FUNGAL PROTEASE MIXTURES AND USES THEREOF
20240156922 ยท 2024-05-16
Inventors
- Sean Michael GARVEY (Zion Crossroads, VA, US)
- Kelly Marie TINKER (Columbia, VA, US)
- Justin Lamont GUICE (Haymarket, VA, US)
- Robert Daniel LITTLE (Charlottesville, VA, US)
- Christopher Edward SCHULER (Charlottesville, VA, US)
Cpc classification
A61K38/4886
HUMAN NECESSITIES
A61K38/488
HUMAN NECESSITIES
International classification
Abstract
Fungal protease compositions, and more particularly, proteolytic enzyme mixtures comprising a plurality of Aspergillus proteases are provided. The disclosure also relates to protein hydrolysates, food and beverage products and dietary supplements produced using these proteolytic enzyme mixtures, and methods of making and using the same.
Claims
1. A proteolytic enzyme mixture comprising a plurality of fungal proteases from members of the genus Aspergillus, wherein the plurality of fungal proteases comprises: (a) a 42 kDa protease with exo- and endo-protease activity obtained from A. oryzae, (b) a 34 kDA protease with peptidase activity obtained from A. melleus, and (c) a 35 kDa fungal neutral protease obtained from A. oryzae, and the proteolytic enzyme mixture has exoprotease, endoprotease and peptidase activity.
2. The proteolytic enzyme mixture of claim 1, wherein the ratio of the 42 kDa protease:34 kDA protease:35 kDa fungal neutral protease is: a) 10:1:40; or b) 5-15:0.5-1.5:30-50; as measured in Hemoglobin Unit Tyrosine base (HUT) units.
3. The proteolytic enzyme mixture of claim 1, wherein the mixture displays peak proteolytic activity at approximately pH 6.
4. The proteolytic enzyme mixture of claim 1, wherein the mixture maintains proteolytic activity across a pH range of approximately 3.0 to 9.0.
5. The proteolytic enzyme mixture of claim 1, wherein the mixture is stable over a temperature range of approximately 20 to 80? C.
6. The proteolytic enzyme mixture of claim 1, wherein the mixture has a relative activity level of at least 40% over a temperature range of approximately 20 to 80? C.
7. A proteolytic enzyme mixture comprising a plurality of fungal proteases from the genus Aspergillus, wherein the mixture comprises at least two of SEQ ID NOs: 1, 2, and 3; or wherein the mixture includes at least one variant of SEQ ID NOs: 1, 2, or 3, comprising: a) an enzyme which shares at least 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% full-length sequence identity with any one of SEQ ID NOs: 1-3; b) an enzyme which shares at least 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% full-length sequence identity with the region spanning position 78-404 of SEQ ID NO: 1; c) an enzyme which shares at least 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% full-length sequence identity with the region spanning position 246-634 of SEQ ID NO: 3; or d) any combination of a), b) and/or c); wherein the variant retains the enzymatic activity of any one of SEQ ID NOs: 1-3.
8. (canceled)
9. The proteolytic enzyme mixture of claim 1, in a dehydrated, powdered, granular or freeze-dried form.
10. A dietary supplement comprising the proteolytic enzyme mixture of claim 1.
11. A dietary supplement comprising the proteolytic enzyme mixture of claim 1 and at least one additional enzyme comprising: a) a carbohydrase; b) an alpha-amylase; and/or c) an alpha-galactosidase.
12. The dietary supplement of claim 10, wherein the dietary supplement is: a) a protein supplement or a nutritional supplement; and/or b) formulated as a tablet, capsule, or powder.
13. The dietary supplement of claim 10, wherein the dietary supplement contains at least 0.04% by weight solids of a protease preparation from Aspergillus oryzae.
14. A method for increasing dietary protein digestion and/or the absorption of amino acids from dietary protein, comprising: administering a proteolytic enzyme mixture comprising a plurality of fungal proteases from members of the genus Aspergillus, wherein the plurality of fungal proteases comprises: (a) a 42 kDa protease with exo- and endo-protease activity obtained from A. oryzae, (b) a 34 kDA protease with peptidase activity obtained from A. melleus, and (c) a 35 kDa fungal neutral protease obtained from A. oryzae, and the proteolytic enzyme mixture has exoprotease, endoprotease and peptidase activity, or the dietary supplement of claim 10, to a subject at least once per day.
15. The method of claim 14, wherein the dietary supplement is administered at least twice per day, at least three times per day, or at least four times per day.
16. The method of claim 14, wherein the dietary supplement is administered in an amount effective to increase postprandial plasma concentrations of total amino acids, essential amino acids, branched chain amino acids, and/or leucine in the subject.
17. The method of claim 14, wherein the dietary supplement is administered to the subject before, after, or concurrently with a food or beverage comprising at least 10 wt. % of protein.
18. A method for improving muscle health, increasing muscle protein synthesis, increasing muscle size, and/or improving muscle strength, comprising: administering a proteolytic enzyme mixture comprising a plurality of fungal proteases from members of the genus Aspergillus, wherein the plurality of fungal proteases comprises: (a) a 42 kDa protease with exo- and endo-protease activity obtained from A. oryzae, (b) a 34 kDA protease with peptidase activity obtained from A. melleus, and (c) a 35 kDa fungal neutral protease obtained from A. oryzae, and the proteolytic enzyme mixture has exoprotease, endoprotease and peptidase activity, or the dietary supplement of claim 10, to a subject at least once per day.
19. A method of increasing exercise performance, decreasing muscle breakdown during exercise, and/or improving recovery from exercise comprising: administering a proteolytic enzyme mixture comprising a plurality of fungal proteases from members of the genus Aspergillus, wherein the plurality of fungal proteases comprises: (a) a 42 kDa protease with exo- and endo-protease activity obtained from A. oryzae, (b) a 34 kDA protease with peptidase activity obtained from A. melleus, and (c) a 35 kDa fungal neutral protease obtained from A. oryzae, and the proteolytic enzyme mixture has exoprotease, endoprotease and peptidase activity, a food product comprising said proteolytic enzyme mixture, or the dietary supplement of claim 10, to a subject in an amount sufficient to increase exercise performance and/or decrease muscle breakdown during exercise.
20. The method of claim 19, wherein the food product is a protein shake.
21. The method of claim 20, wherein the protein shake comprises a protein source from dairy, plant, or a mushroom.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
DETAILED DESCRIPTION OF VARIOUS EMBODIMENTS
[0039] The present disclosure relates to proteolytic enzyme mixtures comprising a plurality of fungal proteases obtained from members of the genus Aspergillus (e.g., from A. oryzae and A. melleus). These proteolytic enzyme mixtures may be administered to a subject as a dietary supplement (e.g., to improve protein digestion or the absorption of amino acids, EAAs, and/or BCAAs). They may also be used to produce a protein hydrolysate containing amino acids, EAAs and/or BCAAs, which may also possess additional beneficial properties (e.g., less bitterness, improved flavor and/or mouthfeel) compared to protein hydrolysate produced using currently available proteases and proteolytic enzyme mixtures. Additionally, methods of using these proteolytic enzyme mixtures, and various products (e.g., foods, beverages, dietary supplements) and other vehicles for administering the proteolytic enzyme mixtures or resulting protein hydrolysate are also provided. Methods of producing protein hydrolysates enriched with amino acids, EAAs, and/or BCAAs from a single protein source (e.g., without the need for supplementation with additional amino acids, EAAs and/or BCAAs from another source) are also provided.
[0040] Proteins are high molecular weight polymers composed of multiple amino acids linked by peptide bonds. These bonds must be cleaved in order for protein to be absorbed and utilized by a human or other organism, with such cleavage typically being performed by endogenous proteolytic enzymes of the gastrointestinal tract that separate the polypeptides into its constituent free amino acids. Amino acids may be classified as essential or non-essential for any given organism, depending on whether an organism is capable of synthesizing the given amino acid. For a dietary regimen to be considered adequate for the support of normal physiological functions, it should contain all essential amino acids in the appropriate levels and in proper proportions. For humans, the nine essential amino acids are leucine, isoleucine, valine, methionine, tryptophan, phenylalanine, threonine, lysine and histidine.
[0041] Three of the essential amino acids (valine, leucine and isoleucine) have aliphatic side-chains with a branch, i.e., a central carbon atom bound to three or more carbon atoms. These BCAAs are particularly notable because these amino acids are an important nutritional factor for proper muscle physiology and metabolism. Reports further indicate that athletic and exercise performance and recovery may be improved by BCAA supplements (See e.g., Glynn, E. L., et al., Excess Leucine Intake Enhances Muscle Anabolic Signaling but Not Net Protein Anabolism in Young Men and Women. The Journal of Nutrition. 2010. 140(11), 1970-1976; Sharp, C. P. M., et al., Amino Acid Supplements and Recovery from High-Intensity Resistance Training. Journal of Strength and Conditioning Research. 2010. 24(4), 1125-1130; Foure, A. & Bendahan, D. Is Branched-chain Amino Acids Supplementation an Efficient Nutritional Strategy to Alleviate Skeletal Muscle Damage? A Systematic Review. Nutrients. 2017. 9(10), 1047). In older adults, who are at risk of severe muscle wasting, BCAA supplementation in combination with exercise has also been shown to enhance performance and muscle strength (See e.g., Ikeda, T., et al. Effects and Feasibility of Exercise Therapy Combined with Branched-chain Amino Acid Supplementation on Muscle Strengthening in Frail and Pre-Frail Elderly People Requiring Long-term Care: A Crossover Trial. Applied Physiology, Nutrition, and Metabolism. 2016. 41(4), 438-445). The remaining non-essential amino acids provide a source of metabolizable nitrogen required for the biosynthesis of proteins, purines, nucleic acids, and other metabolites.
[0042] In view of the above, there has been commercial interest in dietary supplements and food additives that contain EAAs and BCAAs (e.g., protein powders and energy drinks directed to athletes). These supplements are typically prepared by fermentation of a raw protein source (e.g., whey protein), or by digestion of a raw protein source using a proteolytic enzyme or combination of enzymes and then supplementing the end product with BCAAs or other EAAs obtained from a second process or source. The manufacturing of such products is therefore complicated by the fact that amino acids must typically be obtained from multiple sources and mixed together to obtain a product which has the desired profile and ratios (e.g., enriched in BCAAs and/or EAAs).
[0043] The present disclosure provides proteolytic enzyme mixtures that simplify this process by generating protein hydrolysates already enriched in EAAs, and more particularly BCAAs. Use of these proteolytic enzyme mixtures reduces the complexity and manufacturing costs associated with having to obtain amino acids from different sources. Moreover, protein hydrolysates produced using these proteolytic enzyme mixtures have been found to have an improved taste, texture (e.g., mouthfeel) and solubility profiles compared to hydrolysates produced using known proteolytic enzymes and combinations thereof.
[0044] Protein hydrolysates produced using the present methods are therefore well-suited for use in commercial food products, dietary supplements, additives, and beverages. These food products and other vehicles may in turn be used by consumers, and athletes in particular, to provide nutrition, as well as athletic and/or exercise benefits.
Proteolytic Enzyme Mixtures Comprising a Plurality of Aspergillus Proteases
[0045] In one general aspect, the present disclosure provides a proteolytic enzyme mixture comprising a plurality of fungal proteases obtained from members of the genus Aspergillus (e.g., a combination of at least three proteases obtained from A. oryzae or A. melleus). One or more of these enzymes may possess exopeptidase, endopeptidase and/or peptidase activity, alone or operating in combination with other enzymes in the mixture. In some exemplary aspects, the mixture has proteolytic activity across a pH range spanning from 3.0 to 9.0, or any range of integer values therein. In some embodiments, the relative activity of the proteolytic enzyme mixture will be >40% across a pH range of 4.0 to 9.0, >60% across a pH range of 5.0 to 9.0, >80% across a pH range of 5.7 to 6.3, and/or >90% across a pH range of 5.8 to 6.2, measured at 60? C. The relative activity may also be >40% across a temperature range of 20 to 80? C., >60% across a temperature range of 40 to 80? C., >80% across a temperature range of 55 to 70? C., and/or >90% across a temperature range of 56 to 63? C., measured at pH 6.0. The proteolytic enzyme mixture may be capable of digesting a raw protein source (e.g., plant protein, whey protein) and producing a protein hydrolysate enriched in EAAs and/or BCAAs when applied to a food product or dietary supplement comprising a protein (e.g., a protein shake containing whey isolate as the protein) at a minimum of 1,000 to 150,000 hemoglobin unit tyrosine base (HUT) units per gram of the protein. As used herein, references to HUT units of the enzymes and enzyme mixtures described herein are calculated using the standard protocol labeled PROTEOLYTIC ACTIVITY, FUNGAL (HUT) in the Food Chemicals Codex (FCC), 12. Ed. (published Mar. 1, 2020), the contents of which is hereby incorporated by reference in its entirety. Briefly, one HUT unit (HUT/g) is defined as the amount of enzyme that produces a hydrolysate from bovine hemoglobin at pH 4.7 whose absorbance at 275 nanometers is the same as that of a solution containing 1.10 ?g/mL of tyrosine in 0.006 N hydrochloric acid. Increased HUT correlates with increased proteolytic activity of a protease or proteolytic mixture.
[0046] In some aspects, the proteolytic enzyme mixture may alternatively be applied to a food product or dietary supplement at a minimum of 1,000 to 150,000 HUT units per gram of total protein in the composition (e.g., at a minimum of 10,000; 20,000; 30,000; 40,000; 50,000; 60,000; 70,000; 80,000; 90,000; 100,000; 110,000; 120,000; 130,000; 140,000; or 150,000 HUT/g, or alternatively within a range bounded by any of these values). In some exemplary aspects, the proteolytic enzyme mixture comprises a three-enzyme blend and may produce a hydrolysate with amino acid, EAA, and/or BCAA enrichment at a concentration several-fold larger than the amino acid, EAA, and/or BCAA concentrations of a hydrolysate prepared by digestion with only one or two of the three enzymes in the proteolytic enzyme mixture. As such, the proteolytic enzyme mixture may be used to improve the absorption of amino acids (e.g., EAAs, BCAAs) by a human or animal that consumes a treated food product or dietary supplement comprising the proteolytic enzyme mixture, by increasing the amount of free amino acids, EAAs and/or BCAAs released during digestion.
[0047] For example, in some aspects, the proteolytic enzyme mixture may comprise OPTIZIOME? P.sup.3 HYDROLYZER? (also referred to as p.sup.3 or P.sup.3 HYDROLYZER? herein), a mixture of three fungal proteases distributed by BIO-CAT, Inc.: 1) Fungal Protease A (a 42 kDa protease with exo- and endo-protease activity obtained from A. oryzae; CAS No. 9025-49-4; IUBMB Enzyme Commission (EC) No. 3.4.23.18), present at 25,000 HUT units/g, 2) Fungal Protease AM (a 34 kDA protease with peptidase activity obtained from A. melleus; CAS No. 9074-07-1; EC No. 3.4.11.-), present at 2,500 HUT units per gram, and 3) Fungal Protease A2 (a 35 kDa fungal neutral protease obtained from A. oryzae; CAS No. 9025-49-4; EC No. 3.4.24.-), present at 100,000 HUT units per gram. The molecular weight of the enzymes is analyzed by polyacrylamide gel electrophoresis. As described herein, this combination has been shown to release amino acids, EAAs, and BCAAs across a wide range of pH and temperature levels (e.g., pH 3 to 9, and a temperature of 20-80? C.) while maintaining high activity.
[0048] In other aspects, the proteolytic enzyme mixture comprises a plurality of fungal proteases from the genus Aspergillus, wherein the mixture comprises SEQ ID NO: 1, a protease with peptidase activity obtained from A. melleus (CAS No. 9074-07-1; EC No. 3.4.11.-), and a fungal neutral protease obtained from A. oryzae (CAS No. 9025-49-4; EC No. 3.4.24.-). In another aspect, the mixture comprises SEQ ID NO: 1, SEQ ID NO: 2, and a fungal neutral protease obtained from A. oryzae (CAS No. 9025-49-4; EC No. 3.4.24.-). In another aspect, the mixture comprises SEQ ID NO: 1, a protease with peptidase activity obtained from A. melleus (EC No. 3.4.11.-), and SEQ ID NO: 3.
[0049] In another aspect, the mixture comprises a protease with exo- and endo-protease activity obtained from A. oryzae (CAS No. 9025-49-4; EC No. 3.4.23.18), SEQ ID NO: 2, and a fungal neutral protease obtained from A. oryzae (CAS No. 9025-49-4; EC No. 3.4.24.-). In another aspect, the mixture comprises a protease with exo- and endo-protease activity obtained from A. oryzae (CAS No. 9025-49-4; EC No. 3.4.23.18), SEQ ID NO: 2, and SEQ ID NO: 3.
[0050] In another aspect, the mixture comprises a protease with exo- and endo-protease activity obtained from A. oryzae (CAS No. 9025-49-4; EC No. 3.4.23.18), a protease with peptidase activity obtained from A. melleus (CAS No. 9074-07-1; EC No. 3.4.11.-), and SEQ ID NO: 3.
[0051] In other aspects, the proteolytic enzyme mixture comprises a plurality of fungal proteases from the genus Aspergillus, wherein the mixture comprises SEQ ID NO: 1, a 34 kDA protease with peptidase activity obtained from A. melleus (CAS No. 9074-07-1; EC No. 3.4.11.-), and a 35 kDA fungal neutral protease obtained from A. oryzae (CAS No. 9025-49-4; EC No. 3.4.24.-), wherein the molecular weight of the proteases are analyzed by polyacrylamide gel electrophoresis. In another aspect, the mixture comprises SEQ ID NO: 1, SEQ ID NO: 2, and a 35 kDa fungal neutral protease obtained from A. oryzae (CAS No. 9025-49-4; EC No. 3.4.24.-) when analyzed by polyacrylamide gel electrophoresis. In another aspect, the mixture comprises SEQ ID NO: 1, a 34 kDA protease with peptidase activity obtained from A. melleus (CAS No. 9074-07-1; EC No. 3.4.11.-) when analyzed by polyacrylamide gel electrophoresis, and SEQ ID NO: 3.
[0052] In another aspect, the mixture comprises a 42 kDa protease with exo- and endo-protease activity obtained from A. oryzae (CAS No. 9025-49-4; EC No. 3.4.23.18), SEQ ID NO: 2, and a 35 kDa fungal neutral protease obtained from A. oryzae (CAS No. 9025-49-4; EC No. 3.4.24.-), wherein the molecular weight of the proteases are analyzed by polyacrylamide gel electrophoresis. In another aspect, the mixture comprises a 42 kDa protease with exo- and endo-protease activity obtained from A. oryzae (CAS No. 9025-49-4; EC No. 3.4.23.18) when analyzed by polyacrylamide gel electrophoresis, SEQ ID NO: 2, and SEQ ID NO: 3.
[0053] In another aspect, the mixture comprises a 42 kDa protease with exo- and endo-protease activity obtained from A. oryzae (CAS No. 9025-49-4; EC No. 3.4.23.18), a 34 kDA protease with peptidase activity obtained from A. melleus (CAS No. 9074-07-1; EC No. 3.4.11.-), and SEQ ID NO: 3, wherein the molecular weight of the proteases are analyzed by polyacrylamide gel electrophoresis.
[0054] In other aspects, the proteolytic enzyme mixture comprises a plurality of fungal proteases from the genus Aspergillus, wherein the mixture comprises SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3.
[0055] In some aspects, the proteolytic enzyme mixture comprises a plurality of fungal proteases from the genus Aspergillus, wherein the mixture comprises SEQ ID NO: 1, SEQ ID NO: 2, and/or SEQ ID NO: 3, or a fragment or variant of any of these enzymes. For example, in some aspects, the proteolytic enzyme mixture comprises at least one variant enzyme which shares at least 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% full-length sequence identity with any one of SEQ ID NOs: 1-3, and which retains one or more of the enzymatic activities of SEQ ID NOs: 1-3. For example, a polypeptide sequence may differ from any one of SEQ ID NOs:1-3 by the presence of one or more conservative or non-conservative substitutions which do not impact the catalytic or other activity of the enzyme. As used herein, the term sequence identity refers to the degree to which two polypeptide sequences are identical (i.e., on a residue-by-residue basis) over the window of comparison. The percentage of sequence identity is calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which identical residues occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity.
[0056] In some aspects, the proteolytic enzyme mixture comprises a plurality of fungal proteases from the genus Aspergillus, wherein the mixture comprises at least one enzyme which shares at least 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% full-length sequence identity with a portion of the sequence of SEQ ID NOs: 1-3 (e.g., with the region spanning positions 78-404 of SEQ ID NO: 1 or with the region spanning positions 246-634 of SEQ ID NO: 3, which are predicted to represent the mature forms of the enzymes represented by these SEQ ID NOs). In some aspects, the proteolytic enzyme mixture comprises a plurality of fungal proteases from the genus Aspergillus, wherein the mixture comprises at least one enzyme which shares at least 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% full-length sequence identity with the region spanning positions 21-404 of SEQ ID NO: 1 or with the region spanning positions 19-634 of SEQ ID NO: 3.
[0057]
[0058] While the assay results described herein pertain to P.sup.3 HYDROLYZER?, it is understood that in some alternative aspects, a proteolytic enzyme mixture according to the disclosure may include at least two of the enzymes in P.sup.3 HYDROLYZER? or comprise at least two of SEQ ID NOs: 1, 2, or 3 (e.g., SEQ ID NOs: 1 and 2, 1 and 3, or 2 and 3). It is further understood that the amounts or ratios of the enzymes in the proteolytic enzyme mixture may be varied to produce a mixture having enhanced or reduced activity levels. For example, Fungal Protease A, Fungal Protease AM, and Fungal Protease A2 may be combined at a ratio of approximately 10:1:40, 10:1:20, 10:1:75, 3:1:10, as measured in HUT activity units, or any other ratio which provides a desired activity level as measured in HUT units. In some aspects, the ratio of any of the individual components may vary by ?5, 10, 15, 20, 25, 30, 35, 40, 45, or 50% from any of the foregoing examples or ratios described herein (e.g., the ratio may be 5-15:0.5-1.5:10-30, as measured in HUT activity units).
[0059] In practice, P.sup.3 HYDROLYZER? will typically be used at 1,000-2,000 HUT unit per gram of protein being digested (e.g., approximately 1,300 HUT units). However, it is understood that this amount will be varied subject to routine optimization for a given application (e.g., additional HUTs/g may be necessary at a lower incubation temperature for a given protein). Additional enzymes (e.g., proteases), coenzymes, cofactors, solvents, salts, etc., may be added to any of the protease enzyme mixtures disclosed herein as desired to improve or modify the digestion process as necessary or desired for a particular implementation.
[0060] The proteolytic enzyme mixtures described herein may be in a dehydrated, powdered, granular or freeze-dried form. In other aspects, the enzyme mixture is cell-free.
Dietary Supplements Comprising Proteolytic Enzyme Mixtures
[0061] In some aspects, proteolytic enzyme mixtures described herein may be formulated as dietary supplements, protein supplements, and/or nutritional supplement compositions that may be administered to a subject to provide one or more benefits (e.g., to increase protein digestion and/or the absorption of amino acids, EAAs, or BCAAs, or to improve the subject's muscle health). As used herein, the term dietary supplement refers to a manufactured product taken by mouth that comprises one or more dietary ingredients intended to supplement the diet (i.e., food) of a subject. Exemplary dietary ingredients include proteins, amino acids, carbohydrates, fat, vitamins, minerals, metabolites, probiotics, enzymes, herbs and botanicals. Unlike medicaments, dietary supplements are not intended to treat, diagnose, prevent, or cure diseases. A dietary supplement may comprise, e.g., a proteolytic enzyme mixture as described herein and at least 10, 20, 30, 40, 50, 60, 70, 80, or 90 wt. % of a dietary ingredient or a mixture of dietary ingredients. In some aspects, the dietary ingredient portion comprises a wt. % within a range bounded by any of these values (e.g., 10-20 wt. %). A protein supplement is a type of dietary supplement comprising at least 10 dry wt. % protein, wherein the amount of protein in the composition is greater than that of either carbohydrate or fat. A nutritional supplement is a type dietary supplement comprising protein, carbohydrates, and fat.
[0062] In accordance with certain embodiments disclosed herein, the proteolytic enzyme mixtures contains at least 0.01%, 0.02%, 0.03%, 0.04%, 0.05%, 0.06%, 0.07%, 0.08%, 0.09%, 0.10%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, or 30% by weight solids of a protease preparation from Aspergillus oryzae, including at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, and at least 90% by weight solids of a protease preparation from Aspergillus oryzae. In accordance with certain of the preceding embodiments, the proteolytic enzyme mixture contains 30% to 100% total HUT activity from the Aspergillus oryzae protease preparation, including from 45% to 100%, 50% to 100%, 70% to 100%, 80% to 100%, and 90% to 100% total HUT activity of the proteolytic enzyme mixture.
[0063] In some aspects, dietary supplements, protein supplements, and/or nutritional supplement compositions comprising a proteolytic enzyme mixture according to the disclosure may be suitable for oral administration. Oral administration, as defined herein, includes any form of administration in which the composition including the proteolytic enzyme mixture passes through the esophagus of the subject. For example, oral administration typically refers to oral consumption, but may also include administration through nasogastric intubation, in which a tube is run from the nose to the stomach of the subject to administer the composition. Oral administration is a form of enteral administration (i.e., administration through the digestive tract). Other forms of enteral administration suitable for use with the methods disclosed herein include administration through a gastric or jejunal tube. In accordance with the embodiments described herein, suitable forms of the composition for enteral administration to the subject include caplets, tablets, pills, capsules, chewable tablets, quick dissolve tablets, effervescent tablets, solutions, suspensions, emulsions, multi-layer tablets, bi-layer tablets, soft gelatin capsules, hard gelatin capsules, lozenges, chewable lozenges, beads, granules, particles, microparticles, dispersible granules, sachets, and combinations thereof.
[0064] In some aspects, dietary supplement, protein supplement, and/or nutritional supplement compositions may be formulated consisting of or consisting essentially of a proteolytic enzyme mixture according to the disclosure. In other aspects, the proteolytic enzyme mixture is formulated into a protein supplement. Such protein supplements disclosed herein are useful to provide supplemental sources of protein, including providing the subjects one or more benefits as described herein. In other embodiments, the proteolytic enzyme mixture is formulated in to a nutritional supplement. Such nutritional supplements disclosed herein are useful to provide supplemental sources of nutrition, including providing the subjects one or more benefits as described herein.
[0065] In accordance with certain methods of the embodiments disclosed herein, the dietary supplements, protein supplements, and nutritional supplement compositions may be provided as needed to deliver the desired level of proteolytic enzyme mixture, e.g., by providing at least one serving per day to achieve the desired effect. In some aspects, the dietary supplements, protein supplements, and nutritional supplement compositions maybe administered at one serving per day, two servings per day, three servings per day, four servings per day, etc., as needed to achieve a desired effect. Typically, the compositions disclosed herein are administered in at least one serving per day or at least two servings per day.
[0066] In some aspects, the proteolytic enzyme mixture is administered as a dietary supplement in capsule form before, during, or following consumption of a protein supplement. The final dose per serving of the proteolytic enzyme mixture may be between 5,000 and 300,000 HUT, 10,000 and 100,000 HUT, and 25,000 and 75,000 HUT. Table 1 shows an example formulation, from which a 250 mg capsule would be expected to deliver ?31,000 HUT. Table 2 shows an alternative exemplary formulation for a 300 mg capsule.
TABLE-US-00001 TABLE 1 An exemplary formulation of a dietary supplement in capsule form comprising a proteolytic enzyme mixture according to the disclosure. AMOUNT ACTIVITY INGREDIENTS (mg/1,000 mg) (HUT/g) Maltodextrin 687.3 n/a Fungal Protease A2 256.4 100,000 (Aspergillus oryzae) Fungal Protease A 34.4 25,000 (Aspergillus oryzae) Fungal Protease AM 21.9 2,500 (Aspergillus melleus)
TABLE-US-00002 TABLE 2 A second exemplary formulation of a dietary supplement in capsule form comprising a proteolytic enzyme mixture according to the disclosure. AMOUNT ACTIVITY INGREDIENTS (mg) (HUT/g) Maltodextrin 171.8 n/a Fungal Protease A2 64.1 25,000 (Aspergillus oryzae) Microcrystalline Cellulose 25 n/a Fungal Protease A 8.6 6,250 (Aspergillus oryzae) Fungal Protease AM 5.5 625 (Aspergillus melleus) Silicon Dioxide 2.3 n/a Magnesium Stearate 1.2 n/a
[0067] In some aspects of the disclosure, the proteolytic enzyme mixture is administered as a dietary supplement in the form of a powder sachet or stick pack reconstituted in 4 to 6 ounces of water before, during, or following consumption of a meal. The final dose per serving of the proteolytic enzyme mixture may be between 5,000 and 300,000 HUT, 10,000 and 100,000 HUT, and 25,000 and 75,000 HUT. Table 3 shows an example formulation, from which a 4.5 g stick pack would be expected to deliver ?31,000 HUT:
TABLE-US-00003 TABLE 3 An exemplary formulation of a dietary supplement in powder sachet or stick pack form comprising a protein mixture according to the disclosure. AMOUNT PER INGREDIENTS SERVING (g) Hydrolyzed Collagen 4.0 Maltodextrin 0.376 Fungal Protease A2 0.064 (Aspergillus oryzae) Stevia Leaf Extract 0.030 Strawberry Flavor 0.015 Fungal Protease A 0.009 (Aspergillus oryzae) Fungal Protease AM 0.006 (Aspergillus melleus)
[0068] In some aspects of the disclosure, the proteolytic enzyme mixture is formulated as a protein supplement. The final dose per serving of the proteolytic enzyme mixture is between 5,000 and 300,000 HUT, 10,000 and 100,000 HUT, and 25,000 and 75,000 HUT. Tables 4 and 5 show example protein powder formulations, from which a serving would be expected to deliver ?31,000 HUT:
TABLE-US-00004 TABLE 4 An exemplary formulation of a protein supplement comprising a protein mixture according to the disclosure. AMOUNT PER INGREDIENTS SERVING (g) Whey protein concentrate 25 Cocoa powder 2.7 Maltodextrin 1 Natural Flavors 0.6 Xantham Gum 0.1 Carageenan 0.1 Salt 0.1 Fungal Protease A2 0.064 (Aspergillus oryzae) Sucralose 0.030 Acesulfame potassium 0.025 Fungal Protease A 0.009 (Aspergillus oryzae) Fungal Protease AM 0.006 (Aspergillus melleus)
TABLE-US-00005 TABLE 5 A second exemplary formulation of a protein supplement comprising a protein mixture according to the disclosure. AMOUNT PER INGREDIENTS SERVING (g) Pea Protein Isolate 11 Rice Protein 9 Coconut Oil 2.0 Tapioca Maltodextrin 1 Natural Vanilla Flavors 0.6 Guar Gum 0.1 Carageenan 0.1 Sea Salt 0.1 Stevia Leaf Extract 0.08 Fungal Protease A2 0.064 (Aspergillus oryzae) Fungal Protease A 0.009 (Aspergillus oryzae) Fungal Protease AM 0.006 (Aspergillus melleus)
[0069] Any source of protein may be used so long as it is suitable for protein supplement or nutritional supplement compositions and is otherwise compatible with any other selected ingredients or features in the protein supplement or nutritional supplement compositions. For example, the source of protein may include, but is not limited to, intact, hydrolyzed, and partially hydrolyzed protein, which may be derived from any known or otherwise suitable source such as milk (e.g., casein, whey), animal (e.g., meat, fish, egg), cereal (e.g., rice, corn, oat, wheat), vegetable (e.g., pea, soy, hemp, potato), pulses (chick pea, mung bean, fava bean), fungi, bacteria, insect and combinations thereof. The source of protein may also include a mixture of amino acids known for use in protein supplements or a combination of such amino acids with the intact, hydrolyzed, and partially hydrolyzed proteins described herein. The amino acids may be naturally occurring or synthetic amino acids. The amino acids may include branched chain amino acids, essential amino acids, non-essential amino acids, or combination thereof.
[0070] Examples of suitable sources of protein for use in the protein supplements and nutritional supplements disclosed herein include, but are not limited to, whey protein concentrates, whey protein isolates, whey protein hydrolysates, acid caseins, sodium caseinates, calcium caseinates, potassium caseinates, casein hydrolysates, milk protein concentrates, milk protein isolates, milk protein hydrolysates, nonfat dry milk, condensed skim milk, pea protein isolates, pea protein hydrolysates, soy protein concentrates, soy protein isolates, soy protein hydrolysates, pea protein concentrates, collagen proteins, potato proteins, rice proteins, insect proteins, earthworm proteins, fungal (e.g., mushroom) proteins, proteins expressed by microorganisms (e.g., bacteria and algae), and the like, as well as combinations thereof. The nutritional supplement compositions can include any individual source of protein or a combination of two or more the various sources of protein listed above or otherwise encompassed by the general inventive concepts.
[0071] A variety of dairy protein and plant protein sources may be utilized for the protein system of the protein supplement or nutritional supplement described herein. An exemplary dairy protein suitable for use in the nutritional supplement powder described herein is Avonlac? 282, a whey protein concentrate, available from Glanbia Nutritionals (Kilkenny, Ireland). An exemplary plant protein suitable for use in the nutritional supplement powder described herein is NUTRALYS? S85F, a pea protein isolate, available from Roquette Freres (Lestrem, France).
[0072] In some aspects of the disclosure, the proteolytic enzyme mixture is formulated in to a nutritional supplement. The final dose per serving of the proteolytic enzyme mixture may be between 5,000 and 300,000 HUT, 10,000 and 100,000 HUT, and 25,000 and 75,000 HUT. Table 6 shows an example nutritional formulation, from which a serving would be expected to deliver ?31,000 HUT:
TABLE-US-00006 TABLE 6 An exemplary formulation of a nutritional supplement comprising a protein mixture according to the disclosure. AMOUNT PER INGREDIENTS SERVING (g) Corn Maltodextrin 20.0 Sugar 10.0 Milk protein concentrate 10.0 Soybean Oil 5.0 Soy Protein Isolate 5.0 Canola Oil 3.0 Vitamin and Mineral Blend 1.5 Whey Protein Concentrate 1.0 Guar Gum 1.0 Carageenan 1.0 Salt 0.8 Natural Flavors 0.6 Fungal Protease A2 0.064 (Aspergillus oryzae) Sucralose 0.030 Acesulfame potassium 0.025 Fungal Protease A 0.009 (Aspergillus oryzae) Fungal Protease AM 0.006 (Aspergillus melleus) Alpha-galactosidase 0.003
[0073] The dietary supplements, protein supplements and nutritional supplements described herein may be administered to a subject in order to increase protein digestion and/or to improve the absorption of amino acids, EAAs, and/or BCAAs. In other aspects, these compositions may be administered to a subject to improve muscle health. In each case, such methods comprise administering at least one serving per day of a composition comprising a proteolytic enzyme mixture according to the disclosure. In some aspects, such methods comprise administering 10 mg to 1,000 mg of proteases per serving, or approximately 5,000 HUT to 300,000 HUT per serving, to the subject.
Protein Hydrolysate Compositions and Methods of Preparation
[0074] Proteolytic enzyme mixtures described herein may be used to produce protein hydrolysates enriched in essential amino acids and/or BCAAs compared to protein hydrolysates produced by other protease enzymes and mixtures known in the art. Such hydrolysates may be produced from any raw protein source capable of digestion by a selected proteolytic enzyme mixture, including plant proteins (e.g., soy, hemp, rice, whey or pea protein), animal proteins (e.g., beef, chicken, or pork) and microbial proteins. Non-traditional protein sources such as insect protein (e.g., cricket protein) may also be used, as may proteins expressed from a recombinant organism (e.g., protein synthesized by a genetically-modified yeast culture).
[0075] As described above, proteolytic enzyme mixtures according to the disclosure may be used, in some embodiments, to produce hydrolysates having desirable properties such as enriched levels of essential amino acids or BCAAs. In some exemplary aspects, hydrolysates produced as described herein may have free leucine, isoleucine and/or valine levels which are several-fold higher than the levels of these free amino acids in protein hydrolyzed by any of the individual enzymes in the proteolytic enzyme mixture or by currently available proteases and mixtures. In some embodiments, such hydrolysates may be produced as a one-step process without supplementation from a secondary amino acid source (e.g., the initial hydrolysate may have a several-fold increase in one or more of these amino acids, avoiding the need for supplementation with additional BCAAs). In some exemplary aspects, hydrolysates produced as described herein may contain at least 10, 20, 30 or 40 mg/L of valine, at least 10, 20, 30 or 40 mg/L of isoleucine, and/or at least 10, 20, 30 or 40 mg/L of leucine. In some instances, the concentration of leucine in such hydrolysates may be further enriched to a level of at least 50, 100 or 150 mg/L.
[0076] In addition to providing higher concentrations of free BCAAs, hydrolysates produced according to the disclosure have also been found to display improved organoleptic properties. As noted above, hydrolysates produced according to methods known in the art often have a chalky mouthfeel and/or bitter taste. However, as described by Example 4 and illustrated by
Food Products, Ingredients or Additives, Dietary Supplements and Beverages Comprising Protein Hydrolysates
[0077] Protein hydrolysates produced according to the present disclosure may be used as food products, dietary supplements, as an ingredient or additive for a food product, in beverages, or in any other vehicle suitable for administration to or ingestion by a person or animal. In particular, hydrolysates according to the disclosure enriched in essential amino acids and/or BCAAs may be particularly desirable as food products, beverages or dietary supplements intended for athletes and subjects interested in improving exercise performance.
[0078] In some exemplary aspects, a protein hydrolysate may be prepared from a protein source (e.g., plant, animal or microbial-sourced raw protein) using any of the protease enzyme mixtures or methods of production described herein. The resulting hydrolysate may be optionally processed, such as by heat-inactivating the protease enzymes used to perform the digestion, chemically treating the mixture, and/or by filtering the mixture. The hydrolysate may also be optionally converted into a form more convenient for transport or storage (e.g., by drying, dehydrating or freeze-drying the hydrolysate). The hydrolysate may, subject to any such optional processing, be added to a food product, dietary supplement, beverage or any other vehicle suitable for administration to a human or animal, as indicated above.
[0079] In some exemplary aspects, the hydrolysate is dried or dehydrated to form a protein powder enriched in essential amino acids and/or BCAAs. In other exemplary aspects, the hydrolysate is added to a food product such as a meal replacement or energy bar or beverage. The hydrolysate may be added to a vehicle as a powder or in liquid form, as is preferred for a given application.
Methods of Using Protein Hydrolysates
[0080] Protein hydrolysates may be provided or administered to a human or animal in need of additional nutrition and/or to promote or provide a beneficial physiological effect. Protein hydrolysates enriched in essential amino acids and/or BCAAs are particularly useful as these classes of amino acid are associated with proper nutrition, muscle physiology and metabolism. As a result, protein hydrolysates produced according to the methods described herein may be used as a dietary supplement or as part of a treatment for humans or animals in order to improve nutrition or to improve athletic or exercise performance.
[0081] In some exemplary aspects, a protein hydrolysate as described herein may be administered to a subject in need thereof once, on a periodic basis or as part of any other regimen suitable to provide the subject with sufficient levels of one or more essential amino acids and/or BCAAs (e.g., to provide a desirable trait or reach a selected threshold associated with a desirable physiological state). The hydrolysate may be provided or administered as a food product, additive or ingredient to a food product, dietary supplement, beverage, or any other vehicle suitable which allows a subject to ingest or otherwise absorb amino acids in the hydrolysate.
[0082] Protein hydrolysates prepared using P.sup.3 HYDROLYZER? in accordance with any of the exemplary aspects above may be provided to a human or animal to promote nutrition or improved athletic or exercise performance, particularly hydrolysates enriched in BCAAs. It is understood that any such hydrolysates may be provided to a human or animal in need thereof as part of a food product, dietary supplement or beverage and may be provided in any amount necessary to provide a desirable function or outcome, with such amounts being the product of routine optimization depending on the nature of the individual or animal receiving the hydrolysate and/or the composition of the hydrolysate.
[0083] All statements herein reciting principles, aspects, and embodiments of the invention as well as specific examples thereof, are intended to encompass both structural and functional equivalents thereof. Additionally, it is intended that such equivalents include both currently known equivalents and equivalents developed in the future, i.e., any elements developed that perform the same function, regardless of structure. The scope of the present invention, therefore, is not intended to be limited to the exemplary embodiments shown and described herein. Rather, the scope and spirit of present invention is embodied by the appended claims.
[0084] All publications and patents cited in this specification are herein incorporated by reference as if each individual publication or patent were specifically and individually indicated to be incorporated by reference and are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. The citation of any publication is for its disclosure prior to the filing date and should not be construed as an admission that the present invention is not entitled to antedate such publication by virtue of prior invention. Further, the dates of publication provided may be different from the actual publication dates which may need to be independently confirmed.
EXAMPLES
[0085] The following examples demonstrate the performance of an exemplary protease mixture comprising Fungal Protease (A. oryzae), Fungal Protease AM (A. melleus), and Fungal Protease A2 (A. oryzae) at a ratio of 10:1:40. Each of these enzyme ingredients was obtained from BIO-CAT, Inc (Troy, Virginia, USA).
Example 1: Comparative Amino Acid Releasing Performance of P.SUP.3 .HYDROLYZER? in a 60 Minute Simulation of Gastric Digestion of Whey Protein
[0086] The primary objective of these in vitro experiments was to determine the effects of P.sup.3 HYDROLYZER? in releasing amino acids from dietary proteins in a gastric digestion simulation, with a comparison to two additional protease ingredient products. To start, the effects of P.sup.3 HYDROLYZER? on amino acid release from whey protein powder (NAKED Nutrition?; Coral Gables, FL, USA) was compared to Aminogen? and ProHydrolase?, two commercially available protease mixtures. Three experimental treatment groups, in addition to one control with no supplemental enzymes, were tested: 1) a blend of proteases and maltodextrin that meets at least the minimum protease concentration in the Aminogen? product; 2) the ProHydrolase? blend of proteases; and 3) a blend of P.sup.3 HYDROLYZER? and maltodextrin. Three grams of whey protein (approximately 1/10 serving size) were dissolved in 20 mL deionized water for each experimental enzyme treatment and control. Enzymes were weighed on tared weigh paper and then transferred to 20 mL test tubes using deionized water. Enzymes were prepared as follows: 1) 0.250 grams of a protease blend and maltodextrin that meets at least the minimum protease concentration in Aminogen? per 10 mL, 2) 0.250 grams ProHydrolase? per 5 mL, and 3) 0.125 grams of a protease blend and maltodextrin reflective of the final protease concentration in P.sup.3 HYDROLYZER? per 10 mL. All treatments reflect an equivalent recommended dose of the enzymes in Aminogen?, ProHydrolase?, and P.sup.3 HYDROLYZER?. One mL of each enzyme solution (approximately 1/10 recommended dose) was added to a separate beaker of dissolved protein. One mL deionized water (instead of enzyme) was also added to a separate beaker of dissolved protein (control). 2.5 mL simulated, acidic gastric solution (0.015 g mucin, 0.0125 grams pepsin 1:10,000, electrolytes, pH 1.9) was added to each beaker, including the control. This simulated gastric solution has been previously described (See Donhowe, E., et al., Characterization and In Vitro Bioavailability of 0-Carotene: Effects of Microencapsulation Method and Food Matrix. LWTFood Science and Technology. 2014. 57, 42-48, which is hereby incorporated by reference in its entirety). Importantly, the simulated gastric solution contains porcine pepsin, which is an endogenous, naturally occurring mammalian protease that is released in to the stomach during food or beverage consumption. This porcine pepsin in this in vitro experiment simulates the activity of human gastric pepsin. The experimental samples now containing protein, experimental enzymes (with the exception of the control), and simulated gastric fluid with pepsin were then placed on a stir plate in a 37? C. water bath for 60 minutes with agitation by magnetic stir bar. After the full 60 minute incubation, beaker contentsnow called gastric digestaswere transferred to 50 mL centrifuge tubes and enzymatic activity was halted by placing tubes in a 90? C. water bath for 10 minutes. Heat-killed gastric digestas were stored at 4? C. until high performance liquid chromatography (HPLC) analysis of all 20 essential and non-essential amino acids using o-phthalaldehyde (OPA) and 9-fluorenylmethyl chloroformate (FMOC). The results reported here are the average of amino acid values measured from three gastric simulations carried out on three separate days (n=3). A second experiment was also performed using the same compositions and parameters, except that the simulated gastric digestion incubation time was reduced to 15 minutes to better understand early activity of P.sup.3 HYDROLZYER? during gastric digestion.
[0087] Amino acids were measured by HPLC (Agilent 1100 Series HPLC, Agilent Technologies, Inc.; Santa Clara, CA, USA) with fluorescence detection. Combining OPA and FMOC enables fast pre-column derivatization of amino acids for chromatographic analysis. The HPLC reaction mixture was buffered at a pH of 10.2, which allows direct derivatization of acid hydrolyzed protein/peptide samples. Primary amino acids contain both a basic amino group and an acidic carboxyl group. Proline is the only proteinogenic amino acid that is a secondary amino acid, i.e., the nitrogen atom is attached both to the ?-carbon and to a chain of three carbons that together form a five-membered ring. Only primary amino acids react with OPA, so FMOC is needed for the detection of proline. The primary amino acids were reacted first with OPA using 3-mercaptopropionic acid (3-MPA). The secondary are then derivatized using FMOC. The incorporation of 3-MPA into the indoles decreases their hydrophobicity, and as a result, the OPA derivatives elute chromatographically before the FMOC derivatives. Excess FMOC and its degradation products elute after the last of the secondary amino acids and do not interfere with the analysis.
[0088] The results of these experiments are summarized by
Example 2: Comparative Amino Acid Releasing Performance of P.SUP.3 .HYDROLYZER? in a 60 Minute Simulation of Gastric Digestion of Whey, Soy, Pea, and Rice Proteins
[0089] A similar experiment was performed to evaluate the use of P.sup.3 HYDROLYZER? to release BCAAs from several additional protein sources (i.e., whey, soy, pea and rice protein), compared to a control sample with protein and only porcine pepsin, and protein digested with ProHydrolase? and Aminogen?. One dairy protein source and three plant protein sources were evaluated for their amino acid release profile under experimental enzymatic treatment: 1) whey protein powder (NAKED Nutrition?; Coral Gables, FL, USA), 2) soy protein isolate powder (Hard Eight Nutrition LLC, Hendersonville, NV, USA), 3) pea protein isolate powder (Hard Eight Nutrition LLC, Hendersonville, NV, USA), and 4) brown rice powder (Raw Power?, Coeur d'Alene, ID, USA).
[0090] For each protein source, 3 treatment groups in addition to no enzyme control were tested: 1) a blend of proteases and maltodextrin that meets at least the minimum protease concentration in the Aminogen? product; 2) the ProHydrolase? blend of proteases; and 3) a blend of P.sup.3 HYDROLYZER? and maltodextrin. The test compositions with experimental enzymes, protein, and simulated gastric fluid (containing porcine pepsin) were prepared, digested for 60 minutes, and analyzed as described in Example 1. The results of this experiment are summarized by
[0091] The effects of P.sup.3 HYDROLYZER? on total amino acid, EAA, and leucine release profiles, in addition to the BCAA concentrations reported previously in Example 2, were also determined. The results of these additional measurements are summarized by
[0092] To better characterize the superior performance of P.sup.3 HYDROLYZER?, a statistical analysis was performed using R? version 3.6.2 (R Core Team, 2020). Graphs were produced using the gglot2 package (Wickham, 2016). A one-way ANOVA analysis was performed to determine significance and an F-statistic of p<0.05 was considered statistically significant. Tukey's Honestly Significant Difference adjustment was used for multiple comparisons using a 95% family-wise confidence level. Each individual amino acid, total EAAs, total BCAAs, and total amino acids were analyzed.
[0093] P.sup.3 HYDROLYZER? treatment of whey protein promoted greater amino acid liberation compared to competitor protease products, including greater liberation of total amino acids, EAAs BCAAs and leucine (
TABLE-US-00007 TABLE 7 Amino acid release from whey protein in a 60 minute simulation of gastric digestion (Comp, competitor; Comp A, Aminogen?; Comp B, ProHydrolase?). Measured Adjusted P.sup.3 vs Value Values P.sup.3 vs Comp Fold P.sup.3 vs Comp Unadjusted Unadjusted (mg/g) (mg/g) Comp Average Change Unadjusted average fold change Essential amino acids: Control 0.89 2257% 22x Comp A 2.01 1.12 1714% 1000% Comp B 3.44 2.55 753% 1234% 12x 584% 792% 7x P.sup.3 20.09 19.2 Branched chain amino acids: Control 0.31 2545% 25x Comp A 0.51 0.2 3790% 1547% Comp B 0.76 0.45 1684% 2737% 27x 1038% 1293% 12x P.sup.3 7.89 7.58 Total amino acids: Control 3.1 1023% 10x Comp A 6.2 3.1 923% 511% Comp B 8.6 5.5 520% 721% 7x 369% 440% 4x P.sup.3 31.7 28.6 Leucine: Control 0.15 3247% 32x Comp A 0.30 0.15 3147% 1623% Comp B 0.44 0.29 1628% 2387% 23x 1107% 1365% 13x P.sup.3 4.87 4.72
[0094] P.sup.3 HYDROLYZER? treatment of soy protein (
[0095] In this example, whey, soy, pea and rice protein were assayed as protein sources for digestion. However, it is understood that other raw protein sources obtained from plants, fungi, bacteria or animals may also be digested using the protease enzyme mixtures disclosed herein. Similarly, the incubation time and temperature parameters described above may vary as necessary for a given application, while remaining in accordance with the present disclosure.
TABLE-US-00008 TABLE 8 Amino acid release from soy protein in a 60 minute simulation of gastric digestion (Comp, competitor; Comp A, Aminogen?; Comp B, ProHydrolase?). Measured Adjusted P.sup.3 vs Value Values P.sup.3 vs Comp Fold P.sup.3 vs Comp Unadjusted Unadjusted (mg/g) (mg/g) Comp Average Change Unadjusted average fold change Essential amino acids: Control 1.5 1667% 16x Comp A 3.1 1.6 1469% 806% Comp B 5.2 3.7 635% 1052% 10x 481% 644% 6x P.sup.3 25 23.5 Branched chain amino acids: Control 0.59 1820% 18x Comp A 1.09 0.5 2030% 985% Comp B 1.44 0.85 1194% 1612% 16x 746% 866% 8x P.sup.3 10.74 10.15 Total amino acids: Control 5.2 856% 8x Comp A 8.1 2.9 1355% 549% Comp B 11.8 6.6 595% 975% 9x 377% 463% 4x P.sup.3 44.5 39.3 Leucine: Control 0.37 1800% 18x Comp A 0.81 0.44 1430% 822% Comp B 0.95 0.58 1084% 1257% 15x 701% 762% 7x P.sup.3 6.66 6.29
TABLE-US-00009 TABLE 9 Amino acid release from soy protein in a 60 minute simulation of gastric digestion (Comp, competitor; Comp A, Aminogen?; Comp B, ProHydrolase?). Measured Adjusted P.sup.3 vs Value Values P.sup.3 vs Comp Fold P.sup.3 vs Comp Unadjusted Unadjusted (mg/g) (mg/g) Comp Average Change Unadjusted average fold change Essential amino acids: Control 1.7 994% 9x Comp A 2.1 0.4 3800% 805% Comp B 5.3 3.6 422% 2111% 21x 319% 562% 5x P.sup.3 16.9 15.2 Branched chain amino acids: Control 0.74 1232% 12x Comp A 0.80 0.06 13967% 1140% Comp B 1.86 1.12 748% 7357% 73x 490% 815% 8x P.sup.3 9.12 8.38 Total amino acids: Control 5.4 580% 5x Comp A 7.1 1.7 1524% 441% Comp B 12.4 7 370% 947% 9x 252% 347% 3x P.sup.3 31.3 25.9 Leucine: Control 0.4 1425% 14x Comp A 0.5 0.1 5300% 1140% Comp B 1.0 0.6 883% 3092% 30x 570% 855% 8x P.sup.3 5.7 5.3
TABLE-US-00010 TABLE 10 Amino acid release from rice protein in a 60 minute simulation of gastric digestion (Comp A, Aminogen?; Comp B, ProHydrolase?). Measured Adjusted P.sup.3 vs Value Values P.sup.3 vs Comp Fold P.sup.3 vs Comp Unadjusted Unadjusted (mg/g) (mg/g) Comp Average Change Unadjusted average fold change Essential amino acids: Control 0.7 2043% 20x Comp A 1.45 0.75 1813% 986% Comp B 3.91 3.21 424% 1119% 11x 366% 676% 6x P.sup.3 14.3 13.6 Branched chain amino acids: Control 0.27 3015% 360x Comp A 0.48 0.21 3748% 1696% Comp B 1.36 1.09 722% 2235% 22x 599% 1147% 11x P.sup.3 8.14 7.87 Total amino acids: Control 3.0 907% 9x Comp A 6.7 3.7 654% 406% Comp B 10.5 7.5 323% 488% 4x 259% 333% 3x P.sup.3 27.2 24.2 Leucine: Control 0.14 3564% 35x Comp A 0.32 0.18 2694% 1559% Comp B 0.73 0.59 822% 1758% 17x 684% 1121% 11x P.sup.3 4.99 4.85
TABLE-US-00011 TABLE 11 Average percent increase in percent greater amino acid liberation from three plant protein sources by P.sup.3 HYDROLYZER? compared to the average of two competitor products (Aminogen? and ProHydrolase?) in a 60 minute simulation of gastric digestion. Essential Branched chain Total amino acids amino acids amino acids Leucine Soy 644% 866% 463% 762% Pea 562% 815% 347% 855% Rice 676% 1147% 333% 1121% Average 627% 943% 381% 913%
Example 3: Comparative Amino Acid Releasing Performance of P.SUP.3 .HYDROLYZER? in the INFOGEST 122 Minute Simulation of Salivary-Gastric Digestion of Whey, Pea, and Soy Proteins
[0096] The INFOGEST simulation of salivary-gastric digestion was used to test the efficacy of P.sup.3 HYDROLYZER?, Aminogen?, and ProHydrolase? on protein digestion in vitro. Protein substrates included each of 1) Avonlac? 282 whey protein concentrate (Glanbia Nutritionals, Kilkenny, Ireland), 2) soy protein isolate (Hard Eight Nutrition LLC, Hendersonville, NV, USA), and 3) NUTRALYS? S85F pea protein isolate (Roquette Freres; Lestrem, France).
[0097] The INFOGEST protocol has been extensively described elsewhere (See Minekus, M., et al., A Standardised Static In Vitro Digestion Method Suitable for FoodAn International Consensus. Food and Function. 2014. 5(6), 1113-1124; Brodkorb, A., et al., INFOGEST Static In Vitro Simulation of Gastrointestinal Food Digestion. Nature Protocols. 2019. 14(4), 991-1014, each of which is hereby incorporated by reference in its entirety). The INFOGEST protocol models three phases of digestion: salivary, gastric, and intestinal. The salivary and gastric phases were modeled herein.
[0098] The salivary phase proceeded for 2 minutes in a simulated salivary fluid with agitation at 37? C. and neutral pH in the presence of porcine salivary amylase. The gastric phase proceeded by addition of simulated gastric fluid containing porcine pepsin and incubation for 2 hours with agitation at 37? C. at a starting pH of 3. In the experimental groups (treatments), a partial dose of experimental enzymes (i.e., P.sup.3 HYDROLYZER?, Aminogen?, or ProHydrolase?) based on the partial serving size of the food substrate, was added to the gastric digesta 10 minutes after the start of the gastric phase to mimic the time to dissolution of a vegetarian capsule shell in the human stomach. The control groups contained protein substrate and the endogenous porcine amylase and porcine pepsin in the salivary and gastric phases, respectively, to model human endogenous enzyme activities. Small samples were withdrawn at the end of the 2 hour gastric phase, followed by inactivation of enzymatic activity at 90? C. for 10 minutes. Samples were stored at 4? C. until measurement of all 20 amino acids by HPLC (Chemstation, Revision B.04.01 SP1, Agilent Technologies; Santa Clara, CA, USA). The results reported here are the average of amino acid values measured from 3 digestion experiments.
[0099] Statistical analysis was performed using R? version 3.6.2 (R Core Team, 2020). Figures were produced using GraphPad Prism version 9.1.2 for Windows (San Diego, California, USA). A one-way ANOVA analysis was performed to determine significance and an F-statistic of p<0.05 was considered statistically significant. Tukey's Honestly Significant Difference adjustment was used for multiple comparisons using a 95% family-wise confidence level. Normality was assessed by Shapiro-Wilk test on residuals. Homoscedasticity was assessed with the Levene's Test of Equality of Variances. No violations of normality or homoscedasticity were observed. Data below the limit of quantitation was imputed at the lowest standard value. Amino acids resolved as not detected were imputed with a value of zero for analytical purposes. Each amino acid, total EAAs, total BCAAs, and total amino acids were analyzed. All observations are expressed as mean?standard deviation. Figures with asterisks indicate increased levels of significance as follow: *, P<0.05; **, P<0.01; *** P<0.001; ****, P<0.0001.
[0100] P.sup.3 HYDROLYZER? treatment of whey protein promoted greater amino acid liberation compared to competitor protease products, including greater liberation of leucine, BCAAs, EAAs, and total amino acids leucine (
TABLE-US-00012 TABLE 12 Amino acid release from whey protein in the INFOGEST simulation of salivary-gastric digestion. Average % % Average Measured Adjusted Increase Increase Fold Value Values (P.sup.3 vs (P.sup.3 vs Change (mg/g) (mg/g) Comp) Comps) (P.sup.3 vs) Total amino acids: Control 7.12 Aminogen? 11.15 4.03 256% ProHydrolase? 14.35 7.23 143% 200% 3 P.sup.3 17.45 10.33 Essential amino acids: Control 6.08 Aminogen? 9.29 3.21 212% ProHydrolase? 11.00 4.92 139% 176% 2.7 P.sup.3 12.90 6.82 Branched chain amino acids: Control 1.55 Aminogen? 3.02 1.47 186% ProHydrolase? 3.26 1.71 160% 173% 2.7 P.sup.3 4.29 2.74 Leucine: Control 1.26 Aminogen? 1.95 0.69 339% ProHydrolase? 2.06 0.80 293% 316% 4.1 P.sup.3 3.60 2.34
[0101] P.sup.3 HYDROLYZER? treatment of pea protein (
TABLE-US-00013 TABLE 13 Amino acid release from pea protein in the INFOGEST simulation of salivary-gastric digestion. Average % % Average Measured Adjusted Increase Increase Fold Value Values (P.sup.3 vs (P.sup.3 vs Change (mg/g) (mg/g) Comp) Comps) (P.sup.3 vs) Total amino acids: Control 4.61 Aminogen? 10.35 5.74 198% ProHydrolase? 10.09 5.48 208% 203% 3 P.sup.3 15.99 11.38 Essential amino acids: Control 2.17 Aminogen? 6.28 4.11 191% ProHydrolase? 6.26 4.09 191% 191% 2.9 P.sup.3 10.00 7.83 Branched chain amino acids: Control 0.45 Aminogen? 1.69 1.24 246% ProHydrolase? 1.26 0.81 377% 311% 4.1 P.sup.3 3.50 3.05 Leucine: Control 0.22 Aminogen? 1.23 1.01 261% ProHydrolase? 0.82 0.60 440% 351% 4.5 P.sup.3 2.86 2.64
TABLE-US-00014 TABLE 14 Amino acid release from soy protein in the INFOGEST simulation of salivary-gastric digestion. Average % % Average Measured Adjusted Increase Increase Fold Value Values (P.sup.3 vs (P.sup.3 vs Change (mg/g) (mg/g) Comp) Comps) (P.sup.3 vs) Total amino acids: Control 8.94 Aminogen 12.40 3.46 247% ProHydrolase 12.09 3.15 271% 259% 3.5 P.sup.3 17.48 8.54 Essential amino acids: Control 7.03 Aminogen 9.24 2.21 249% ProHydrolase 9.12 2.09 264% 256% 3.5 P.sup.3 12.54 5.51 Branched chain amino acids: Control 1.95 Aminogen 2.71 0.76 280% ProHydrolase 2.47 0.52 410% 345% 4.4 P.sup.3 4.08 2.13 Leucine: Control 1.44 Aminogen 1.9 0.46 385% ProHydrolase 1.79 0.35 506% 445% 5.4 P.sup.3 3.21 1.77
TABLE-US-00015 TABLE 15 Average percent increase in percent greater amino acid liberation from 2 plant protein sources by P.sup.3 HYDROLYZER? compared to the average of two competitor products (Aminogen? and ProHydrolase?) in the INFOGEST simulation of salivary-gastric digestion. Total Essential Branched chain amino acids amino acids amino acids Leucine Pea 103% 91% 211% 251% Soy 159% 156% 245% 345% Average 131% 124% 228% 298%
Example 4: Evaluation of the Organoleptic Properties of an Exemplary Hydrolysate Produced Using P.SUP.3 .HYDROLYZER?
[0102] A sensory test was performed in order to determine the effects of the addition of P.sup.3 HYDROLYZER? and ProHydrolase? on sensory attributes of a whey protein shake. The panel of sensory assessors consisted of thirteen volunteers, and the whey protein shakes used in this test were prepared with whey protein powder from NAKED Nutrition? (Coral Gables, FL, USA) and whole milk, as summarized by Table 16.
TABLE-US-00016 TABLE 16 Composition of the whey protein shakes for sensory testing. Control P.sup.3 HYDROLYZER? ProHydrolase? Whole milk (mL) 250 250 250 Whey protein (g) 25 25 25 Enzyme (mg) N/A 250 250
[0103] Each experimental group was coded with a 3 digit number to keep the study participants blinded. The control samples were numbered 200 to 300, samples treated with P.sup.3 HYDROLYZER? were numbered 400 to 500, and samples treated with ProHydrolase? were numbered 600 to 700. Each assessor evaluated each shake using a rating system based on a 1 to 5 point scale (1, very poor; 2, poor; 3, fair; 4, good; 5, excellent) where a 1 indicated the very poor taste, texture, or overall flavor perception and a 5 indicated excellent taste, texture, or overall flavor perception. Participants also scored one of the 3 experimental shakes as Best and one of the remaining two experimental shakes as Worse. The results were ranked, scored and then analyzed to determine the preference of protein shakes without enzyme, with P.sup.3 HYDROLYZER?, or with ProHydrolase?.
TABLE-US-00017 TABLE 17 Sensory testing of whey protein shakes without added enzymes (control). Control Product Participant Code ID Taste Texture Overall Best Worse 301 J1 4 4 4 X 304 M3 3 4 4 X 310 J2 4 5 4 X 319 S2 3 4 4 322 D2 4 5 5 X 330 S1 4 5 4 X 350 K1 3 5 4 X 381 M1 3 3 3 X 236 J3 4 4 4 240 D1 3 5 5 291 M2 2 4 3 293 C1 4 5 4 X 295 K2 4 4 4 X Totals: 45 57 52 9 0 % of Groups: 69.2% 0.0%
TABLE-US-00018 TABLE 18 Sensory testing of whey protein shakes with added P.sup.3 HYDROLYZER?. P.sup.3 Partic- HYDROLYZER? ipant Tex- Product Code ID Taste ture Overall Best Worse 405 M2 4 4 4 414 S1 4 4 4 415 K1 2 3 2 X 434 M3 2 3 2 447 S2 4 5 5 X 451 J2 4 5 4 455 D2 5 4 4 457 J1 2 3 2 X 500 J3 4 4 4 507 K2 4 3 3 512 D1 4 3.5 4 X 527 C1 3 5 4 549 M3 4 4 4 X Totals: 46 50.5 46 3 2 % of Groups: 23.1% 15.4%
TABLE-US-00019 TABLE 19 Sensory testing of whey protein shakes with added ProHydrolase?. ProHydrolase? Participant Product Code ID Taste Texture Overall Best Worse 602 K1 2 2 2 608 J2 3 3 3 X 622 M2 2 2 2 X 628 S2 2 2 2 X 632 S1 3 2 3 X 638 D2 2 1 2 X 658 M3 1 1 1 X 681 J1 3 1 2 691 J3 2 2 2 716 K2 2 1 2 X 747 DI 3 3 3 X 750 M2 1 1 1 X 756 C1 2 1 2 X Totals: 28 22 27 0 10 % of Groups: 0.0% 76.9%
[0104] As illustrated by these results shown in Tables 17-19 and
Example 5: Clinical Evaluation of the Effects of Protease Supplementation on Post-Prandial Plasma Amino Acid Levels
[0105] Dietary protein is digested in the stomach and intestines to smaller peptides and 20 individual amino acids which, when absorbed by the gut into circulation and taken up by skeletal muscle, help stimulate muscle protein synthesis (MPS). Amino acids also provide the building blocks for muscle proteins that contribute to muscle growth and increased strength following resistance exercise. Therefore, strategies to efficiently maximize amino acid exposure without protein overconsumption are warranted. Oral enzyme supplementation is a candidate approach to optimize amino acid absorption from dietary protein and protein supplements. Microbial proteases can theoretically speed up the conversion of protein and peptides to amino acids. Protease supplements have been marketed to promote muscle strength by optimizing amino acid absorption, however meaningful and statistically significant clinical evidence is lacking.
[0106] Protease supplementation using the proteolytic enzyme mixture described herein was evaluated in a randomized, double-blind, placebo-controlled, cross-over clinical trial. Eligible participants were randomized into groups given either P.sup.3 HYDROLYZER? (n=12) or placebo (n=12) in conjunction with a liquid protein blend for their 1.sup.st aminoacidemia trial. A 2.sup.nd aminoacidemia trial consisted of the opposite treatment condition. The objective of this study was to determine whether P.sup.3 HYDROLYZER? enzyme supplementation (e.g., with 31,875 HUT protease activity) is an effective dosage to improve the early (0-2 h) and cumulative (0-5 h) net area under the total amino acid, EAA, BCAA, and leucine curves after the ingestion of a protein shake in healthy subjects. Statistically significant results showed that P.sup.3 HYDROLYZER? increased postprandial amino acid concentrations greater than that of the placebo in the acute protein shake challenge aminoacidemia trial. These clinical trial data provide evidence that P.sup.3 HYDROLYZER? supports digestive health, improves protein digestion, and enhances amino acid absorption from dietary protein.
[0107] Twenty-four recreationally active healthy adults volunteered to participate in this study. All participants were recruited and performed two experimental trials in the Nutrition and Exercise Performance Research Group clinical laboratory at the University of Illinois at Urbana-Champaign from April to August 2021. All participants were deemed healthy based on their responses to a routine medical screening questionnaire. All participants were informed about the experimental procedures, the purpose of the study, and potential risks before giving written consent. All trials conformed to standards for the use of human participants in research as outlined in the Helsinki Declaration (Clinicaltrials.gov ID NCT04821557) and were approved by the local Institutional Review Board at the University of Illinois at Urbana-Champaign (IRB approval no. 21545)
[0108] At Visit 1, study participants were asked to report to the testing facility at ?0700 hours after an overnight fast for measurement of body weight, height, and body composition by dual-energy x-ray absorptiometry (DEXA; Horizon W, Hologic Inc., Marlborough, MA, USA). After the preliminary testing session, participants were randomized to ingest 25 grams of pea protein isolate (Roquette NUTRALYS? S85F Pea Protein; 101 kcal, 20 g protein, 2.2 g fat) with either added P.sup.3 HYDROLYZER or placebo in a counterbalanced fashion on their first experimental trial. For allocation of the participants, a computer-generated list of random numbers was used. The study product was coded with a random numerical-alphabetical code and unblinded after all analyses were completed. Participants were instructed to refrain from any strenuous physical exercise 72 hours and alcohol 48 hours prior to the experimental trial. Participants were provided an identical standardized meal for consumption the evening before both trials (25-30% of energy requirement; 50% of energy from carbohydrate 25% energy from protein and 25% energy from fat). In addition, participants were instructed to maintain the same dietary intake for three days prior to each experimental trial, which was confirmed by the Automated Self-Administered 24-hour (ASA24) Dietary Assessment Tool (version 2020; National Cancer Institute, Bethesda, MD, USA). Both test days were separated by a 7-d wash-out.
[0109] For both trials, participants reported to the laboratory between 0600 hours and 0800 hours after an overnight fast. Following assessment of blood pressure, a Teflon catheter was inserted into an antecubital vein, and an arterialized baseline blood sample was collected. Immediately after catheter placement and blood sample collection, participants consumed 25 g of pea protein powder dissolved in 300 mL of water with either P.sup.3 HYDROLYZER? or a maltodextrin placebo. The test articles were manufactured in capsule form, i.e., as: 250 mg P.sup.3 HYDROLYZER? formulated to contain no less than 31,875 HUT activity, plus 20 mg microcrystalline cellulose, or placebo with 250 mg maltodextrin and 20 mg microcrystalline cellulose. On the morning of a protein shake challenge test and aminoacidemia trial, a capsule was opened and contents mixed into the shake. Arterialized blood samples were collected in EDTA-containing tubes before (t=?5 min) and after treatment ingestion (t=15, 30, 45, 60, 75, 90, 120, 150, 180, 210, 240 and 300 min). Blood samples were centrifuged at 3000 g for 10 min at 4? C. and the plasma was subsequently aliquoted and stored at ?80? C. for future analysis. Following an at least 1 week washout, participants repeated the aminoacidemia trial at Visit 2 with the opposite test article.
[0110] Plasma amino acid concentrations were determined as follows: the Amino Acid standard solution (AAS18, Sigma, USA), containing 2.5 ?mol/mL each of L-alanine, L-arginine, L-aspartic acid, L-glutamic acid, glycine, L-histidine, L-isoleucine, L-leucine, L-lysine HCl, L-methionine, L-phenylalanine, L-proline, L-serine, L-threonine, L-tyrosine and L-valine, and 1.25 ?moL/mL L-cystine and a custom mixture containing 2.5 ?mol/mL each of L-tryptophane, L-glutamine, L-asparagine, L-citrulline, L-cysteine were used for the calibration curve. Plasma samples (50 ?L) were deproteinized with methanol (940 ?L), centrifuged with following supernatant evaporation in vacuum and re-suspended in 1 mL of 0.1% formic acid in water before instrument injection. Ten ?L of internal standard (DL-p-Chlorophenylalanine, 1 mg/mL 0.1 M HCL) was added to each sample and standard solution. Samples were analyzed by the Thermo Altis Triple Quadrupole liquid chromatography with tandem mass spectrometry (LC/MS/MS) system. Software TraceFinder 4.1 was used for data acquisition and analysis. The LC separation was performed on a Thermo Accucore Vanquish C18+ column (2.1?100 mm, 1.5 ?m) with mobile phase A (0.1% formic acid in water) and mobile phase B (0.1% formic acid in acetonitrile) and the flow rate was 0.2 mL/min. The linear gradient was as follows: 0-0.5 min, 0% B; 0.5-3.5 min, 60% B; 3.5-5.5 min, 100% B; 5.5-7.5 min, 0% B. The autosampler and HPLC column chamber were set at 10? C., 50? C., respectively. The injection volume was 1 ?L. Mass spectra was acquired under positive electrospray ionization (ESI) with the ion spray voltage of 3500 V. Selected reaction monitoring (SRM) used for the amino acid quantitation.
[0111] All data are presented as mean?standard deviation (SD). A priori power analysis was conducted using GPOWER version 3.1.9.2. Based on previous research, the power analysis showed that a sample size of 20 participants was sufficient to detect differences in postprandial AUC BCAA concentrations between conditions when using a one-tailed t-test (p<0.05, 85% power, d=0.62). Accounting for a dropout rate of 15%, we recruited a total of 24 participants. All data were assessed for normality before analysis via visual inspection of normal Q-Q plots and skewness kurtosis values. Differences in amino acid concentrations were analyzed using linear mixed-effects models with time and group as fixed factors and participant intercept as a random effect. Bonferroni's post hoc test was used when significant main effects were identified. Differences in plasma AUC amino acid concentrations were analyzed using a paired samples two-tailed t-test. The level of statistical significance was set at p<0.05 for all analyses. All analyses were performed using IBM SPSS Statistics 23.0 (IBM Corporation, Armonk, NY, USA). For the analysis of amino acid concentrations at baseline, 45, and 60 minute time points, normality was assessed by the Shapiro-Wilk test on residuals and by visual confirmation using QQ-plot. Data points were considered outliers and subsequently removed only if their presence prevented normality. Normality was reassessed prior to removing any additional outliers.
[0112] Table 19 reports the subject characteristics at screening. Postprandial leucine, BCAA, EAA, and total amino acid concentrations over time are illustrated in
[0113] Plasma leucine concentrations increased during the two hours after P.sup.3 HYDROLYZER? and placebo ingestion with the protein shake (time effect: p<0.001), with no significant differences between conditions (condition effect: p=0.602, linear mixed-effects model,
TABLE-US-00020 TABLE 19 Subject characteristics at screening. Subject characteristics at screening Overall Characteristic Statistic/Category (n = 24) Biological sex Female (n) 12 Male (n) 12 Age (years) Mean 27 SD 4 Weight (kg) Mean 74.6 SD 11.2 BMI (kg/m.sup.2) Mean 24.8 SD 1.9 BMI group 18.0-24.99 kg/m.sup.2 13 25.0-29.99 kg/m.sup.2 11 Systolic BP (mmHg) Mean 119 SD 12 Diastolic BP (mmHg) Mean 67 SD 8 Body fat (%) Mean 29.2 SD 9.4 Lean body mass Mean 50.4 SD 13.5 Fasting blood glucose (mmol/L) Mean 4.90 SD 0.52 Energy intake (kcal/d) Mean 2189 SD 595 Relative protein intake Mean 1.5 (g ? kg bw.sup.?1 ? d.sup.?1) SD 0.6 Carbohydrate intake (g/d) Mean 236 SD 69 Fat intake (g/d) Mean 93 SD 27 SD, standard deviation; bw, body weight
[0114] Postprandial plasma BCAA concentrations increased during the two hours after P.sup.3 HYDROLYZER? and placebo ingestion with the protein shake (time effect: p<0.001), with no differences between conditions (condition effect: p=0.724, linear mixed-effects model,
TABLE-US-00021 TABLE 20 Postprandial plasma amino acid concentration total area under the curve (AUC) across the first two hours following consumption of a pea protein shake with placebo or P.sup.3 HYDROLYZER? Amino Acid P.sup.3 Timepoint Category Statistic Placebo HYDROLYZER? 0-2 Leucine n 20 20 hours Mean, ?mol .Math. 120 min .Math. L.sup.?1 (SD) 18031 (3326) 18566 (3133) Difference (P.sup.3 - Placebo) 535.3 paired t-test p-value 0.0858 n 19 19 BCAA Mean, ?mol .Math. 120 min .Math. L.sup.?1 (SD) 46765 (6559) 47433 (6674) Difference (P.sup.3 - Placebo) 667.8 paired t-test p-value 0.3497 n 21 21 EAA Mean, ?mol .Math. 120 min .Math. L.sup.?1 (SD) 101420 (14282) 103993 (15028) Difference (P.sup.3 - Placebo) 2574 paired t-test p-value 0.0379 n 21 21 TAA Mean, ?mol .Math. 120 min .Math. L.sup.?1 (SD) 208597 (28265) 216999 (32284) Difference (P.sup.3 - Placebo) 8402 paired t-test p-value 0.0332 SD, standard deviation
[0115] Plasma EAA concentrations increased during the two hours after P.sup.3 HYDROLYZER? and placebo ingestion with the protein shake (time effect: p<0.001), with no differences between conditions (condition effect: p=0.125, linear mixed-effects model,
[0116] Plasma total amino acids concentrations increased during the two hours after protein shake consumption (p<0.001), with higher concentrations with P.sup.3 HYDROLYZER? when compared to placebo (condition effect: p=0.003, linear mixed-effects model,
TABLE-US-00022 TABLE 21 Postprandial plasma amino acid concentrations at 45 and 60 minutes following consumption of a pea protein shake with P.sup.3 HYDROLYZER? or placebo. Amino Acid P.sup.3 Timepoint Category Statistic Placebo HYDROLYZER? 45 minutes Leucine n 24 24 Mean, ?mol/L (SD) 183.1 (31.75) 188.7 (38.70) ?, ?mol/L (P.sup.3 - Placebo) 5.64 paired t-test p-value 0.3346 Baseline-adjusted comparison.sup.a 6.5% paired t-test p-value 0.2343 BCAA n 23 23 Mean, ?mol/L (SD) 471.4 (77.03) 482.2 (99.99) ?, ?mol/L (P.sup.3 - Placebo) 10.76 paired t-test p-value 0.4601 Baseline-adjusted comparison.sup.a 6.5% paired t-test p-value 0.2731 EAA n 23 23 Mean, ?mol/L (SD) 965.7 (128.1) 999.7 (188.1) ?, ?mol/L (P.sup.3 - Placebo) 34.03 paired t-test p-value 0.1989 Baseline-adjusted comparison.sup.a 12.7% paired t-test p-value 0.1040 TAA n 22 22 Mean, ?mol/L (SD) 1952 (258.5) 2019 (337.7) ?, ?mol/L (P.sup.3 - Placebo) 157.3 paired t-test p-value 0.0009 Baseline-adjusted comparison.sup.a 23.5% paired t-test p-value 0.0225 60 minutes Leucine n 23 23 Mean, ?mol/L (SD) 175.2 (36.37) 185.4 (39.03) ?, ?mol/L (P.sup.3 - Placebo) 10.14 paired t-test p-value 0.1056 Baseline-adjusted comparison.sup.a 13.5% paired t-test p-value 0.0361 BCAA n 24 24 Mean, ?mol/L (SD) 466.8 (100.90) 479.9 (96.86) ?, ?mol/L (P.sup.3 - Placebo) 13.06 paired t-test p-value 0.3525 Baseline-adjusted comparison.sup.a 10.1% paired t-test p-value 0.1351 EAA n 24 24 Mean, ?mol/L (SD) 957.1 (177.6) 1012 (2074.6) ?, ?mol/L (P.sup.3 - Placebo) 55.33 paired t-test p-value 0.0448 Baseline-adjusted comparison.sup.a 21.7% paired t-test p-value 0.0153 TAA n 24 24 Mean, ?mol/L (SD) 1927 (342.5) 2079 (457.2) ?, ?mol/L (P.sup.3 - Placebo) 152.1 paired t-test p-value 0.017 Baseline-adjusted comparison.sup.a 33.0% paired t-test p-value 0.0053 .sup.aAverage baseline amino acid concentration was subtracted from average amino acid concentration at each time point, within each experimental group, and then compared between groups and expressed as a relative percent increase (P3 vs Placebo). n, sample size; SD, standard deviation; ?, difference
[0117] This is the first randomized, double-blind, placebo-controlled, cross-over study showing the efficacy of microbial protease supplementation in increasing postprandial plasma amino acid concentrations following protein shake consumption in healthy men and women. The results suggest that P.sup.3 HYDROLYZER? is a well-tolerated and safe strategy to improve dietary protein digestion and increase postprandial plasma concentrations in healthy adults.
[0118] A study according to this exemplary protocol may be used to evaluate the effects of protease supplementation using the proteolytic enzyme mixtures described herein and to provide data that can be used to select optimal amounts and/or administration schedules for the proteolytic enzyme mixtures described herein.
TABLE-US-00023 DescriptionofSequences SEQIDNo.: 1 Tradename: FungalProteaseA(BIO-CAT,Inc.) Sourceorganism: Aspergillusoryzae Protein: Aspergillopepsin-1 Gene: pepA UniPROTKBID: Q06902 Synonyms: AcidproteaseA2,AsparticproteaseA2,Aspergillusacid proteaseAspergillusacidproteinase,Aspergillusaspartic proteinase,AspergillopepsinI,AspergillopepsinO, AspergillopeptidaseA IUBMBEnzyme 3.4.23.18 Commission(EC)number: Length: ?404aminoacids Aminoacidsequence: 1020304050 MVILSKVAAVAVGLSTVASALPTGPSHSPHARRGFTINQITRQTARVGPK 60708090100 TASFPAIYSRALAKYGGTVPAHLKSAVASGHGTVVTSPEPNDIEYLTPVN 110120130140150 IGGTTLNLDFDTGSADLWVFSEELPKSEQTGHDVYKPSGNASKIAGASWD 160170180190200 ISYGDGSSASGDVYQDTVTVGGVTAQGQAVEAASKISDQFVQDKNNDGLL 210220230240250 GLAFSSINTVKPKPQTTFFDTVKDQLDAPLFAVTLKYHAPGSYDFGFIDK 260270280290300 SKFTGELAYADVDDSQGFWQFTADGYSVGKGDAQKAPITGIADTGTTLVM 310320330340350 LDDEIVDAYYKQVQGAKNDASAGGYVFPCETELPEFTVVIGSYNAVIPGK 360370380390400 HINYAPLQEGSSTCVGGIQSNSGLGLSILGDVFLKSQYVVFDSQGPRLGF AAQA Molecularmass: ?43kDa(irrespectiveofpost-translationalmodifications andincludinglowermolecularweighttranscriptionalor alternatepromotervariants) SEQIDNo.: 2 TradeName: FungalProteaseAM(BIO-CAT,Inc.) Protein: Leucineaminopeptidase1,variant2 Gene: LAP1 NCBIAccession: XP_045945651 IUBMBEnzyme 3.4.11.- Commission(EC) number: Sourceorganism: Aspergillusmelleus Length: ?387aminoacids AminoAcidsequence: 1020304050 MKVGAALALGATASTGVLAAVIPQAPLTNPHIYHNQEKYLIELAPYQTRW 60708090100 VTEEEKWALKLDGVNFIDVTTERNAGFYPTLHAPSYVRYPSKMEHTDEVT 110120130140150 TLIKDLSKANMQHNLEKFTSFHTRYYKSQTGIESATWLYNQVLDVIKSSG 160170180190200 AAKHGATVDQFAHPWGQFSVIARVPGKTNKTVVLGAHQDSINLFLPSILA 210220230240250 APGADDDGSGTVTILEALRGLLQSDPIIKGEAPNTIEFHWYSAEEGGMLG 260270280290300 SQAIFSQYKQDKRDIKAMLQQDMTGYTQGALEAGRQEAVGIMVDYVDQGL 310320330340350 TQFLKDAVTTYCDIGFINTKCGYACSDHTSASKYGYPAAMATESEMENSN 360370380 KRIHTTDDKIKYLSFDHMLQHAKLTLGFAYELAFAPF Molecularmass: ?43kDa(irrespectiveofpost-translationalmodifications andincludinglowermolecularweighttranscriptionalor alternatepromotervariants) SEQIDNo.: 3 Tradename: FungalProteaseA2(BIO-CAT,Inc.) Sourceorganism: Aspergillusoryzae Protein: ExtracellularmetalloproteinaseNpI Gene: NpI UniPROTKBID: Q2U1G7 Synonyms: ElastinolyticmetalloproteinaseNpI, FungalysinNpI,NeutralproteaseI IUBMBEnzyme 3.4.24.- Commission (EC)number: Length: ?634aminoacids Aminoacidsequence: 1020304050 MRGLLLAGALGLPLAVLAHPTHHAHGLQRRTVDLNSFRLHQAAKYINATE 60708090100 SSSDVSSSFSPFTEQSYVETATQLVKNILPDATFRVVKDHYIGSNGVAHV 110120130140150 NFRQTAHGLDANPLTKRDYTIDNADFNVNVGKNGKIFSYGHSFYTGKIPD 160170180190200 DPVAALRGTNEALQLSITLDQVSTEATEDKESFNFKGVSGTVSDPKAQLV 210220230240250 YLVKEDGSLALTWKVETDIDSNWLLTYIDANTGKDVHGVVDYVAEADYQV 260270280290300 YAWGINDPTEGPRTVISDPWDSSASAFTWISDGENNYTTTRGNNGIAQSN 310320330340350 PTGGSQYLKNYRPDSPDLKFQYPYSLNATPPESYIDASITQLFYTANTYH 360370380390400 DLLYTLGFNEEAGNFQYDNNGKGGAGNDYVILNAQDGSGTNNANFATPPD 410420430440450 GQPGRMRMYIWTESQPYRDGSFEAGIVIHEYTHGLSNRLTGGPANSRCLN 460470480490500 ALESGGMGEGWGDFMATAIRLKAGDTHSTDYTMGEWAANKKGGIRAYPFS 510520530540550 TSLETNPLTYTSLNELDEVHAIGAVWANVLYELLWNLIDKHGKNDGPKPE 560570580590600 FKDGVPTDGKYLAMKLVIDGMALQPCNPNCVQARDAILDADKALTDGANK 610620630 CEIWKAFAKRGLGEGAEYHASRRVGSDKVPSDAC Molecularmass: ?70kDa(irrespectiveofpost-translational modificationsandincludinglowermolecular weighttranscriptionaloralternatepromotervariants)