X X Height, Weight, and Head Circumference X X X X X X X X X ECG X X X Renal Function.sup.kk X IC/ICV Administration Evaluation.sup.l X X Head/Neck MRI.sup.m X X X X Abdominal ultrasound.sup.p X X X.sup.p X X.sup.p 2-D Echocardiogram X X X Adverse Events X X X X X X X X X X X X X X X X X X X X X X X X X X.sup.i Genetic testing.sup.n X Auditory capacity testing.sup.m X X X X Clinical Laboratory Assessments Hematology X X X X X X X X X X X X X X.sup.i Chemistry X X X X X X X X X X X X X X Lipid Panel X X X X QuantiFERO N-TB Gold X Urinalysis X X X X X X X X PT/PTT/INR X X Hep B sAg/Hep B Core Antibody/Hep C/HIV X ELISPOT Assay; T-Cell Response to AAV9 X X X X X X X X Vector and 12S Plasma Biomarkers.sup.o X X X X X X X X X X.sup.p X.sup.p X.sup.p X.sup.p X.sup.p X X Serum Immune Response Monitoring.sup.q X X X X X X X X X Urine Biomarkers.sup.i X X X X X X X X X X X X X.sup.p X.sup.p X.sup.p X.sup.p X.sup.p X X Viral testing.sup.z X X X X X X X X X Vector Concentration (qPCR to Construct 1 X X X X X X DNA) in Serum and Urine Future Use Research Sample X X X X X X Construct 1 Administration (CT-Guided) Construct 1 Administration.sup.s X Immunosuppression Therapy.sup.t Dispense Prednisone (QD PO Day 2 to Week X X X 12 Visits) Methylprednisolone (IV Day X Dispense Tacrolimus (PO BID Day 2 to Week X X X X X 24 Visits) Dispense Sirolimus (Day ?2 until Week 48 X X X X X X X X Visits) Dispense Sulfamethoxazole/Trimethoprim X X X X X X X X (Day ?2 until Week 48 Visits) Immunosuppressant Drug Accountability X X X X X X X X Tacrolimus Whole Blood Levels X X X X X X X X.sup.i Sirolimus Whole Blood Levels X X X X X X X X X X.sup.i CSF Laboratory Assessments Lumbar Puncture X.sup.u X.sup.u X X X X X X CSF Biomarkers.sup.v X X X X X X X X CSF Safety Laboratory.sup.w X X X X X X CSF Immune Response Monitoring.sup.q X X X X X X Vector Concentration (qPCR to Construct 1 X X X DNA) in CSF Neurocognitive Assessments Cognitive Testing.sup.k X X X X X X X Adaptive & Behavioral Function Testing.sup.x,aa X X X X X X X X X Clinical Assessment of Disease.sup.bb X X X X X X X X X X X X X X X X Caregiver Assessment of Disease.sup.aa X X X X X X X X X X X X X X X X PedsQL.sup.aa X X X X X X X Sleep Assessment.sup.aa X X X X X X X X Activities of Daily Living.sup.aa X X X X X X Burden of Illness Survey.sup.aa X X X AAV9 = Adeno-associated virus vector of serotype 9; ABR = auditory brainstem response; CSF = cerebrospinal fluid; CT = computed tomography; DNA = deoxyribonucleic acid; ECG = electrocardiogram; ELISPOT = enzyme-linked immunospot; EOS = end of study; ERT = enzyme replacement therapy; ET = early termination; GAG = glycosaminoglycan; Hep = hepatitis; HIV = human immunodeficiency virus; IC = intracisternal; ICV = Intracerebroventricular, INR= International Normalized Ratio; IQ = intelligence quotient; IT = intrathecally; IV = intravenous; MRI = magnetic resonance imaging; PI = principal investigator; PO = orally; PT = prothrombin time; PTT = partial thromboplastin time; QD = once daily; qPCR = quantitative polymerase chain reaction; Construct 1 = Recombinant adeno-associated virus serotype 9 capsid containing human iduronate-2-sulfatase expression cassette; sAg = surface antigen; T cell = T lymphocyte. Visit 14 is deliberately omitted from the visit numbering scheme. .sup.aSites can admit the subject between Day ?2 and the morning of Day 1. Therefore, some of the pre-dose testing can be done on Day ?2 or on Day ?1, as per institution's standards. .sup.bFor an ET visit, lumbar puncture (and CSF assessments) is performed only if withdrawal occurs before Week 56 and cognitive function assessment is performed only if withdrawal occurs before Week 48. .sup.cThe Investigator, in consultation with the Medical Monitor, should determine which assessments need to be performed at an unscheduled visit. .sup.dVital signs and neurologic assessments are monitored frequently, including assessments every 45 ? 10 minutes for 3 hours starting in the post-anesthesia care unit, then hourly ?15 minutes for the next 4 hours, and then every 4 hours ?30 minutes for the remainder of the 24-hour period immediately post-dose. .sup.eSubjects can be discharged home approximately 1-2 days after dosing if deemed appropriate by the PI. Subjects/caregivers are to receive instructions on neurologic function monitoring. .sup.fWeek 64 visit is to be performed only for subjects who discontinue IV ERT. .sup.gWeek 20 and 28 assessments, italicized in the table, will be limited to evaluation of adverse events and concomitant therapies by telephone contact. .sup.hPre-dose neurologic assessment can be performed any time from Day ?2 to Day 1. .sup.iIf clinically indicated. .sup.jPerformed according to each institution's standards and may be performed prior to Day 1. .sup.kResults should be assessed or reviewed by a neurologist. .sup.kkEstimated glomerular filtration rate (eGFR) based on creatinine must be measured prior to screening MRI with gadolinium. If laboratory determines that creatinine is less than the lower limit of assay validation or detection then the lowest limit cutoff value will be used to estimate eGFR. The investigator must consult with the Medical Monitor before proceeding with MRI if the eGFR is <30 mL/min/1.73 m.sup.2. .sup.lAssessments to evaluate contraindication to IC or ICV injection is performed according to the appropriate Administration Manual and be completed prior to Day ?2. Approval to proceed with the IC or ICV injection has to be documented before starting IS on Day ?2. .sup.mMRI with gadolinium is performed as a screening assessment only. All attempts should be made to perform MRI following confirmation of neurocognitive scores. If an MRI under sedation occurs prior to neurocognitive testing, then there must be at least 24 hours between the time of the MRI and when the neurocognitive testing can be performed. .sup.nGenetic confirmation of MPS type 2. Genetic test done prior to the study is acceptable with adequate documentation. Subject with no prior genetic testing can have it done during screening. .sup.nnAuditory capacity changes are measured by auditory brainstem response (ABR) and, if possible, behavioral audiometry (BAUD). Tympanometry is done at the time BAUD and/or ABR assessments are completed. Auditory capacity are assessed at visits specified in this Schedule of Events; an additional assessment is permitted at the Week 24 visit if deemed clinically necessary by the investigator. .sup.oPlasma biomarkers: samples are taken for GAGs and I2S. All attempts should be made to perform I2S assessments at trough in relation to IV ERT, defined as at least 96 hours after ERT infusion up until the start of the subsequent infusion. .sup.pAbdominal ultrasound are done to assess the size of the liver and spleen. For subjects who have ERT withdrawn after Week 24, plasma and urine biomarkers are to be drawn. The abdominal ultrasound is performed at the same facility for every timepoint. .sup.qAntibodies to AAV9 and I2S. .sup.rUrine biomarkers: samples are taken for GAGs. All attempts should be made to collect urine GAGs at trough in relation to IV ERT, defined as at least 96 hours after ERT infusion up until the start of the subsequent infusion. .sup.sIC or ICV injection are performed according to the appropriate Administration Manual. .sup.tTacrolimus: dose adjustments are made to maintain whole blood trough concentrations within 2-4 ng/ml Sirolimus: dose adjustments are made to maintain whole blood trough concentrations within 1-3 ng/mL. Subjects should continue the new maintenance dose for at least 7-14 days before further dosage adjustment with concentration monitoring. The methylprednisolone should be administered before the lumbar puncture and IC or ICV injection of the investigational product. Pre-medication with acetaminophen and an antihistamine is optional, at the discretion of the investigator. .sup.uThe screening (Day ?35 to Day ?2) lumbar puncture is for assessment of CSF pressure and biomarkers only. Following the Day 1 pre-dose lumbar puncture, iodinated myelographic contrast are administered IT (see Administration Manual). .sup.vCSF biomarkers: samples are taken for GAGs and I2S, and future use sample testing are only conducted from remnants of study samples, if available. .sup.wCSF safety laboratory tests: CSF pressure, erythrocyte cell count, white blood cell count with differential, total protein, and glucose. .sup.xCognition is assessed using BSID-III or KABC-II; adaptive function using VABS-II. If an MRI under sedation occurs prior to neurocognitive testing, then there must be at least 24 hours between the time of the MRI and when the neurocognitive testing can be performed. .sup.zFor VZV: Ab titer at baseline. For EBV and CMV: Viral genome PCR at baseline and serial testing as described in able X. If positive at any timepoint then more frequent testing can be performed as per site standard of care. .sup.yIf a subject has a relative with the same MPS II mutation, separate informed consent to review appropriate relative documentation is provided. .sup.aaTo be completed by same caregiver throughout study if possible. .sup.bbTo be completed by same clinician throughout study if possible.

(504) Investigational Product

(505) Construct 1: AAV9.CB7.hIDS (recombinant adeno-associated virus serotype 9 capsid containing human iduronate-2-sulfatase expression cassette). See FIG. 5.

(506) Dose

(507) Construct 1 will be preferentially administered as a single IC injection, or as a single ICV injection should IC administration prove difficult or potentially unsafe, to allow direct delivery of the vector to the target tissue within the confined CSF compartment. Although cervical puncture (C1-C2) is a routine clinical procedure used for contrast administration for myelography, image-assisted suboccipital puncture is proposed as the IC clinical route of administration. This replicates the route of administration used in the nonclinical studies and is considered advantageous over the C1-C2 puncture in the intended patient population because patients with MPS II have a high incidence of abnormal narrowing of the C1-C2 IT space, which substantially increases the risks associated with a C1-C2 puncture. Prior to the procedure, each subject will have a magnetic resonance imaging (MRI) of the area reviewed by a team of neuroradiologists/neurosurgeons participating in the study. If it is not considered safe to proceed with an IC injection, then the subject will be considered for ICV injection.

(508) TABLE-US-00033 TABLE 13 Total Dose Administered by Brain Mass Dose Levels Dose 1 Dose 2 Total GC Total GC by Poly-A- by Poly-A- specific specific PCR PCR Brain Mass (in g) (1.3 ? 10.sup.10 GC/g (6.5 ? 10.sup.10 GC/g Min Max Target brain mass) brain mass) 700 650 8.5 ? 10.sup.12 4.2 ? 10.sup.13 701 800 750 9.8 ? 10.sup.12 4.9 ? 10.sup.13 801 900 850 1.1 ? 10.sup.13 5.5 ? 10.sup.13 901 1050 975 1.3 ? 10.sup.13 6.3 ? 10.sup.13 1051 1200 1125 1.5 ? 10.sup.13 7.3 ? 10.sup.13 1201 1300 1.7 ? 10.sup.13 8.5 ? 10.sup.13 Total Dose Administered by Brain Mass Dose 3 Dose 3 Total GC by Poly-A-specific PCR Brain Mass (in g) (2.0 ? 10.sup.11 GC/g brain Min Max Target mass) 474 450 9.0 ? 10.sup.13 475 524 500 1.0 ? 10.sup.14 525 574 550 1.1 ? 10.sup.14 575 624 600 1.2 ? 10.sup.14 625 674 650 1.3 ? 10.sup.14 675 724 700 1.4 ? 10.sup.14 725 774 750 1.5 ? 10.sup.14 775 824 800 1.6 ? 10.sup.14 825 874 850 1.7 ? 10.sup.14 875 924 900 1.8 ? 10.sup.14 925 974 950 1.9 ? 10.sup.14 975 1024 1000 2.0 ? 10.sup.14 1025 1074 1050 2.1 ? 10.sup.14 1075 1124 1100 2.2 ? 10.sup.14 1125 1174 1150 2.3 ? 10.sup.14 1175 1224 1200 2.4 ? 10.sup.14 1225 1274 1250 2.5 ? 10.sup.14 1275 >1300 1300 2.6 ? 10.sup.14 Total Dose Administered by Brain Mass Dose 3 EC Dose 3 EC Total GC by Transgene ddPCR (Conversion factor: Transgene Brain Mass (in g) ddPCR = Poly-A ddPCR ? 1.48) Min Max Target (2.9 ? 10.sup.11 GC/g brain mass) 474 450 1.3 ? 10.sup.14 475 524 500 1.5 ? 10.sup.14 525 574 550 1.6 ? 10.sup.14 575 624 600 1.8 ? 10.sup.14 625 674 650 1.9 ? 10.sup.14 675 724 700 2.1 ? 10.sup.14 725 774 750 2.2 ? 10.sup.14 775 824 800 2.4 ? 10.sup.14 825 874 850 2.4 ? 10.sup.14 875 924 900 2.6 ? 10.sup.14 925 974 950 2.8 ? 10.sup.14 975 1024 1000 2.9 ? 10.sup.14 1025 1074 1050 3.1 ? 10.sup.14 1075 1124 1100 3.2 ? 10.sup.14 1125 1174 1150 3.4 ? 10.sup.14 1175 1224 1200 3.5 ? 10.sup.14 1225 1274 1250 3.7 ? 10.sup.14 1275 >1300 1300 3.8 ? 10.sup.14 1. Obtain subject brain volume in cm3 from screening MRI. 2. Convert subject's MRI brain volume to brain mass: 3. brain mass=(brain volume in cm.sup.3)?1.046 g/cm.sup.3 (brain density taken from Hasgall et al, 2018, Tissue Properties, Density. [cited 4 Nov. 2019]. In: IT'IS Database for Thermal and Electromagnetic Parameters of Biological Tissues, Version 4.0, 15 May 2018 [Internet]. Zurich: IT'IS Foundation. c2010). 4. Identify appropriate dose in Table 13 above.

(509) Construct 1 is intended for investigational use only by selected investigators familiar with the information in the investigator brochure for Construct 1 and experienced in conducting clinical trials. Construct 1 may only be administered to human subjects participating in clinical trials sponsored/approved by the Sponsor and who have provided formal written consent.

(510) 6.10.2. Criteria for Evaluation Safety and Efficacy

(511) Primary Endpoints Safety through Week 24: AEs and SAEs

(512) Secondary Endpoints Safety through Week 104: AEs and SAEs Biomarkers in CSF (GAGs, I2S), plasma (GAGs, I2S), and urine (GAGs) Neurodevelopmental parameters of cognitive, behavioral, and adaptive function: Bayley Scales of Infant and Toddler Development, 3rd Edition (BSID-III) (Bayley, 2005, Scales of Infant and Toddler Development, 3rd Ed.) Vineland Adaptive Behavior Scales, 2nd Edition, Expanded Interview Form (VABS-II) (Sparrow et al., 2005, Vineland Adaptive Behavior Scales, 2nd Ed.) Vector concentration in CSF, serum, and urine by quantitative polymerase chain reaction (PCR) to Construct 1 DNA

(513) Exploratory Endpoints Immunogenicity measurements Neutralizing antibody titers to AAV9 and binding antibody titers to I2S in CSF and serum Enzyme-linked immunospot (ELISPOT) assay: T-cell response to AAV9 and I2S Flow cytometry: AAV9 and I2S-specific regulatory T cells CNS structural abnormalities assessed by MRI of the brain Liver and spleen size assessed by ultrasound of the abdomen Cardiac evaluation by echocardiogram for valvular disease and left ventricular mass index Auditory capacity changes measured by auditory brainstem response (ABR) testing or behavioral audiometry and otoacoustic emissions testing Plasma and urinary GAGs in subjects who temporarily discontinue IV ERT (ELAPRASE?) PedsQL Sleep assessment (Ferreira et al., 2009, Sleep Medicine; 10(4):457-463) Clinical Assessment of Disease Caregiver Assessment of Disease Activities of Daily Living (ADL) (Tanjuakio et al. 2015, Mol Genet Metab, 114(2):161-169: Kato et al., 2007, Brain Dev, 29(5): 298-305) Burden of Illness

(514) 6.10.3. List of Abbreviations and Definitions of Terms

(515) TABLE-US-00034 TABLE 14 Abbreviations and Specialist Terms Abbreviation Term AAV Adeno-associated virus AAV9 AAV vector of serotype 9 ABR Auditory brainstem response(s) ADL Activities of Daily Living AE(s) Adverse event(s) AESI Adverse Event(s) of Special Interest ALP Alkaline phosphatase ALT Alanine aminotransferase ANC Absolute neutrophil count AST Aspartate aminotransferase BBB Blood-brain barrier BID Twice a day BP Blood pressure BSID Bayley Scales of Infant and Toddler Development BSL Biosafety level CB7 Hybrid C4 and CB (chicken beta actin promoter) CBC Complete blood count cDNA Consensus DNA CFC Contextual fear conditioning CFR Code of Federal Regulations CI Confidence interval CMV Cytomegalovirus CNS Central nervous system CoA Certificate of analysis CRF Case Report Form CSF Cerebrospinal fluid CT Computed tomography CTA Clinical Trial Agreement CTCAE Common Terminology Criteria for Adverse Events CZ Crystal Zenith? ddPCR Digital droplet polymerase chain reaction DLT(s) Dose-limiting toxicity(ies) DNA Deoxyribonucleic acid DRG Dorsal root ganglia DS Dermatan sulfate EBV Epstein-Barr virus ECG Electrocardiogram EDC Electronic Data Capture eGFR Estimated glomerular filtration rate ELISA Enzyme-Linked Immunosorbent Assay ELISPOT Enzyme-linked immunospot EOS End of Study ERT Enzyme replacement therapy ET Early Termination FDA US Food and Drug Administration g gram GAG(s) Glycosaminoglycan(s) GAN Giant Axonal Neuropathy GC Genome copies GCP Good Clinical Practice GLP Good Laboratory Practice GM3 Monosialodihexosylganglioside HD High dose HDL High-density lipoprotein Hep Hepatitis Hex Hexosaminidase hIDS Human iduronate-2-sulfatase HIPAA Health Insurance Portability and Accounting Act HIV Human immunodeficiency virus HS Heparan sulfate HSCT Hematopoietic stem cell transplantation I2S Iduronate-2-sulfatase IB Investigator's Brochure IC Intracisternal(ly) ICF Informed Consent Form ICH International Council for Harmonisation ICV Intracerebroventricular IDMC Independent Data Monitoring Committee IDS Iduronate-2-sulfatase gene IEC(s) Independent Ethics Committee(s) IgG Immunoglobulin G IND Investigation New Drug IP Investigational product IQ Intelligence quotient IRB Institutional Review Board IS Immune suppression/immunosuppression ISC Internal Safety Committee IT Intrathecal(ly) ITR(s) Inverted terminal repeat(s) IV Intravenous(ly) KABC Kaufman Assessment Battery for Children KIDS Kinder Infant Development Scale KSPD Kyoto Scale of Psychological Development LD Low dose LDH Lactate dehydrogenase LDL Low-density lipoprotein LIMP2 Lysosomal membrane protein MED Minimum effective dose MedDRA Medical Dictionary of Regulatory Activities mL milliliter MMF Mycophenolate mofetil MPS I Mucopolysaccharidosis type I MPS II Mucopolysaccharidosis type II MPS III Sanfilippo syndrome MPS VII Mucopolysaccharidosis type VII MRI Magnetic resonance imaging MTD Maximum tolerated dose mTORC1 Mammalian/mechanistic target of rapamycin complex 1 N Number in sample NAb Neutralizing antibody NAGLU N-acetyl-alpha-glucosaminidase NCI National Cancer Institute NHP(s) Non-human primate(s) NIH National Institutes of Health NOAEL No-observable-adverse-effect level NOR Novel object recognition PBMC(s) Peripheral blood mononuclear cell(s) PCR Polymerase chain reaction PCP Pneumocystis carinii pneumonia PD Pharmacodynamic(s) PgP P-glycoprotein PI Principal Investigator PML Progressive multifocal leukoencephalopathy PNS Peripheral nervous system PO By mouth/orally PT Prothrombin time or Preferred Term PTT Partial thromboplastin time PVAN Polyoma virus-associated nephropathy QD Daily QOL Quality of Life qPCR Quantitative polymerase chain reaction RBC Red blood cell RG1 Risk Group 1 Construct 1 Recombinant adeno-associated virus serotype 9 capsid containing human iduronate-2-sulfatase expression cassette SAE(s) Serious adverse event(s) SAP Statistical analysis plan SDV Source document verification SMA Spinal Muscular Atrophy SOC System Organ Class SRT Safety review trigger SSEP Somatosensory evoked potential TB Tuberculosis TEAE(s) Treatment-emergent adverse event(s) TMA Thrombotic microangiopathy TPP Thrombocytopenia purpura Treg Regulatory T cell ULN Upper limit of normal US United States USMs Urgent safety measures VABS Vineland Adaptive Behavior Scales VZV Varicella zoster virus WBC White blood cell (count) WHO World Health Organization

(516) 6.10.4. Immunosuppressive Therapy

(517) Corticosteroids In the morning of vector administration (Day 1 pre-dose), participants will receive methylprednisolone 10 mg/kg IV (maximum of 500 mg) over at least 30 minutes. The methylprednisolone should be administered before the lumbar puncture and IC injection of IP. Premedication with acetaminophen and an antihistamine is optional and at the discretion of the investigator. On Day 2, oral prednisolone will be started with the goal to discontinue prednisolone by Week 12. The dose of prednisolone will be as follows: Day 2 to the end of Week 2: 0.5 mg/kg/day Week 3 and 4: 0.35 mg/kg/day Week 5-8: 0.2 mg/kg/day Week 9-12: 0.1 mg/kg Prednisolone will be discontinued after Week 12. The exact dose of prednisolone can be adjusted to the next higher clinically practical dose. Note: Prednisolone may be substituted for prednisone in a 1:1 conversion rate, at the discretion of the investigator.

(518) Sirolimus 2 days prior to vector administration (Day ?2): a loading dose of sirolimus 1 mg/m.sup.2 every 4 hours?3 doses will be administered From Day ?1: sirolimus 0.5 mg/m.sup.2/day divided in twice a day dosing with target blood level of 1-3 ng/ml Sirolimus will be discontinued after the Week 48 visit.

(519) Tacrolimus Tacrolimus will be started on Day 2 (the day following IP administration) at a dose of 0.05 mg/kg twice daily and adjusted to achieve a blood level 2-4 ng/mL for 24 Weeks. Starting at Week 24 visit, tacrolimus will be tapered off over 8 weeks. At Week 24 the dose will be decreased by approximately 50%. At Week 28 the dose will be further decreased by approximately 50%. Tacrolimus will be discontinued at Week 32. Tacrolimus and sirolimus blood level monitoring will be conducted.

(520) Prednisone dosing will start at 0.5 mg/kg/day and will be gradually tapered off by the Week 12 visit.

(521) Tacrolimus dose adjustments will be made to maintain whole blood trough concentrations within 2-4 ng/mL for the first 24 Weeks. At Week 24, the dose will be decreased by approximately 50%. At Week 28, the dose will be further decreased by approximately 50%. Tacrolimus will be discontinued at Week 32. Sirolimus dose adjustments will be made to maintain whole blood trough concentrations within 1-3 ng/mL. Dose adjustments should be performed by a clinical pharmacist. Subjects should continue on the new maintenance dose for at least 7 to 14 days before further dosage adjustment with concentration monitoring.

(522) Pneumocystis carinii pneumonia (PCP) prophylaxis with trimethoprim/sulfamethoxazole (Bactrim?; BACTRIM? USPI, 2013) will be given three times a week (example dosing schedule; Monday, Wednesday, Friday) at a dose of 5 mg/kg beginning on Day ?2 and continuing until Week 48. Refer to the prescribing information for risks associated with trimethoprim/sulfamethoxazole use (BACTRIM? USPI, 2013). For patients with sulfa allergies, alternative medications can include pentamidine, dapsone, and atovaquone.

(523) Antifungal prophylaxis is to be initiated if the ANC is <500 mm.sup.3. The treatment regimen will be determined through local site standard of care in consultation with appropriate subspecialists.

(524) The concomitant use of Rapamune with a calcineurin inhibitor may increase the risk of calcineurin inhibitor-induced thrombotic microangiopathies. Thrombotic microangiopathies (TMA) are a group of disorders characterized by thrombocytopenia, microangiopathic hemolytic anemia, and variable organ system involvement.

(525) This may present severe thrombocytopenia (<30-109/L), microangiopathic hemolytic anemia characterized by schistocytes on the blood smear, increased reticulocyte count (>120?10.sup.9/L), elevated lactate dehydrogenase level (LDH), and signs of skin and mucosal hemorrhage, weakness, and dyspnea. Treatment includes discontinuation of tacrolimus and possible initiation of plasma exchange.

(526) If rising CMV or EBV viral genomes are detected during serial testing, the decision to decrease IS or begin antiviral therapy will be determined through local site standard of care in consultation with appropriate subspecialists.

6.11 Example 11: Pharmacology Studies in MPS II Mice

(527) Minimum Effective Dose Study (Study #1): This study was designed to determine the minimum effective dose (MED) of Construct 1 (AAV9.CB7.CI.hIDS.rBG) administered through the ICV route as a single dose with a 3 months post-injection (pi) observation period, in a murine model of MPS 11. Limited safety assessments were also included (evaluation of the humoral immune response to the transgene and brain histopathology).

(528) Construct 1 was administered ICV to 2-3 month old C57BL/6 IDS ?/? (MPS II) mice (16 males/group) at doses of 1.3?10.sup.9, 1.3?10.sup.10, or 1.3?10.sup.11 GC/g brain mass (calculated based on a conversation factor to ddPCR titering from original method presented in study report) on Day 0. At Day 21, 8 mice from each of the treated dose groups were euthanized and necropsied for evaluation of CNS I2S activity, biodistribution and anti-hI2S immunogenicity. Between Days 60 and 89, wildtype mice and untreated MPS II mice were evaluated in a series of neurobehavioral assays (open field, Y-maze, contextual fear conditioning and novel object recognition) to characterize effect of the disease state on these endpoints. Based on the results of these initial assays, remaining treated mice were evaluated in the two assays that evaluated long term memory (contextual fear conditioning and novel object recognition).

(529) Approximately 3 months after ICV dosing of Construct 1, all the remaining mice were euthanized and necropsied. Serum and CSF were evaluated for 2S activity as well as serum for anti-12S antibodies. Liver and heart were evaluated for GAG tissue content. Brain overall lysosomal storage (both primary GAG storage and secondary ganglioside storage) was assessed by immunohistochemical staining of LIMP2 and GM3. Tissue hexosaminidase levels have been shown to be higher in MPS II mice and MPS II patients, and to be a biomarker of lysosomal homeostasis disruption. Tissue hexosaminidase enzymatic activity was thus measured as a biomarker of lysosomal function secondary to Construct 1 administration. Histopathology of the brain was evaluated to investigate both efficacy and safety.

(530) ICV administration of Construct 1 to C57BL/6 IDS ?/? (MPS II) mice at up to 1.3?10.sup.10 GC/g brain mass (using conversion factor to ddPCR method) was well tolerated, with no clinical signs or mortality, and resulted in distribution to the CNS as well as to peripheral tissues, particularly liver, thus demonstrating partial redistribution of injected viral particles from the CSF to the peripheral blood.

(531) Corresponding to the presence of vector, there was evidence of IDS gene expression based on dose dependent increases in I2S activity in the brain at Day 21 and in the CSF 3 months post-injection, with enzymatic activity close to wildtype level at the highest dose (brain tissue) and comparable to or higher than wildtype at the mid and high doses (CSF). There was dose dependent normalization of the lysosomal compartment, as shown by reductions in LIMP2 and GM3 staining in the CNS at all doses 3 months post injection. In H&E stained brain sections, dose dependent reductions in the amount and frequency of glial vacuolation and neuronal accumulation of amphophilic material, indicators of MPS II CNS phenotype, were also observed. Corresponding to the changes in CNS lysosomal content and improvements in disease-related morphology in the H&E stained sections, there were improvements in one measure of long term memory (novel object recognition, NOR) but not in the other, contextual fear conditioning (CFC). No clear dose response was apparent in the improvement in NOR.

(532) Dose dependent increases in serum I2S activity were also observed 3 months post-injection, with enzymatic activity comparable to or higher than wild type at the mid and high doses. Reflecting the normalization of I2S activity in serum, the treated MPS II mice had dose dependent decreases in hexosaminidase activity and GAG content in the liver and heart. Hepatic hexosaminidase and GAG levels were normalized at all dose levels in liver and at the mid and high doses in the heart. The highly transduced liver (1 to 10 GC per diploid genome) may have acted as a depot organ for the secretion of I2S into the serum, contributing to the reduction in GAGs seen in the heart at the higher doses.

(533) Construct 1 and injection procedure were well tolerated. No clinical abnormality was noted in the mice and they all survived up to the scheduled euthanasia. There was no evidence of Construct 1 related toxicity in the brain on histopathology, although changes related to the ICV administration procedure itself were observed in some mice. Humoral immune response to the transgene was minor, observed only in some mid- and high-dose animals without impact on the health or brain histopathology of those animals.

(534) In conclusion, Construct 1 was well tolerated in MPS II mice at all dose levels and resulted in dose-dependent increases in I2S levels (enzymatic activity) that were associated with improvements in both CNS and peripheral parameters of MPS II. The lowest dose administered, 1.3?10.sup.9 GC/g brain mass (conversion factor to ddPCR method), was the minimum effective dose in this study.

(535) GLP Toxicology and Biodistribution Studies in Non-Human Primates (Safety of Two Dose Levels of Construct 1; Study #2): This study evaluated the safety, biodistribution, and pharmacology of two dose levels of Construct 1 for up to 90 days after administration by image-guided suboccipital puncture in adult male rhesus macaques. Control article (Elliott's B?+0.001% Pluronic? F68 buffer) was administered via suboccipital puncture to a single macaque in Group 1. Construct 1 in the same buffer was administered via suboccipital puncture to 6 male rhesus macaques randomized to Groups 2-3. Macaques in Group 2 (n=3) received Construct 1 at a high dose (HD) of 5.6?10.sup.10 GC/g brain mass (5?10.sup.13 GC total); macaques in Group 3 (n=3) received Construct 1 administered at a low dose (LD) of 1.9?10.sup.11 GC/g brain mass (1.7?10.sup.13 GC total). Blood and cerebrospinal fluid (CSF) were collected as part of a general safety panel at baseline, Day 7, 14, 21, 30, 45, 60, and 90. Humoral response to the transgene product hI2S and to the AAV9 capsid, and hI2S enzymatic activity were analyzed in serum and CSF at the same timepoints. T-cell responses to the transgene product hI2S and to the AAV9 capsid were evaluated at baseline, Day 14, 30, 60, and 90 in the blood, and at Day 90 in spleen and bone marrow. Vector genomes were quantified in the total blood and CSF at baseline, Day 7, 14, 21, 30, 45, 60, and 90, and in urine and feces (shedding) at baseline, Day 5, 30, and 90. Following completion of the in-life phase of the study at 90?3 days post-vector administration, macaques were necropsied and tissues harvested for further evaluation. Histopathologic evaluation and biodistribution of the vector genome were done in a comprehensive list of tissues from the central nervous system (CNS), peripheral nervous system (PNS) and peripheral organs.

(536) There were no adverse events (AEs) associated with the administration procedure, and no treatment-related abnormalities on clinical general observations, body weight change, serum chemistry, or coagulation parameters. Treatment-related transient modifications of complete blood count (CBC), namely lymphocytosis, monocytosis, and basophilia, were observed around Day 7 and around Day 30. Increases were moderate, less than 3-fold over the baseline, and were in general less pronounced in LD animals compared to HD animals. A dose-dependent CSF mild lymphocytic pleocytosis (less than 20 cells per ?L) was observed in ? HD animals between Day 21 and Day 45 and in ? LD animal on Day 30. All but one animal (RA2203, HD) had normalized values by Day 90.

(537) A dose-dependent humoral immune response to the transgene-expressed hI2S was present in the serum of 3/3 HD and 2/3 LD, and in the CSF of 2/3 HD and 1/3 LD animals. Only one Construct 1 treated animal (LD) developed a peripheral blood T-cell immune response to the protein hI2S.

(538) All treated animals developed a dose-dependent anti-AAV9 neutralizing antibody (NAb) response from Day 7 in the serum. Anti-AAV9 NAb levels were lower in the CSF, did not appear until Day 45, and stayed negative throughout the study in one animal. No animal had a detectable T-cell response to AAV9 capsid in the blood, spleen, or bone marrow.

(539) Dose dependent treatment-related histologic findings were predominately found within the dorsal root ganglia (DRG) (minimal to mild neuronal degeneration with mononuclear cell infiltration) and within the corresponding dorsal white matter tracts of the spinal cord (minimal to mild dorsal axonopathy). Both incidence and severity were reduced at the low dose compared to the high dose. Inflammatory cells in the DRG were mostly CD3+ T cells with the inconsistent presence of fewer CD20+ B cells. These histological findings were not associated with any observed clinical abnormalities.

(540) High levels of AAV vector genomes were detected throughout the brain, spinal cord, and DRG of all Construct 1-treated animals yielding an average across all CNS and DRG samples of 8.30?10.sup.4 GC/?g DNA in the LD group, and 1.51?10.sup.5 GC/?g DNA in the HD group. Significant vector biodistribution was also found in the periphery, especially in the liver at levels about 10 times higher than in the CNS. The least transduced organs were eye, kidney, testicle, lung and thyroid gland with levels about 10.sup.3 GC/?g DNA, representing 1% of those measured in the CNS.

(541) Vector was cleared from the CSF between Day 30 and Day 90 in all animals, whereas it declined over time but persisted at low levels in the whole blood at the final Day 90 time point. At the earliest time point, Day 7, vector DNA was more abundant in the blood than in the CSF, showing rapid transfer from the intrathecal compartment to the systemic circulation. Vector shedding occurred through biliary clearance mostly, with higher genome copy values detected in the feces than in the urine. Shedding was also more durable in the feces (up to Day 30-90) than in the urine (up to Day 5).

(542) I2S activity rapidly increased over the baseline in all animals in the serum and CSF. Activity levels fell below the baseline level in the serum between Day 21 and Day 60 in all but one animal (LD). There was a correlation between the onset of anti-hI2S antibodies, and the decrease of serum activity. In the CSF, humoral immune response was less pronounced and the I2S activity was more variable but stayed above the baseline level in all but one animal (HD). There was no clear dose response in either serum or CSF.

(543) Based on the observation of a dose-dependent minimal to mild dorsal axonopathy, a no observable adverse effect level (NOAEL) could not be defined in rhesus macaques injected IT with Construct 1, a vector expressing human I2S.

(544) Safety of Consruct 1 with Immunosuppression (Study #3): To further investigate the histopathological findings, an additional 90-day exploratory NHP GLP study was conducted at the same dose levels (1.9?10.sup.11 and 5.6?10.sup.11 GC/g brain mass) with immunosuppression (IS). The IS regimen consisted of rapamycin and mycophenolate mofetil (MMF) with withdrawal of the latter at 60 days post-injection. Trough drug levels were measured and doses were adjusted as needed to maintain effective drug levels.

(545) There were no AEs associated with the administration procedure, and no Construct 1-related abnormalities on clinical general observations, body weight change, organ weights, CBC, serum chemistry, or coagulation parameters. IS procedure caused intestinal signs with increase of some inflammation parameters and anemia that were not related to Construct 1 administration. Only one animal from the LD group (RA2233) had a lymphocytic CSF pleocytosis (23 cells per ?L) on the necropsy day.

(546) High levels of AAV vector genomes were detected throughout the brain, spinal cord, and dorsal root ganglia of all Construct 1-treated animals. Significant vector biodistribution was also found in the periphery, especially in the liver that had levels about 10 times higher than in the CNS for the HD animals and equivalent to the CNS for the LD animals. The least transduced organs were eye, kidney, testicle, and thyroid gland.

(547) One animal had pre-existing AAV9 NAb (baseline titer 1:40) that completely inhibited the transduction of liver, eye, heart, lung, testicles, and thyroid (undetected genome copies), whereas the CNS and PNS vector biodistribution was not affected. Corresponding to the presence of vector genome copies in the CNS, PNS, and peripheral organs, I2S activity rapidly increased over the baseline in all but one animal in the serum and in all animals in the CSF, showing that Construct 1 expresses functional I2S enzyme that is present both in the CSF and in the serum of intrathecally treated animals.

(548) Humoral immune response to hI2S was absent or reduced to a minimal response. There was no T cell response to hI2S in IS animals and minimal to moderate response to AAV9 in the LD group only. No rebound immune response was seen following the withdrawal of MMF on Day 60.

(549) There was a mild AAV9 NAb response following vector administration that was more obvious in the LD animals than in the HD animals. IS had no clear effect on AAV9 NAb response of the LD animals (low in both IS and non-IS animals) but seemed efficient in modulating the AAV9 NAb response of the HD animals. IS completely prevented CSF AAV9 NAb response in both HD and LD animals treated with Construct 1.

(550) Treatment-related histopathologic findings were observed in both low- and high-dose groups. These findings consisted of minimal to mild neuronal cell body degeneration with mononuclear cell infiltration in the trigeminal ganglia and in dorsal root ganglia, that project in the dorsal white matter tracts, including minimal to mild axonopathy of the spinal cord dorsal white matter tracts and sciatic nerve. Immunohistochemistry of the DRG identified infiltrates of CD3+ cells in both groups, with occasional CD20+ cells also observed at the low-dose. These findings were generally qualitatively similar to those observed in Study #2 and therefore were not prevented by IS in this NHP study. However, there were some differences between the two studies with respect to histopathology. In Study #2, there was an apparent dose response between the low- and high-dose groups with respect to incidence and severity of findings. No dose response was observed in Study #3. The severity of axonopathy at the high-dose appear to be lower in Study #3 as compared to Study #2, whereas at the low dose IS in Study #3 did not decrease the findings. The histopathological findings may have been partially ameliorated (but not prevented) by the IS protocol in high-dose treated animals. No inflammation was seen within the brain or spinal cord, despite the presence of high vector copy number, likely reflecting the anatomic specificity of dorsal root ganglia that are highly vascularized and lack a protective blood brain-barrier unlike CNS.

(551) Proof-of-Concept Study (Study #4): The purpose of this proof-of-concept study was to evaluate the effectiveness of ICV administered Construct 1 in correcting IDS deficiency and preventing neurologic deficit in MPS II mice.

(552) Eight-week old MPS II male mice (C57BL/6 IDS-/0; n=13) were anesthetized with ketamine/xylazine and Construct 1 was administered into the right lateral cerebral ventricle at 2.15?10.sup.11 GC/g brain mass in 5 ?L. Fifteen untreated MPS II mice and 15 wild type mice served as comparators. An additional three animals were used separately for biodistribution

(553) The timeline for study data collection is illustrated in FIG. 16. Blood for plasma I2S activity assessment was collected every 4 weeks for 28 weeks post dose. At 6 months of age, wild type, treated and untreated mice were evaluated for performance in the Barnes maze, a circular maze with holes around the perimeter permitting the rodent subject to escape the platform. This maze is used to assess spatial learning and memory in mice that is thought to involve hippocampal function; untreated MPS II mice are significantly slower than wild type littermates at escaping the platform even after 6 days of trials (average latency to escape of 71 seconds versus 30 seconds in WT animals; p?0.05). At the end of the study (when the mice were 40 weeks old), urine was collected for evaluation of creatinine and glycosaminoglycan (GAG) content and mice were euthanized. Selected tissues were collected and weighed at necropsy and tissue homogenates of brain, spinal cord, heart, lung, liver, spleen and kidney were prepared and evaluated for I2S activity and GAG content. DNA was isolated from the same tissue homogenates and evaluated for vector biodistribution by qPCR.

(554) Treated mice exhibited increased ability to perform in the Barnes maze on the fifth and sixth day of trials, with no significant difference in performance between treated animals and wild type littermates (p>0.05).

(555) Vector distributed well through the CNS of treated mice, except for one animal which was attributed to a failed injection. One to 10 vector copies per genome equivalent were observed in most areas of the brain except the right hippocampus, where 49 vector copies/genome equivalent were detected.

(556) Vector also distributed to peripheral organs of treated mice, though generally at a slightly lower level (less than one vector copy per genome equivalent) in heart, lung, spleen and kidney, on average. The exception was the liver, which contained an average of 60 vector copies per genome equivalent.

(557) CNS tissue I2S activity levels in treated mice were 9 to 28% of wild type levels in the 12 regions of the brain, except the olfactory bulb (58%) and spinal cord (7%). Peripheral tissue I2S activity levels were 11-, 270-, 5- and 3-fold higher than in wild type mice (heart, liver, spleen and kidney, respectively). Lung I2S activity levels were 34% of wild type mice. Plasma I2S activity in treated mice was 160-fold higher than in wild type mice. Untreated MPS II mice had no detectable plasma I2S activity.

(558) Urine GAG levels in treated MPS II mice, normalized to urine protein, were comparable to those of wild type mice and significantly lower than untreated MPS II mice. GAG content in the sections of CNS tissues and peripheral organs was significantly lower in treated MPS II mice compared to untreated MPS II controls (mean 12.53 versus 30.58; p<0.01) and was not significantly different from wild type mice (mean 12.53 versus 10.11; p>0.05). Reduction in liver GAG content correlated with a reduction in liver weight in treated animals compared to untreated MPS 11 mice. Liver weight in treated MPS 11 mice was comparable to wild type mice.

(559) In conclusion, Construct 1 at a dose of 2.15?10.sup.11 GC/g brain was well tolerated in MPS II mice and resulted in distribution of vector within both the CNS and periphery, increased CNS and peripheral organ I2S activity, and improvements in both CNS function and peripheral parameters of MPS II.

(560) From pharmacology studies conducted in MPS II mice with Construct 1, it has been shown that the biodistribution and transgene expression profiles of AAV9 vector-based products are comparable for ICV and IC routes, supporting the use of ICV as an alternative route of administration should IC administration prove difficult or potentially unsafe (Study #2, Study #4). The FDA recommended that dose scaling from animals to humans should be based on the volume of the targeted compartment. Therefore, the calculated human equivalent of the animal doses is based on the relative size of the CNS compartment by age (using brain mass as a measure because accurate data are available for brain mass in most species).

(561) Therefore, the initial dose level proposed has been scaled from the mouse pharmacology study into humans. The proposed starting dose in humans, 1.3?10.sup.10 GC/g brain mass (Dose 1), is based on observations in the MPS II mouse model (Study #1). As shown in FIG. 17, the starting dose represents the middle dose evaluated in Study #1 and is 10-fold higher than the observed MED in mice. It is also approximately 14-fold lower than the lowest dose evaluated in the Safety/Toxicology studies conducted in NHPs (1.9?10.sup.10 GC/g brain mass: Study #2, Study #3). Dose 2 is 6.5?10.sup.10 GC/g brain mass (i.e., 5-fold greater than the low dose) and is 3-fold lower than the lowest dose evaluated in the NHP toxicology studies (i.e., 1.9?10.sup.11 GC/g brain mass). Dose 3 and Dose 3 Expanded Cohort (EC) is 2.0?10.sup.11 GC/g brain mass (Poly-A assay) or 2.9?10.sup.11 GC/g brain mass (transgene-specific assay), which is a 3-fold increase from Dose 2, and equivalent to the lowest dose used in the NHP studies. The analytical assay used to determine the number of genomic copies (GC) in drug product for Dose 3 EC has been updated to be more specific to the Construct 1 transgene. When testing the same lot, the updated assay reports a 1.48-fold higher number of GC than the assay used in prior dose cohorts (e.g., Poly-A PCR assay and transgene-specific assay). However, the effective dose (the dose that the subject experiences) remains unchanged.

(562) While there were no treatment-related clinical adverse events or findings in any NHP, dose-dependent treatment-related histologic findings occurred within the dorsal root ganglia (DRG) and their corresponding dorsal white matter tracts of the spinal cord. Both incidence and severity were reduced at the 1.9?10.sup.11 GC/g brain mass dose compared to the high dose of 5.6?10.sup.11 GC/g brain mass. The total volume of product administered does not exceed 10% of the total CSF volume (estimated to be ?50 mL in infant brain and ?150 mL in adult brain).

(563) TABLE-US-00035 TABLE 15 Tabular Summary of Nonclinical Studies with Construct 1 Doses (GC/g Study brain Species Type mass).sup. Key Results MPS II MED 1.3 ? Comparable biodistribution to brain and liver, which Mouse Pilot 10.sup.9 was greater than other organs (Study biodistribution 1.3 ? Dose-dependent increase in brain I2S activity #1) 10.sup.10 Dose-dependent reduction in LIMP2 and GM3 1.3 ? staining 10.sup.11 Dose-dependent decreases in hepatic and cardiac hexosaminidase activity and GAG content Improvement in preference for novel object indicating improvement of long term memory; no dose- dependence was observed Identified MED of 1.3 ? 10.sup.9 GC/g brain mass MPS II Proof-of- 2.15 ? At 6 months post-dose, treated MPS II mice Mouse Concept 10.sup.11 outperformed untreated MPS II mice in the Barnes (Study study maze #4) Comparable biodistribution to brain and liver CNS I2S levels were 9-28% of wild type Plasma and peripheral tissue I2S levels were higher than wild type GAG content in CNS and peripheral organs was comparable to wild type mice and correlated with lower liver weight in treated MPS II mice compared to untreated MPS II mice Urinary GAG excretion in treated MPS II mice was comparable to wild type mice and significantly lower than in untreated MPS II mice Rhesus Safety, 1.9 ? No abnormal clinical observations macaque toxicology, 10.sup.11 No administration procedure-related adverse events (Study and 5.6 ? No treatment-related abnormalities on clinical #2) biodistribution 10.sup.11 observations, body weight, serum chemistry, coagulation; no unscheduled deaths High levels of vector genome detected through brain, SC and DRG; highest concentrations were in liver; less in other peripheral organs. Transient moderate (<3-fold baseline) lymphocytosis, monocytosis, and basophilia around D 7 and D 30. Generally normalized by D 90. CSF: Dose-dependent mild lymphocytic pleocytosis (less than 20 cells per ?L) in 2/3 HD animals D 21- D 45 and 1/3 LD animal D 30. All but 1 HD animals normalized by D 90. Humoral immune response to hIDS: dose-dependent anti-hIDS response in serum of 3/3 HD and 2/3 LD; and CSF of 2/3 HD and 1/3 LD. T-cell response to hIDS: 1 LD animal had a peripheral blood T-cell immune response to the protein hIDS; no T-cell response identified in spleen or bone marrow. Dose-dependent treatment-related findings in DRG and SC. DRG: Minimal to mild neuronal degeneration with mononuclear cell infiltrates (mostly CD3+ cells); corresponding axonopathy in SC dorsal WM. A NOAEL was not identified Rhesus Exploratory 1.9 ? There were no AEs associated with the administration macaque safety, 10.sup.11 procedure, and no Construct 1-related abnormalities (Study toxicology, 5.6 ? on clinical general observations, body weight change, #3) and 10.sup.11 organ weights, CBC, serum chemistry, or coagulation biodistribution parameters. of Construct No unscheduled deaths; no abnormal clinical 1 in observations combination IS procedure caused intestinal signs with increase of with some inflammation parameters and anemia that were immunosuppression not related to Consruct I administration. (MMF and Humoral immune response to hIDS was prevented by sirolimus/ IS and was absent or reduced to a minimal (close to rapamycin) background) response in other animals. There was no T cell response to hIDS in IS animals and minimal to moderate response to AAV9 in the LD group only. No rebound immune response was seen following the withdrawal of MMF on Day 60. Both high and low dose groups had minimal neuronal cell body degeneration with mononuclear cell infiltration in the dorsal root ganglia, that project in the dorsal white matter tracts, and trigeminal ganglia, associated with minimal to mild axonopathy of the spinal cord dorsal white matter tracts and sciatic nerve. These findings were generally similar to Study #2 No inflammation was seen within the brain or spinal cord, despite the presence of high vector copy number High levels of AAV vector genomes were detected throughout the brain, spinal cord, and dorsal root ganglia. Significant vector biodistribution was also found in the periphery, especially in the liver .sup.Doses presented on a per gram basis were estimated from total dose administered by assuming a mouse brain size of 0.4 grams and NHP brain size of 90 grams. Dose levels in mouse pharmacology studies (Study #1, Study #4) were also converted to the ddPCR doses based on bridging studies to account for differences in assay titer between nonclinical studies and using a standard conversion factor based on comparability studies. The corrected doses are included in this document for consistency with the toxicology study vector dose (Study #2, Study #3), as well as the proposed clinical doses.

6.12 Example 12: Identification of a Biomarker that Differentiates Neuronopathic Forms of MPS I and MPS II

(564) In this study, cerebrospinal fluid (CSF) samples from healthy controls (n=31; age range from 1 month to 89 years), MPS I (Neuronopathic n=7, Non-neuronopathic n=2; age range from 1 to 28 years) and MPS II (Neuronopathic n=14, Non-neuronopathic n=4; age range from 4 to 29 years) patients were used to determine total amount of heparan sulfate (t-HS) and GAG heparan sulfate (HS). MPS patients were classified as neuronopathic or non-neuronopathic based on an IQ of less than or equal to 70 or less than 70, respectively. Further, total HS was calculated as the sum of the 4 disaccharides (FIG. 18). In brief, a bioanalytical mass spectrometry method was developed and validated to quantify the total amount of heparan sulfate (t-HS) as the sum of four disaccharides (D2S6, D0A0, D0S0, D0A6) in cerebrospinal fluid (CSF) following enzymatic digestion. LC-MS/MS assay was used for the determination of HS disaccharides D0A0, D0S0, D0A6, and D2S6 in human cerebrospinal fluid (CSF) using isotope-labelled disaccharide derivative as internal standards. HS polysaccharides are digested by enzymes (Heparinase I, II and III) into disaccharides, which are derivatized before being analyzed with LC-MS. Separation of the disaccharides was achieved by reversed-phase HPLC and disaccharides were detected using MS/MS.

(565) Results showed that HS composition revealed differential disaccharide concentrations in MPS I and MPS II compared to normal controls (FIGS. 19A-C). In addition, D2S6 concentrations were elevated in neuronopathic compared to non-neuronopathic MPS I and MPS II and to healthy controls (FIG. 20). Thus, the concentration of D2S6 in CSF samples separated patients with neuronopathic from patients with non-neuronopathic MPS I and MPS II (FIG. 20). Accordingly, CSF D2S6 can provide a diagnostic biomarker to differentiate neuronopathic and non-neuronopathic MPS II in presymptomatic patients. Additionally, D2S6 is a direct substrate of the deficient iduronate-2-sulfatase enzyme in MPS II and provides a direct estimate of enzyme activity with potential utility in monitoring therapy. The percent composition of HS disaccharides (e.g., D0A0, D0A6, D0S0, and D2S6) in normal, neuronopathic MPS I, non-neuronopathic MPS I, neuronopathic MPS II, and non-neuronopathic MPS II from this study is shown in FIG. 21. FIG. 21 shows that an increase in the four disaccharides (e.g., D0A0, D0A6, D0S0, and D2S6) was observed in MPS I and MPS II CSF samples compared to healthy controls. HS composition analysis showed that D2S6 constituted 21% and 23.3% of CSF HS in neuronopathic MPS I and MPS II, respectively, but only 11.2% of CSF HS in healthy controls.

6.13 Example 13: Phase I/II Study for MPS I Using Construct 2 (rAAV9 Encoding Human IDUA (hIDUA))

(566) A Phase I/II study was performed in which participants in cohort 1 received a dose of 1.0?10.sup.10 genome copies per gram of brain mass and participants in cohort 2 received a dose of 5.0?10.sup.10 genome copies per gram of brain mass of Construct 2 (FIG. 30 shows a representation of the Phase I/II study). Construct 2 is a non-replicating recombinant AAV of serotype 9 capsid containing an hIDUA expression cassette (refer to PCT/US2021/014129; PCT/US2018/015910; and PCT/US2019/042205, each of which is incorporated by reference herein in its entirety). The primary endpoint was safety and the secondary endpoints included: CSF biomarkers (heparin sulfate), neurodevelopmental assessments (Bayley/WASI), caregiver reported outcomes (Vineland), and systemic biomarkers (urine and plasma). Participants' ages (total of 6 participants) at dosing ranged from 4 months to 13 years in Phase 1/2 study and 20 months in a single patient study. The IDUA mutations among participants in the Phase 1/2 trial and the single patient study included nonsense/frameshift, nonsense/null variant splice site, and missense. No SAE related to the studies were observed and immunosuppression was discontinued after week 28. Table 16 summarizes the Phase I/II study and the single participant study (FIGS. 31A-31B). It was observed that CSF heparan sulfate decreased in all participants through the last time point available and that measurable CSF IDUA enzyme activity was observed in 3 of 4 participants in the Phase 1/2 trial and the single patient IND participant.

(567) TABLE-US-00036 TABLE 16 Phase I/II and single patient trial Dose Immuno- (GC/g Follow- Prior suppression Brain up treatment regimen ERT (IV) Cohort N Mass) (weeks) at dosing status status 1 2 1.0 ? 10.sup.10 40-46 1 prior 1 completed 1 not HSCT + 1 active on ERT ERT 1 weekly 1 ERT 2 3 5.0 ? 10.sup.10 3-32 1 HSCT + 3 active 2 weekly ERT 1 ERT 1 ERT Naive 1 ERT na?ve Single 1 1.0 ? 10.sup.10* 87 ERT completed weekly Patient *Previously reported as 1.3 ? 10.sup.10 from initial calculations for brain mass

(568) Neurodevelopmental assessments included Bayley Scale of Infant and Toddler Development, Third Edition (BSID-III) for chronological or developmental ages 0 to 42 months; Wechsler Abbreviated Scale of Intelligence (WASI-II) for chronological and development age>6 years; and Vineland Adaptive Behavior Scale, Third Edition (VABS-III). Results for the cognition, expressive language, and fine motor tests for participants in cohorts 1 and 2 are provided in FIGS. 32A-32F. All participants showed continued skill acquisition within 2 SD of normative mean on the cognition, expressive language and fine motor subtests at last assessment (FIGS. 32A-32F). The neurodevelopmental function BSID cognition of the single patient study was compared to MPS I natural history. It was found that cognitive function remains within 2 SD of normative range at the last assessment, 20 months after Construct 2 administration (FIG. 33). BSID cognition in participant approaching 42 months of age demonstrated higher age equivalent scores than available natural history data (FIG. 33). Further, a 13 year old Phase 1/2 study participant demonstrated improvements in WASI composite and the majority of components of the VABS 52 weeks after Construct 2 administration (FIG. 34). Systemic effect was also determined by measuring plasma I0S6 levels (FIGS. 35A-35B) and urine total GAGs (FIGS. 36A-36B) in the participants. I0S6 is a non-reducing end (NRE) disaccharide of glycosaminoglycans shown to be elevated in plasma, urine and CSF of MPS I patients. It was observed that participants with elevated I0S6 at baseline showed a decrease in I0S6 following Construct 2 administration and that in general, I0S6 levels were lower in participants after Construct 2 administration. Total urinary GAGs remained below 30 g/mol in all participants at the last time point available (FIGS. 36A-36B).

EQUIVALENTS

(569) Although the invention is described in detail with reference to specific embodiments thereof, it will be understood that variations which are functionally equivalent are within the scope of this invention. Indeed, various modifications of the invention in addition to those shown and described herein will become apparent to those skilled in the art from the foregoing description and accompanying drawings. Such modifications are intended to fall within the scope of the appended claims. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.

(570) All publications, patents and patent applications mentioned in this specification are herein incorporated by reference into the specification to the same extent as if each individual publication, patent or patent application was specifically and individually indicated to be incorporated herein by reference in their entireties.