METHODS AND COMPOUNDS FOR TREATING DISORDERS

20240150328 ยท 2024-05-09

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention relates to methods and compositions for the treatment of BAF-related disorders such as cancers and viral infections.

    Claims

    1. A method of treating cancer in a subject in need thereof, the method comprising administering to the subject an effective amount of an agent that reduces the level and/or activity of BRD9 in the a cancer cell, wherein the cancer is a synovial sarcoma, CD8.sub.+ T-cell lymphoma, endometrial carcinoma, ovarian carcinoma, bladder cancer, stomach cancer, pancreatic cancer, esophageal cancer, prostate cancer, renal cell carcinoma, melanoma, colorectal cancer, non-small cell lung cancer, stomach cancer, breast cancer, or adult soft tissue sarcoma.

    2. The method of claim 1, wherein the cancer is synovial sarcoma.

    3. The method of claim 1, wherein the agent that reduces the level and/or activity of BRD9 in a cell is a small molecule compound, an antibody, an enzyme, and/or a polynucleotide.

    4. The method of claim 3, wherein the small molecule compound is a degrader.

    5. The method of claim 4, wherein the degrader has the structure of Formula I:
    A-L-B Formula I wherein A is a BRD9 binding moiety; L is a linker; and B is a degradation moiety.

    6. The method of claim 5, wherein the degradation moiety is a ubiquitin ligase binding moiety.

    7. The method of claim 6, wherein the degradation moiety has the structure of Formula A-1: ##STR00354## wherein Y.sup.1 is ##STR00355## each of R.sup.3 and R.sup.4 is, independently, H, optionally substituted C.sub.1-C.sub.6 alkyl, or optionally substituted C.sub.1-C.sub.6 heteroalkyl; q is 0, 1, 2, 3, or 4; and each R.sup.2 is, independently, halogen, optionally substituted C.sub.1-C.sub.6 alkyl, optionally substituted C.sub.1-C.sub.6 heteroalkyl, optionally substituted C.sub.3-C.sub.10 carbocyclyl, optionally substituted C.sub.2-C.sub.9 heterocyclyl, optionally substituted C.sub.6-C.sub.10 aryl, optionally substituted C.sub.2-C.sub.9 heteroaryl, optionally substituted C.sub.2-C.sub.6 alkenyl, optionally substituted C.sub.2-C.sub.6 heteroalkenyl, hydroxyl, thiol, or optionally substituted amino, or a pharmaceutically acceptable salt thereof.

    8. The method of claim 6, wherein the degradation moiety has the structure of ##STR00356## wherein q is 0, 1, 2, 3, or 4; each R.sup.2 is, independently, halogen, optionally substituted C.sub.1-C.sub.6 alkyl, optionally substituted C.sub.1-C.sub.6 heteroalkyl, optionally substituted C.sub.3-C.sub.10 carbocyclyl, optionally substituted C.sub.2-C.sub.9 heterocyclyl, optionally substituted C.sub.6-C.sub.10 aryl, optionally substituted C.sub.2-C.sub.9 heteroaryl, optionally substituted C.sub.2-C.sub.6 alkenyl, optionally substituted C.sub.2-C.sub.6 heteroalkenyl, hydroxyl, thiol, or optionally substituted amino; each of R.sup.3a, R.sup.3b, and R.sup.3c is, independently, H, optionally substituted C.sub.1-C.sub.6 alkyl, or optionally substituted C.sub.1-C.sub.6 heteroalkyl; and R.sup.4 is H, optionally substituted C.sub.1-C.sub.6 alkyl, or optionally substituted C.sub.1-C.sub.6 heteroalkyl, or a pharmaceutically acceptable salt thereof.

    9. The method of claim 5, wherein the BRD9 binding moiety comprises the structure of Formula E-a: ##STR00357## wherein R.sup.22 is H, optionally substituted C.sub.1-C.sub.6 alkyl, or optionally substituted C.sub.1-C.sub.6 heteroalkyl; R.sup.23 is H, halogen, optionally substituted C.sub.1-C.sub.6 alkyl, or optionally substituted C.sub.6-C.sub.10 aryl; s is 0, 1, or 2; each R.sup.24 is, independently, halogen, optionally substituted C.sub.1-C.sub.6 alkyl, optionally substituted C.sub.1-C.sub.6 heteroalkyl, optionally substituted C.sub.3-C.sub.10 carbocyclyl, optionally substituted C.sub.2-C.sub.9 heterocyclyl, optionally substituted C.sub.6-C.sub.10 aryl, optionally substituted C.sub.2-C.sub.9 heteroaryl, optionally substituted C.sub.2-C.sub.6 alkenyl, optionally substituted C.sub.2-C.sub.6 heteroalkenyl, hydroxyl, thiol, or optionally substituted amino, or two R.sup.24 combine with the carbon atoms to which they are attached to form an optionally substituted C.sub.6-C.sub.10 aryl or optionally substituted C.sub.2-C.sub.9 heteroaryl; s is 0, 1, 2, 3, or 4; and each R.sup.25 is, independently, halogen, optionally substituted C.sub.1-C.sub.6 alkyl, optionally substituted C.sub.1-C.sub.6 heteroalkyl, optionally substituted C.sub.3-C.sub.10 carbocyclyl, optionally substituted C.sub.2-C.sub.9 heterocyclyl, optionally substituted C.sub.6-C.sub.10 aryl, optionally substituted C.sub.2-C.sub.9 heteroaryl, optionally substituted C.sub.2-C.sub.6 alkenyl, optionally substituted C.sub.2-C.sub.6 heteroalkenyl, hydroxyl, thiol, or optionally substituted amino, or a pharmaceutically acceptable salt thereof.

    10. A compound having the structure of Formula K-1, Formula K-2, Formula M-2, Formula M-3, or Formula O-1: ##STR00358## wherein Y.sup.2 is N or CR.sup.23; R.sup.22 is H, optionally substituted C.sub.1-C.sub.6 alkyl, or optionally substituted C.sub.1-C.sub.6 heteroalkyl; R.sup.23 is H, halogen, optionally substituted C.sub.1-C.sub.6 alkyl, or optionally substituted C.sub.6-C.sub.10 aryl; s is 0, 1, 2, 3, or 4; each R.sup.25 is, independently, halogen, optionally substituted C.sub.1-C.sub.6 alkyl, optionally substituted C.sub.1-C.sub.6 heteroalkyl, optionally substituted C.sub.3-C.sub.10 carbocyclyl, optionally substituted C.sub.2-C.sub.9 heterocyclyl, optionally substituted C.sub.6-C.sub.10 aryl, optionally substituted C.sub.2-C.sub.9 heteroaryl, optionally substituted C.sub.2-C.sub.6 alkenyl, optionally substituted C.sub.2-C.sub.6 heteroalkenyl, hydroxyl, thiol, or optionally substituted amino; R.sup.53 is H, optionally substituted C.sub.1-C.sub.6 alkyl, optionally substituted C.sub.1-C.sub.6 heteroalkyl, or optionally substituted C.sub.3-C.sub.10 carbocyclyl; R.sup.54 is H or optionally substituted C.sub.2-C.sub.9 heteroaryl; R.sup.55 is H or NR.sup.a, wherein R.sup.a is H, optionally substituted C.sub.1-C.sub.6alkyl, optionally substituted C.sub.1-C.sub.6 heteroalkyl, or optionally substituted C.sub.3-C.sub.10 carbocyclyl; X.sup.5 is N or CR.sup.56a; X.sup.6 is N or CR.sup.56b; each of X.sup.7 and X.sup.8 is, independently, N or CH; each of R.sup.56a and R.sup.56b is, independently, H or NR.sup.a, wherein each R.sup.a is H, optionally substituted C.sub.1-C.sub.6 alkyl, optionally substituted C.sub.1-C.sub.6 heteroalkyl, or optionally substituted C.sub.3-C.sub.10 carbocyclyl; R.sup.57 is optionally substituted C.sub.2-C.sub.10 heterocyclyl; Y.sup.2 is N or CR.sup.58a; Y.sup.3 is N or CR.sup.58b; and each of R.sup.58a and R.sup.58b is, independently, H or optionally substituted C.sub.1-C.sub.6 alkyl, wherein if R.sup.53 is H and R.sup.54 is H, then R.sup.55 is NR.sup.a; if R.sup.54 is H and R.sup.55 is H, then R.sup.53 is optionally substituted C.sub.3-C.sub.10 carbocyclyl; and if R.sup.53 is H and R.sup.55 is H, then R.sup.54 is optionally substituted C.sub.2-C.sub.9 heteroaryl, or a pharmaceutically acceptable salt thereof.

    11. The compound of claim 10, wherein the compound has the structure of any of compounds B1-B65 in Table 1, or a pharmaceutical acceptable salt thereof.

    12. A pharmaceutical composition comprising the compound of claim 10 and a pharmaceutically acceptable excipient.

    13. A compound having the structure of Formula I:
    A-L-B Formula I, wherein L is a linker; B is a degradation moiety; and A has the structure of Formula E-3, Formula E-4, Formula G-2, Formula G-3, or Formula E-5: ##STR00359## wherein Y.sup.2 is N or CR.sup.23; R.sup.22 is H, optionally substituted C.sub.1-C.sub.6 alkyl, or optionally substituted C.sub.1-C.sub.6 heteroalkyl; R.sup.23 is H, halogen, optionally substituted C.sub.1-C.sub.6 alkyl, or optionally substituted C.sub.6-C.sub.10 aryl; s is 0, 1, 2, 3, or 4; each R.sup.25 is, independently, halogen, optionally substituted C.sub.1-C.sub.6 alkyl, optionally substituted C.sub.1-C.sub.6 heteroalkyl, optionally substituted C.sub.3-C.sub.10 carbocyclyl, optionally substituted C.sub.2-C.sub.9 heterocyclyl, optionally substituted C.sub.6-C.sub.10 aryl, optionally substituted C.sub.2-C.sub.9 heteroaryl, optionally substituted C.sub.2-C.sub.6 alkenyl, optionally substituted C.sub.2-C.sub.6 heteroalkenyl, hydroxyl, thiol, or optionally substituted amino; R.sup.53 is H, optionally substituted C.sub.1-C.sub.6 alkyl, optionally substituted C.sub.1-C.sub.6 heteroalkyl, or optionally substituted C.sub.3-C.sub.10 carbocyclyl; R.sup.54 is H or optionally substituted C.sub.2-C.sub.9 heteroaryl; R.sup.55 is H or NR.sup.a, wherein R.sup.a is H, optionally substituted C.sub.1-C.sub.6alkyl, optionally substituted C.sub.1-C.sub.6 heteroalkyl, or optionally substituted C.sub.3-C.sub.10 carbocyclyl; each of X.sup.5 and X.sup.6 is, independently, N or CR.sup.56; each of X.sup.7 and X.sup.8 is, independently, N or CH; each R.sup.56 is, independently, H or NR.sup.a, wherein R.sup.a is H, optionally substituted C.sub.1-C.sub.6 alkyl, optionally substituted C.sub.1-C.sub.6 heteroalkyl, or optionally substituted C.sub.3-C.sub.10 carbocyclyl; R.sup.57 is optionally substituted C.sub.2-C.sub.10 heterocyclyl; each of Y.sup.2 and Y.sup.3 is, independently, N or CR.sup.58; and each R.sup.58 is, independently, H or optionally substituted C.sub.1-C.sub.6 alkyl, wherein if R.sup.53 is H and R.sup.54 is H, then R.sup.55 is NR.sup.a; if R.sup.54 is H and R.sup.55 is H, then R.sup.53 is optionally substituted C.sub.3-C.sub.10 carbocyclyl; and if R.sup.53 is H and R.sup.55 is H, then R.sup.54 is optionally substituted C.sub.2-C.sub.9 heteroaryl, or a pharmaceutically acceptable salt thereof.

    14. The compound of claim 13, wherein the degradation moiety is a ubiquitin ligase binding moiety.

    15. The compound of claim 14, wherein the linker has the structure of Formula II:
    A.sup.1-(B.sup.1).sub.f(C.sup.1).sub.g(B.sup.2).sub.h-(D)-(B.sup.3).sub.i(C.sup.2).sub.j(B.sup.4).sub.k-A.sup.2 Formula II wherein A.sup.1 is a bond between the linker and A; A.sup.2 is a bond between B and the linker; each of B.sup.1, B.sup.2, B.sup.3, and B.sup.4 is, independently, optionally substituted C.sub.1-C.sub.2 alkyl, optionally substituted C.sub.1-C.sub.3 heteroalkyl, O, S, S(O).sub.2, or NR.sup.N; R.sup.N is H, optionally substituted C.sub.1-4 alkyl, optionally substituted C.sub.2-4 alkenyl, optionally substituted C.sub.2-4 alkynyl, optionally substituted C.sub.2-6 heterocyclyl, optionally substituted C.sub.6-12 aryl, or optionally substituted C.sub.1-7 heteroalkyl; each of C.sup.1 and C.sup.2 is, independently, carbonyl, thiocarbonyl, sulphonyl, or phosphoryl; f, g, h, l, j, and k are each, independently, 0 or 1; and D is optionally substituted C.sub.1-10 alkyl, optionally substituted C.sub.2-10 alkenyl, optionally substituted C.sub.2-10 alkynyl, optionally substituted C.sub.2-6 heterocyclyl, optionally substituted C.sub.6-12 aryl, optionally substituted C.sub.2-C.sub.10 polyethylene glycol, or optionally substituted C.sub.1-10 heteroalkyl, or a chemical bond linking A.sup.1-(B.sup.1).sub.f(C.sup.1).sub.g(B.sup.2).sub.h to (B.sup.3).sub.i(C.sup.2).sub.j(B.sup.4).sub.k-A.sup.2.

    16. The compound of claim 14, wherein the compound has the structure of any of compounds D1-D20 in Table 2.

    17. A pharmaceutical composition comprising the compound of claim 14 and a pharmaceutically acceptable excipient.

    18. A method of treating a cancer in a subject in need thereof, the method comprising administering to the subject an effective amount of a compound of claim 14, and optionally a pharmaceutically acceptable excipient.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0367] FIG. 1 is a series of graphs illustrating the effect of specific guide RNA (sgRNA) targeting of the BRD9 BAF complex subunit on synovial sarcoma cell growth. The Y-axis indicated the dropout ratio. The X-axis indicates the nucleotide position of the BRD9 gene. The grey box indicates the range of the negative control sgRNAs in the screen. The SYO1 cell line carries SS18-SSX2 fusion protein. The breakpoint joining the N-terminal region of SS18 to the C-terminal region of SSX2 are indicated by the black lines in their respective panel. The linear protein sequence is show with BRD9 PFAM domains annotated from the PFAM database.

    [0368] FIG. 2 is an image illustrating dose dependent depletion of BRD9 levels in a synovial sarcoma cell line (SYO1) in the presence of a BRD9 degrader.

    [0369] FIG. 3 is an image illustrating sustained suppression of BRD9 levels in a synovial sarcoma cell line (SYO1) in the presence of a BRD9 degrader over 72 hours.

    [0370] FIG. 4 is an image illustrating sustained suppression of BRD9 levels in two cell lines (293T and SYO1) in the presence of a BRD9 degrader over 5 days.

    [0371] FIG. 5 is an image illustrating sustained suppression of BRD9 levels in three synovial sarcoma cell lines (293T, SYO1, and Yamato) in the presence of a BRD9 degrader over 7 days compared to the levels in cells treated with CRISPR reagents.

    [0372] FIG. 6 is an image illustrating the effect on cell growth of six cell lines (SYO1, Yamato, A549, HS-SY-II, ASKA, and 293T) in the presence of a BRD9 degrader and a BRD9 inhibitor.

    [0373] FIG. 7 is an image illustrating the effect on cell growth of two cell lines (SYO1 and G401) in the presence of a BRD9 degrader.

    [0374] FIG. 8 is an image illustrating the effect on cell growth of three synovial sarcoma cell lines (SYO1, HS-SY-II, and ASKA) in the presence of a BRD9 degrader, BRD9 binder and E3 ligase binder.

    [0375] FIG. 9 is an image illustrating the effect on cell growth of three non-synovial sarcoma cell lines (RD, HCT116, and Calu6) in the presence of a BRD9 degrader, BRD9 binder and E3 ligase binder.

    [0376] FIG. 10 is a graph illustrating the percentage of SYO1 in various cell cycle phases following treatment with DMSO, Compound 1 at 200 nM, or Compound 1 at 1 ?M for 8 or 13 days.

    [0377] FIG. 11 is a series of contour plots illustrating the percentage of SYO1 cells in various cell cycle phases following treatment with DMSO, Compound 1 at 200 nM, Compound 1 at 1 ?M, or lenalidomide at 200 nM for 8 days. Numerical values corresponding to each contour plot are found in the table below.

    [0378] FIG. 12 is a series of contour plots illustrating the percentage of SYO1 cells in various cell cycle phases following treatment with DMSO, Compound 1 at 200 nM, Compound 1 at 1 ?M, or lenalidomide at 200 nM for 13 days. Numerical values corresponding to each contour plot are found in the table below.

    [0379] FIG. 13 is a series of contour plots illustrating the percentage of early- and late-apoptotic SYO1 cells following treatment with DMSO, Compound 1 at 200 nM, Compound 1 at 1 ?M, or lenalidomide at 200 nM for 8 days. Numerical values corresponding to each contour plot are found in the table below.

    [0380] FIG. 14 is a graph illustrating the proteins present in BAF complexes including the SS18-SSX fusion protein.

    DETAILED DESCRIPTION

    [0381] The present inventors have found that depletion of BRD9 in cancer cells results in the depletion of the SS18-SSX fusion protein and further inhibits the proliferation of the cancer cells.

    [0382] Accordingly, the invention features methods and compositions useful for the inhibition of the activity of the SS18-SSX fusion proteins, e.g., for the treatment of cancer such as adult soft tissue sarcomas. The invention further features methods and compositions useful for inhibition of the activity of the BRD9 protein, e.g., for the treatment of cancer such as adult soft tissue sarcomas, e.g., in a subject in need thereof. Exemplary methods are described herein.

    Compounds

    [0383] Agents described herein that reduce the level and/or activity of BRD9 in a cell may be an antibody, a protein (such as an enzyme), a polynucleotide, or a small molecule compound. The agents reduce the level of an activity related to BRD9, or a related downstream effect, or reduce the level of BRD9 in a cell or subject.

    Small Molecule Compounds

    [0384] In some embodiments of the invention, the agent that reduces the level and/or activity of BRD9 in a cell is a small molecule compound. In some embodiments, the small molecule compound is a structure of Formula I:


    A-L-B Formula I

    where A is a BRD9 binding moiety; L is a linker; and B is a degradation moiety, or a pharmaceutically acceptable salt thereof. In some embodiments, the degradation moiety is a ubiquitin ligase moiety. In some embodiments, the ubiquitin ligase binding moiety includes Cereblon ligands, IAP (Inhibitors of Apoptosis) ligands, mouse double minute 2 homolog (MDM2), hydrophobic tag, or von Hippel-Lindau ligands, or derivatives or analogs thereof.

    Pharmaceutical Uses

    [0385] The compounds described herein are useful in the methods of the invention and, while not bound by theory, are believed to exert their desirable effects through their ability to modulate the level, status, and/or activity of a BAF complex, e.g., by inhibiting the activity or level of the BRD9 protein in a cell within the BAF complex in a mammal.

    [0386] An aspect of the present invention relates to methods of treating disorders related to BRD9 such as cancer in a subject in need thereof. In some embodiments, the compound is administered in an amount and for a time effective to result in one of (or more, e.g., two or more, three or more, four or more of): (a) reduced tumor size, (b) reduced rate of tumor growth, (c) increased tumor cell death (d) reduced tumor progression, (e) reduced number of metastases, (f) reduced rate of metastasis, (g) decreased tumor recurrence (h) increased survival of subject, and (i) increased progression free survival of a subject.

    [0387] Treating cancer can result in a reduction in size or volume of a tumor. For example, after treatment, tumor size is reduced by 5% or greater (e.g., 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or greater) relative to its size prior to treatment. Size of a tumor may be measured by any reproducible means of measurement. For example, the size of a tumor may be measured as a diameter of the tumor.

    [0388] Treating cancer may further result in a decrease in number of tumors. For example, after treatment, tumor number is reduced by 5% or greater (e.g., 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or greater) relative to number prior to treatment. Number of tumors may be measured by any reproducible means of measurement, e.g., the number of tumors may be measured by counting tumors visible to the naked eye or at a specified magnification (e.g., 2?, 3?, 4?, 5?, 10?, or 50?).

    [0389] Treating cancer can result in a decrease in number of metastatic nodules in other tissues or organs distant from the primary tumor site. For example, after treatment, the number of metastatic nodules is reduced by 5% or greater (e.g., 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater) relative to number prior to treatment. The number of metastatic nodules may be measured by any reproducible means of measurement. For example, the number of metastatic nodules may be measured by counting metastatic nodules visible to the naked eye or at a specified magnification (e.g., 2?, 10?, or 50?).

    [0390] Treating cancer can result in an increase in average survival time of a population of subjects treated according to the present invention in comparison to a population of untreated subjects. For example, the average survival time is increased by more than 30 days (more than 60 days, 90 days, or 120 days). An increase in average survival time of a population may be measured by any reproducible means. An increase in average survival time of a population may be measured, for example, by calculating for a population the average length of survival following initiation of treatment with the compound described herein. An increase in average survival time of a population may also be measured, for example, by calculating for a population the average length of survival following completion of a first round of treatment with a pharmaceutically acceptable salt of a compound described herein.

    [0391] Treating cancer can also result in a decrease in the mortality rate of a population of treated subjects in comparison to an untreated population. For example, the mortality rate is decreased by more than 2% (e.g., more than 5%, 10%, or 25%). A decrease in the mortality rate of a population of treated subjects may be measured by any reproducible means, for example, by calculating for a population the average number of disease-related deaths per unit time following initiation of treatment with a pharmaceutically acceptable salt of a compound described herein. A decrease in the mortality rate of a population may also be measured, for example, by calculating for a population the average number of disease-related deaths per unit time following completion of a first round of treatment with a pharmaceutically acceptable salt of a compound described herein.

    Combination Therapies

    [0392] A method of the invention can be used alone or in combination with an additional therapeutic agent, e.g., other agents that treat cancer or symptoms associated therewith, or in combination with other types of therapies to treat cancer. In combination treatments, the dosages of one or more of the therapeutic compounds may be reduced from standard dosages when administered alone. For example, doses may be determined empirically from drug combinations and permutations or may be deduced by isobolographic analysis (e.g., Black et al., Neurology 65:S3-S6 (2005)). In this case, dosages of the compounds when combined should provide a therapeutic effect.

    [0393] In some embodiments, the second therapeutic agent is a chemotherapeutic agent (e.g., a cytotoxic agent or other chemical compound useful in the treatment of cancer). These include alkylating agents, antimetabolites, folic acid analogs, pyrimidine analogs, purine analogs and related inhibitors, vinca alkaloids, epipodopyyllotoxins, antibiotics, L-Asparaginase, topoisomerase inhibitors, interferons, platinum coordination complexes, anthracenedione substituted urea, methyl hydrazine derivatives, adrenocortical suppressant, adrenocorticosteroides, progestins, estrogens, antiestrogen, androgens, antiandrogen, and gonadotropin-releasing hormone analog. Also included is 5-fluorouracil (5-FU), leucovorin (LV), irenotecan, oxaliplatin, capecitabine, paclitaxel, and doxetaxel. Non-limiting examples of chemotherapeutic agents include alkylating agents such as thiotepa and cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analogue topotecan); bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues); cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogues, KW-2189 and CB1-TM1); eleutherobin; pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranimnustine; antibiotics such as the enediyne antibiotics (e.g., calicheamicin, especially calicheamicin gammall and calicheamicin omegall (see, e.g., Agnew, Chem. Intl. Ed Engl. 33:183-186 (1994)); dynemicin, including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antiobiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, caminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, ADRIAMYCIN? (doxorubicin, including morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elfomithine; elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; phenamet; pirarubicin; losoxantrone; podophyllinic acid; 2-ethylhydrazide; procarbazine; PSK? polysaccharide complex (JHS Natural Products, Eugene, OR); razoxane; rhizoxin; sizofuran; spirogermanium; tenuazonic acid; triaziquone; 2,2,2-trichlorotriethylamine; trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine); urethan; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside (Ara-C); cyclophosphamide; thiotepa; taxoids, e.g., TAXOL? (paclitaxel; Bristol-Myers Squibb Oncology, Princeton, NJ), ABRAXANE?, cremophor-free, albumin-engineered nanoparticle formulation of paclitaxel (American Pharmaceutical Partners, Schaumberg, IL), and TAXOTERE? doxetaxel (Rhone-Poulenc Rorer, Antony, France); chloranbucil; GEMZAR? gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum coordination complexes such as cisplatin, oxaliplatin and carboplatin; vinblastine; platinum; etoposide (VP-16); ifosfamide; mitoxantrone; vincristine; NAVELBINE? vinorelbine; novantrone; teniposide; edatrexate; daunomycin; aminopterin; xeloda; ibandronate; irinotecan (e.g., CPT-11); topoisomerase inhibitor RFS 2000; difluoromethylornithine (DMFO); retinoids such as retinoic acid; capecitabine; and pharmaceutically acceptable salts, acids or derivatives of any of the above. Two or more chemotherapeutic agents can be used in a cocktail to be administered in combination with the first therapeutic agent described herein. Suitable dosing regimens of combination chemotherapies are known in the art and described in, for example, Saltz et al., Proc. Am. Soc. Clin. Oncol. 18:233a (1999), and Douillard et al., Lancet 355(9209):1041-1047 (2000).

    [0394] In some embodiments, the second therapeutic agent is a therapeutic agent which is a biologic such a cytokine (e.g., interferon or an interleukin (e.g., IL-2)) used in cancer treatment. In some embodiments the biologic is an anti-angiogenic agent, such as an anti-VEGF agent, e.g., bevacizumab (AVASTIN?). In some embodiments the biologic is an immunoglobulin-based biologic, e.g., a monoclonal antibody (e.g., a humanized antibody, a fully human antibody, an Fc fusion protein or a functional fragment thereof) that agonizes a target to stimulate an anti-cancer response, or antagonizes an antigen important for cancer. Such agents include RITUXAN? (rituximab); ZENAPAX? (daclizumab); SIMULECT? (basiliximab); SYNAGIS? (palivizumab); REMICADE? (infliximab); HERCEPTIN? (trastuzumab); MYLOTARG? (gemtuzumab ozogamicin); CAMPATH? (alemtuzumab); ZEVALIN? (ibritumomab tiuxetan); HUMIRA? (adalimumab); XOLAIR? (omalizumab); BEXXAR? (tositumomab-I-131); RAPTIVA? (efalizumab); ERBITUX? (cetuximab); AVASTIN? (bevacizumab); TYSABRI? (natalizumab); ACTEMRA? (tocilizumab); VECTIBIX? (panitumumab); LUCENTIS? (ranibizumab); SOLIRIS? (eculizumab); CIMZIA? (certolizumab pegol); SIMPONI? (golimumab); ILARIS? (canakinumab); STELARA? (ustekinumab); ARZERRA? (ofatumumab); PROLIA? (denosumab); NUMAX? (motavizumab); ABTHRAX? (raxibacumab); BENLYSTA? (belimumab); YERVOY? (ipilimumab); ADCETRIS? (brentuximab vedotin); PERJETA? (pertuzumab); KADCYLA? (ado-trastuzumab emtansine); and GAZYVA? (obinutuzumab). Also included are antibody-drug conjugates.

    [0395] The second agent may be a therapeutic agent which is a non-drug treatment. For example, the second therapeutic agent is radiation therapy, cryotherapy, hyperthermia, and/or surgical excision of tumor tissue.

    [0396] The second agent may be a checkpoint inhibitor. In one embodiment, the inhibitor of checkpoint is an inhibitory antibody (e.g., a monospecific antibody such as a monoclonal antibody). The antibody may be, e.g., humanized or fully human. In some embodiments, the inhibitor of checkpoint is a fusion protein, e.g., an Fc-receptor fusion protein. In some embodiments, the inhibitor of checkpoint is an agent, such as an antibody, that interacts with a checkpoint protein. In some embodiments, the inhibitor of checkpoint is an agent, such as an antibody, that interacts with the ligand of a checkpoint protein. In some embodiments, the inhibitor of checkpoint is an inhibitor (e.g., an inhibitory antibody or small molecule inhibitor) of CTLA-4 (e.g., an anti-CTLA4 antibody or fusion a protein such as ipilimumab/YERVOY? or tremelimumab). In some embodiments, the inhibitor of checkpoint is an inhibitor (e.g., an inhibitory antibody or small molecule inhibitor) of PD-1 (e.g., nivolumab/OPDIVO?; pembrolizumab/KEYTRUDA?; pidilizumab/CT-011). In some embodiments, the inhibitor of checkpoint is an inhibitor (e.g., an inhibitory antibody or small molecule inhibitor) of PDL1 (e.g., MPDL3280A/RG7446; MED14736; MSB0010718C; BMS 936559). In some embodiments, the inhibitor of checkpoint is an inhibitor (e.g., an inhibitory antibody or Fc fusion or small molecule inhibitor) of PDL2 (e.g., a PDL2/Ig fusion protein such as AMP 224). In some embodiments, the inhibitor of checkpoint is an inhibitor (e.g., an inhibitory antibody or small molecule inhibitor) of B7-H3 (e.g., MGA271), B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR, B-7 family ligands, or a combination thereof.

    [0397] In some embodiments, the anti-cancer therapy is a T cell adoptive transfer (ACT) therapy. In some embodiments, the T cell is an activated T cell. The T cell may be modified to express a chimeric antigen receptor (CAR). CAR modified T (CAR-T) cells can be generated by any method known in the art. For example, the CAR-T cells can be generated by introducing a suitable expression vector encoding the CAR to a T cell. Prior to expansion and genetic modification of the T cells, a source of T cells is obtained from a subject. T cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. In certain embodiments of the present invention, any number of T cell lines available in the art, may be used. In some embodiments, the T cell is an autologous T cell. Whether prior to or after genetic modification of the T cells to express a desirable protein (e.g., a CAR), the T cells can be activated and expanded generally using methods as described, for example, in U.S. Pat. Nos. 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041; and U.S. Patent Application Publication No. 20060121005.

    [0398] In any of the combination embodiments described herein, the first and second therapeutic agents are administered simultaneously or sequentially, in either order. The first therapeutic agent may be administered immediately, up to 1 hour, up to 2 hours, up to 3 hours, up to 4 hours, up to 5 hours, up to 6 hours, up to 7 hours, up to, 8 hours, up to 9 hours, up to 10 hours, up to 11 hours, up to 12 hours, up to 13 hours, 14 hours, up to hours 16, up to 17 hours, up 18 hours, up to 19 hours up to 20 hours, up to 21 hours, up to 22 hours, up to 23 hours up to 24 hours or up to 1-7, 1-14, 1-21 or 1-30 days before or after the second therapeutic agent.

    Pharmaceutical Compositions

    [0399] The pharmaceutical compositions described herein are preferably formulated into pharmaceutical compositions for administration to human subjects in a biologically compatible form suitable for administration in vivo.

    [0400] The compounds described herein may be used in the form of the free base, in the form of salts, solvates, and as prodrugs. All forms are within the methods described herein. In accordance with the methods of the invention, the described compounds or salts, solvates, or prodrugs thereof may be administered to a patient in a variety of forms depending on the selected route of administration, as will be understood by those skilled in the art. The compounds described herein may be administered, for example, by oral, parenteral, buccal, sublingual, nasal, rectal, patch, pump, intratumoral, or transdermal administration and the pharmaceutical compositions formulated accordingly. Parenteral administration includes intravenous, intraperitoneal, subcutaneous, intramuscular, transepithelial, nasal, intrapulmonary, intrathecal, rectal, and topical modes of administration. Parenteral administration may be by continuous infusion over a selected period of time.

    [0401] A compound described herein may be orally administered, for example, with an inert diluent or with an assimilable edible carrier, or it may be enclosed in hard or soft shell gelatin capsules, or it may be compressed into tablets, or it may be incorporated directly with the food of the diet. For oral therapeutic administration, a compound described herein may be incorporated with an excipient and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, and wafers. A compound described herein may also be administered parenterally. Solutions of a compound described herein can be prepared in water suitably mixed with a surfactant, such as hydroxypropylcellulose. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, DMSO, and mixtures thereof with or without alcohol, and in oils. Under ordinary conditions of storage and use, these preparations may contain a preservative to prevent the growth of microorganisms. Conventional procedures and ingredients for the selection and preparation of suitable formulations are described, for example, in Remington's Pharmaceutical Sciences (2012, 22nd ed.) and in The United States Pharmacopeia: The National Formulary (USP 41 NF36), published in 2018. The pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. In all cases the form must be sterile and must be fluid to the extent that may be easily administered via syringe. Compositions for nasal administration may conveniently be formulated as aerosols, drops, gels, and powders. Aerosol formulations typically include a solution or fine suspension of the active substance in a physiologically acceptable aqueous or non-aqueous solvent and are usually presented in single or multidose quantities in sterile form in a sealed container, which can take the form of a cartridge or refill for use with an atomizing device. Alternatively, the sealed container may be a unitary dispensing device, such as a single dose nasal inhaler or an aerosol dispenser fitted with a metering valve which is intended for disposal after use. Where the dosage form includes an aerosol dispenser, it will contain a propellant, which can be a compressed gas, such as compressed air or an organic propellant, such as fluorochlorohydrocarbon. The aerosol dosage forms can also take the form of a pump-atomizer. Compositions suitable for buccal or sublingual administration include tablets, lozenges, and pastilles, where the active ingredient is formulated with a carrier, such as sugar, acacia, tragacanth, gelatin, and glycerine. Compositions for rectal administration are conveniently in the form of suppositories containing a conventional suppository base, such as cocoa butter. A compound described herein may be administered intratumorally, for example, as an intratumoral injection. Intratumoral injection is injection directly into the tumor vasculature and is specifically contemplated for discrete, solid, accessible tumors. Local, regional, or systemic administration also may be appropriate. A compound described herein may advantageously be contacted by administering an injection or multiple injections to the tumor, spaced for example, at approximately, 1 cm intervals. In the case of surgical intervention, the present invention may be used preoperatively, such as to render an inoperable tumor subject to resection. Continuous administration also may be applied where appropriate, for example, by implanting a catheter into a tumor or into tumor vasculature.

    [0402] The compounds described herein may be administered to an animal, e.g., a human, alone or in combination with pharmaceutically acceptable carriers, as noted herein, the proportion of which is determined by the solubility and chemical nature of the compound, chosen route of administration, and standard pharmaceutical practice.

    Dosages

    [0403] The dosage of the compounds described herein, and/or compositions including a compound described herein, can vary depending on many factors, such as the pharmacodynamic properties of the compound; the mode of administration; the age, health, and weight of the recipient; the nature and extent of the symptoms; the frequency of the treatment, and the type of concurrent treatment, if any; and the clearance rate of the compound in the animal to be treated. One of skill in the art can determine the appropriate dosage based on the above factors. The compounds described herein may be administered initially in a suitable dosage that may be adjusted as required, depending on the clinical response. In general, satisfactory results may be obtained when the compounds described herein are administered to a human at a daily dosage of, for example, between 0.05 mg and 3000 mg (measured as the solid form). Dose ranges include, for example, between 10-1000 mg (e.g., 50-800 mg). In some embodiments, 50, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, or 1000 mg of the compound is administered.

    [0404] Alternatively, the dosage amount can be calculated using the body weight of the patient. For example, the dose of a compound, or pharmaceutical composition thereof, administered to a patient may range from 0.1-50 mg/kg (e.g., 0.25-25 mg/kg). In exemplary, non-limiting embodiments, the dose may range from 0.5-5.0 mg/kg (e.g., 0.5, 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, or 5.0 mg/kg) or from 5.0-20 mg/kg (e.g., 5.5, 6.0, 6.5, 7.0, 7.5, 8.0, 8.5, 9.0, 9.5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 mg/kg).

    Kits

    [0405] The invention also features kits including (a) a pharmaceutical composition including an agent that reduces the level and/or activity of BRD9 in a cell or subject described herein, and (b) a package insert with instructions to perform any of the methods described herein. In some embodiments, the kit includes (a) a pharmaceutical composition including an agent that reduces the level and/or activity of BRD9 in a cell or subject described herein, (b) an additional therapeutic agent (e.g., an anti-cancer agent), and (c) a package insert with instructions to perform any of the methods described herein.

    EXAMPLES

    Example 1High Density Tiling sgRNA Screen Against Human BAF Complex Subunits in Synovial Sarcoma Cell Line SYO1

    [0406] The following example shows that BRD9 sgRNA inhibits cell growth in synovial sarcoma cells.

    [0407] Procedure: To perform high density sgRNA tiling screen, an sgRNA library against BAF complex subunits was custom synthesized at Cellecta (Mountain View, CA). Sequences of DNA encoding the BRD9-targeting sgRNAs used in this screen are listed in Table 3. Negative and positive control sgRNA were included in the library. Negative controls consisted of 200 sgRNAs that do not target human genome. The positive controls are sgRNAs targeting essential genes (CDC16, GTF2B, HSPA5, HSPA9, PAFAH1B1, PCNA, POLR2L, RPL9, and SF3A3). DNA sequences encoding all positive and negative control sgRNAs are listed in Table 4. Procedures for virus production, cell infection, and performing the sgRNA screen were previously described (Tsherniak et al, Cell 170:564-576 (2017); Munoz et al, Cancer Discovery 6:900-913 (2016)). For each sgRNA, 50 counts were added to the sequencing counts and for each time point the resulting counts were normalized to the total number of counts. The log 2 of the ratio between the counts (defined as dropout ratio) at day 24 and day 1 post-infection was calculated. For negative control sgRNAs, the 2.5 and 97.5 percentile of the log 2 dropout ratio of all non-targeting sgRNAs was calculated and considered as background (grey box in the graph). Protein domains were obtained from PFAM regions defined for the UNIPROT identifier: Q9H8M2.

    [0408] Results: As shown in FIG. 1, targeted inhibition of the GBAF complex component BRD9 by sgRNA resulted in growth inhibition of the SYO1 synovial sarcoma cell line. sgRNAs against other components of the BAF complexes resulted in increased proliferation of cells, inhibition of cell growth, or had no effect on SYO1 cells. These data show that targeting various subunits of the GBAF complex represents a therapeutic strategy for the treatment of synovial sarcoma.

    TABLE-US-00003 TABLE3 BRD9sgRNALibrary SEQID NucleicAcid NO Sequence 203 CAAGAAGCACAAGAAGCACA 204 CTTGTGCTTCTTGCCCATGG 205 CTTCTTGTGCTTCTTGCCCA 206 ACAAGAAGCACAAGGCCGAG 207 CTCGTAGGACGAGCGCCACT 208 CGAGTGGCGCTCGTCCTACG 209 GAGTGGCGCTCGTCCTACGA 210 AGGCTTCTCCAGGGGCTTGT 211 AGATTATGCCGACAAGCCCC 212 ACCTTCAGGACTAGCTTTAG 213 AGCTTTAGAGGCTTCTCCAG 214 CTAGCTTTAGAGGCTTCTCC 215 TAGCTTTAGAGGCTTCTCCA 216 CTAAAGCTAGTCCTGAAGGT 217 GCCTCTAAAGCTAGTCCTGA 218 CTTCACTTCCTCCGACCTTC 219 AAGCTAGTCCTGAAGGTCGG 220 AGTGAAGTGACTGAACTCTC 221 GTGACTGAACTCTCAGGATC 222 ATAGTAACTGGAGTCGTGGC 223 CATCATAGTAACTGGAGTCG 224 TGACCTGTCATCATAGTAAC 225 ACTCCAGTTACTATGATGAC 226 CTTTGTGCCTCTCTCGCTCA 227 GGTCAGACCATGAGCGAGAG 228 GAAGAAGAAGAAGTCCGAGA 229 GTCCAGATGCTTCTCCTTCT 230 GTCCGAGAAGGAGAAGCATC 231 GGAGAAGCATCTGGACGATG 232 TGAGGAAAGAAGGAAGCGAA 233 ATCTGGACGATGAGGAAAGA 234 AGAAGAAGCGGAAGCGAGAG 235 GAAGAAGCGGAAGCGAGAGA 236 CCGCCCAGGAAGAGAAGAAG 237 AGAGAGGGAGCACTGTGACA 238 AGGGAGCACTGTGACACGGA 239 GAGGGAGCACTGTGACACGG 240 GCACTGTGACACGGAGGGAG 241 GAGGCTGACGACTTTGATCC 242 AGGCTGACGACTTTGATCCT 243 TCCACCTCCACCTTCTTCCC 244 CGACTTTGATCCTGGGAAGA 245 CTTTGATCCTGGGAAGAAGG 246 TGATCCTGGGAAGAAGGTGG 247 TCCTGGGAAGAAGGTGGAGG 248 CGGACTGGCCGATCTGGGGG 249 ACGCTCGGACTGGCCGATCT 250 AGGTGGAGCCGCCCCCAGAT 251 CGCTCGGACTGGCCGATCTG 252 GCTCGGACTGGCCGATCTGG 253 CACGCTCGGACTGGCCGATC 254 TGTGTCCGGCACGCTCGGAC 255 CTGGCTGTGTCCGGCACGCT 256 ATCGGCCAGTCCGAGCGTGC 257 CACCCTTGCCTGGCTGTGTC 258 CGAGCGTGCCGGACACAGCC 259 TGTTCCAGGAGTTGCTGAAT 260 CACACCTATTCAGCAACTCC 261 GCTGGCGGAGGAAGTGTTCC 262 TTTACCTCTGAAGCTGGCGG 263 CCCCGGTTTACCTCTGAAGC 264 ACTTCCTCCGCCAGCTTCAG 265 CAGGAAAAGCAAAAAATCCA 266 GCTTTCAGAAAAGATCCCCA 267 AGGAAAAGCAAAAAATCCAT 268 GGAAAAGCAAAAAATCCATG 269 GGAGCAATTGCATCCGTGAC 270 GTCACGGATGCAATTGCTCC 271 TTTATTATCATTGAATATCC 272 AATGATAATAAAACATCCCA 273 ATAAAACATCCCATGGATTT 274 TTCATGGTGCCAAAATCCAT 275 TTTCATGGTGCCAAAATCCA 276 TAATGAATACAAGTCAGTTA 277 CAAGTCAGTTACGGAATTTA 278 ATAATGCAATGACATACAAT 279 AACTTGTAGTACACGGTATC 280 CTTCGCCAACTTGTAGTACA 281 AGATACCGTGTACTACAAGT 282 GCGAAGAAGATCCTTCACGC 283 TCATCTTAAAGCCTGCGTGA 284 TTCTCAGCAGGCAGCTCTTT 285 CAATGAAGATACAGCTGTTG 286 ACTGGTACAACTTCAGGGAC 287 CTTGTACTGGTACAACTTCA 288 ACTTGTACTGGTACAACTTC 289 TTGGCAGTTTCTACTTGTAC 290 TACCTGATAACTTCTCTACT 291 AGCCGAGTAGAGAAGTTATC 292 AGCTGCATGTTTGAGCCTGA 293 GCTGCATGTTTGAGCCTGAA 294 AAGCTGCAGGCATTCCCTTC 295 GGTACTGTCCGTCAAGCTGC 296 AGGGAATGCCTGCAGCTTGA 297 CTTGACGGACAGTACCGCAG 298 CGCCAGCACGTGCTCCTCTG 299 TACCGCAGAGGAGCACGTGC 300 AGAGGAGCACGTGCTGGCGC 301 GGAGCACGTGCTGGCGCTGG 302 AGCACGCAGCTGACGAAGCT 303 GCACGCAGCTGACGAAGCTC 304 CAGCTGACGAAGCTCGGGAC 305 AAGCTCGGGACAGGATCAAC 306 CCTTGCCGCCTGGGAGGAAC 307 AGGATCAACCGGTTCCTCCC 308 ATCAACCGGTTCCTCCCAGG 309 GCACTACCTTGCCGCCTGGG 310 AGAGCACTACCTTGCCGCCT 311 CCGGTTCCTCCCAGGCGGCA 312 TCCTCTTCAGATAGCCCATC 313 ATGGGCTATCTGAAGAGGAA 314 GGGCTATCTGAAGAGGAACG 315 TGGGCTATCTGAAGAGGAAC 316 TATCTGAAGAGGAACGGGGA 317 ATCTGAAGAGGAACGGGGAC 318 TGTTGACCACGCTGTAGAGC 319 GCTCTACAGCGTGGTCAACA 320 CGGGAGCCTGCTCTACAGCG 321 CGTGGTCAACACGGCCGAGC 322 CCCACCATCAGCGTCCGGCT 323 ACGGCCGAGCCGGACGCTGA 324 GGGCACCCACCATCAGCGTC 325 GCCGAGCCGGACGCTGATGG 326 CCATGTCCGTGTTGCAGAGG 327 CCGAGCCGGACGCTGATGGT 328 CGAGCTCAAGTCCACCGGGT 329 GCGAGCTCAAGTCCACCGGG 330 AGAGCGAGCTCAAGTCCACC 331 GAGAGCGAGCTCAAGTCCAC 332 GAAGCCTGGGAGTAGCTTAC 333 CTCTCCAGTAAGCTACTCCC 334 AGCCCAGCGTGGTGAAGCCT 335 AAGCCCAGCGTGGTGAAGCC 336 ACTCCCAGGCTTCACCACGC 337 CTCCCAGGCTTCACCACGCT 338 CTCGTCTTTGAAGCCCAGCG 339 CACTGGAGAGAAAGGTGACT 340 GCACTGGAGAGAAAGGTGAC 341 AGTAGTGGCACTGGAGAGAA 342 CGAAAGCGCAGTAGTGGCAC 343 CTGCATCGAAAGCGCAGTAG 344 ATGCAGAATAATTCAGTATT 345 AGTATTTGGCGACTTGAAGT 346 CGACTTGAAGTCGGACGAGA 347 GAGCTGCTCTACTCAGCCTA 348 CACGCCTGTCTCATCTCCGT 349 TCAGCCTACGGAGATGAGAC 350 CAGGCGTGCAGTGTGCGCTG 351 CCGCGGCCCCTCTAGCCTGC 352 CATCCTTCACAAACTCCTGC 353 TAGCCTGCAGGAGTTTGTGA 354 CAGGAGTTTGTGAAGGATGC 355 AGGAGTTTGTGAAGGATGCT 356 TGGGAGCTACAGCAAGAAAG 357 GAGCTACAGCAAGAAAGTGG 358 GAAAGTGGTGGACGACCTCC 359 CGCCTGTGATCTGGTCCAGG 360 CTCCGCCTGTGATCTGGTCC 361 GACCTCCTGGACCAGATCAC 362 CTCCTGGACCAGATCACAGG 363 GCTGGAAGAGCGTCCTAGAG 364 TGCAGCCCACCTGCTTCAGC 365 GACGCTCTTCCAGCTGAAGC 366 CTCTTCCAGCTGAAGCAGGT 367 GCTCTTCCAGCTGAAGCAGG 368 CCTCCAGATGAAGCCAAGGT 369 GCTTCATCTGGAGGCTTCAT 370 GGCTTCATCTGGAGGCTTCA 371 CTTACCTTGGCTTCATCTGG 372 AAACTTACCTTGGCTTCATC 373 GAAGCCTCCAGATGAAGCCA 374 TCCTAGGGTGTCCCCAACCT 375 CCTAGGGTGTCCCCAACCTG 376 GTGTCTGTCTCCACAGGTTG 377 TGTGTCTGTCTCCACAGGTT 378 CCACAGGTTGGGGACACCCT 379 AGAGCTGCTGCTGTCTCCTA 380 CAGAGCTGCTGCTGTCTCCT 381 AGACAGCAGCAGCTCTGTTC 382 ATCCACAGAAACGTCGGGAT 383 GAGATATCCACAGAAACGTC 384 GGAGATATCCACAGAAACGT 385 GTCCTATCCCGACGTTTCTG 386 TCTCCATGCTCAGCTCTCTG 387 CTCACCCAGAGAGCTGAGCA 388 ATCTCCATGCTCAGCTCTCT 389 TATCTCCATGCTCAGCTCTC 390 ATGTCCTGTTTACACAGGGA 391 TTACACAGGGAAGGTGAAGA 392 AGTTCAAATGGCTGTCGTCA 393 TGACGACAGCCATTTGAACT 394 AAGTTCAAATGGCTGTCGTC 395 TCGTCTCATCCAAGTTCAAA 396 TGAGACGACGAAGCTCCTGC 397 GTGCTTCGTGCAGGTCCTGC 398 GCAGGACCTGCACGAAGCAC 399 GCTCCGCCTGTGCTTCGTGC 400 GGACCTGCACGAAGCACAGG 401 CACGAAGCACAGGCGGAGCG 402 AGGCGGAGCGCGGCGGCTCT 403 AGGGAGCTGAGGTTGGACGA 404 GTTGGACAGGGAGCTGAGGT 405 AGGCGTTGGACAGGGAGCTG 406 CCCTCTCGGAGGCGTTGGAC 407 CCTCTCGGAGGCGTTGGACA 408 CTGGTCCCTCTCGGAGGCGT 409 CCCTGTCCAACGCCTCCGAG 410 CCTGTCCAACGCCTCCGAGA 411 GTGGTGCTGGTCCCTCTCGG 412 CAGGTGGTGCTGGTCCCTCT 413 GCATCTCACCCAGGTGGTGC 414 CGAGAGGGACCAGCACCACC 415 GAGAGGGACCAGCACCACCT 416 GTGGGGGCATCTCACCCAGG 417 CCCCGACACTCAGGCGAGAA 418 TCCCCGACACTCAGGCGAGA 419 AGCCCTTCTCGCCTGAGTGT 420 CTGGCTGCTCCCCGACACTC 421 CCCTTCTCGCCTGAGTGTCG 422 GCCCTTCTCGCCTGAGTGTC 423 TAGGGGTCGTGGGTGACGTC 424 AAGAAACTCATAGGGGTCGT 425 GAAGAAACTCATAGGGGTCG 426 GAGACTGAAGAAACTCATAG 427 GGAGACTGAAGAAACTCATA 428 TGGAGACTGAAGAAACTCAT 429 TCTTCAGTCTCCAGAGCCTG 430 TTGGCAGAGGCCGCAGGCTC 431 TAGGTCTTGGCAGAGGCCGC 432 CTAGAGTTAGGTCTTGGCAG 433 GGTGGTCTAGAGTTAGGTCT

    TABLE-US-00004 TABLE4 ControlsgRNALibrary SEQ ID NO. gRNALabel Gene NucleicAcidSequence 434 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTAGCGAACGTGTCCGGCGT 001|Non_Targeting_Human 435 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GACCGGAACGATCTCGCGTA 002|Non_Targeting_Human 436 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GGCAGTCGTTCGGTTGATAT 003|Non_Targeting_Human 437 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCTTGAGCACATACGCGAAT 004|Non_TargctingHuman 438 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTGGTAGAATAACGTATTAC 005|Non_Targeting_Human 439 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTCATACATGGATAAGGCTA 006|Non_Targeting_Human 440 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GATACACGAAGCATCACTAG 007|Non_Targeting_Human 441 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GAACGTTGGCACTACTTCAC 008|Non_TargctingHuman 442 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GATCCATGTAATGCGTTCGA 009|Non_Targeting_Human 443 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTCGTGAAGTGCATTCGATC 010|Non_Targeting_Human 444 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTTCGACTCGCGTGACCGTA 011|Non_Targeting_Human 445 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GAATCTACCGCAGCGGTTCG 012|Non_Targeting_Human 446 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GAAGTGACGTCGATTCGATA 013|Non_Targeting_Human 447 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCGGTGTATGACAACCGCCG 014|Non_Targeting_Human 448 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTACCGCGCCTGAAGTTCGC 015|Non_Targeting_Human 449 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCAGCTCGTGTGTCGTACTC 016|Non_Targeting_Human 450 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCGCCTTAAGAGTACTCATC 017|Non_Targeting_Human 451 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GAGTGTCGTCGTTGCTCCTA 018|Non_Targeting_Human 452 1|sg_Non_Targeting_Human_00 Non_Targeting_Human GCAGCTCGACCTCAAGCCGT 019|Non_Targeting_Human 453 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTATCCTGACCTACGCGCTG 020|Non_Targeting_Human 454 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTGTATCTCAGCACGCTAAC 021|Non_Targeting_Human 455 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTCGTCATACAACGGCAACG 022|Non_Targeting_Human 456 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTCGTGCGCTTCCGGCGGTA 023|Non_Targeting_Human 457 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCGGTCCTCAGTAAGCGCGT 024|Non_Targeting_Human 458 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCTCTGCTGCGGAAGGATTC 025|Non_Targeting_Human 459 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCATGGAGGAGCGTCGCAGA 026|Non_TargetingHuman 460 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTAGCGCGCGTAGGAGTGGC 027|Non_Targeting_Human 461 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GATCACCTGCATTCGTACAC 028|Non_Targeting_Human 462 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCACACCTAGATATCGAATG 029|Non_Targeting_Human 463 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTTGATCAACGCGCTTCGCG 030|Non_Targeting_Human 464 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCGTCTCACTCACTCCATCG 031|Non_Targeting_Human 465 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCCGACCAACGTCAGCGGTA 032|Non_Targeting_Human 466 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GGATACGGTGCGTCAATCTA 033|Non_Targeting_Human 467 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GAATCCAGTGGCGGCGACAA 034|Non_Targeting_Human 468 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCACTGTCAGTGCAACGATA 035|Non_Targeting_Human 469 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCGATCCTCAAGTATGCTCA 036|Non_Targeting_Human 470 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCTAATATCGACACGGCCGC 037|Non_Targeting_Human 471 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GGAGATGCATCGAAGTCGAT 038|Non_Targeting_Human 472 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GGATGCACTCCATCTCGTCT 039|Non_Targeting_Human 473 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTGCCGAGTAATAACGCGAG 040|Non_Targeting_Human 474 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GAGATTCCGATGTAACGTAC 041|Non_Targeting_Human 475 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTCGTCACGAGCAGGATTGC 042|Non_Targeting_Human 476 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCGTTAGTCACTTAGCTCGA 043|Non_Targeting_Human 477 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTTCACACGGTGTCGGATAG 044|Non_Targeting_Human 478 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GGATAGGTGACCTTAGTACG 045|Non_Targeting_Human 479 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTATGAGTCAAGCTAATGCG 046|Non_Targeting_Human 480 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCAACTATTGGAATACGTGA 047|Non_Targeting_Human 481 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTTACCTTCGCTCGTCTATA 048|Non_Targeting_Human 482 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTACCGAGCACCACAGGCCG 049|Non_Targeting_Human 483 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTCAGCCATCGGATAGAGAT 050|Non_Targeting_Human 484 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTACGGCACTCCTAGCCGCT 051|Non_Targeting_Human 485 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GGTCCTGTCGTATGCTTGCA 052|Non_Targeting_Human 486 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCCGCAATATATGCGGTAAG 053|Non_Targeting_Human 487 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCGCACGTATAATCCTGCGT 054|Non_Targeting_Human 488 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTGCACAACACGATCCACGA 055|Non_Targeting_Human 489 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCACAATGTTGACGTAAGTG 056|Non_Targeting_Human 490 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTAAGATGCTGCTCACCGTG 057|Non_Targeting_Human 491 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTCGGTGATCCAACGTATCG 058|Non_Targeting_Human 492 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GAGCTAGTAGGACGCAAGAC 059|Non_Targeting_Human 493 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTACGTGGAAGCTTGTGGCC 060|Non_Targeting_Human 494 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GAGAACTGCCAGTTCTCGAT 061|Non_Targeting_Human 495 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCCATTCGGCGCGGCACTTC 062|Non_Targeting_Human 496 l|sg_Non_Targeting_Human_0 Non_Targeting_Human GCACACGACCAATCCGCTTC 063|Non_Targeting_Human 497 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GAGGTGATCGATTAAGTACA 064|Non_Targeting_Human 498 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTCACTCGCAGACGCCTAAC 065|Non_Targeting_Human 499 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCGCTACGGAATCATACGTT 066|Non_Targeting_Human 500 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GGTAGGACCTCACGGCGCGC 067|Non_Targeting_Human 501 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GAACTGCATCTTGTTGTAGT 068|Non_Targeting_Human 502 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GATCCTGATCCGGCGGCGCG 069|Non_Targeting_Human 503 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GGTATGCGCGATCCTGAGTT 070|Non_Targeting_Human 504 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCGGAGCTAGAGAGCGGTCA 071|Non_Targeting_Human 505 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GAATGGCAATTACGGCTGAT 072|Non_Targeting_Human 506 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTATGGTGAGTAGTCGCTTG 073|Non_Targeting_Human 507 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTGTAATTGCGTCTAGTCGG 074|Non_Targeting_Human 508 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GGTCCTGGCGAGGAGCCTTG 075|Non_Targeting_Human 509 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GAAGATAAGTCGCTGTCTCG 076|Non_Targeting_Human 510 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTCGGCGTTCTGTTGTGACT 077|Non_Targeting_Human 511 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GAGGCAAGCCGTTAGGTGTA 078|Non_Targeting_Human 512 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCGGATCCAGATCTCATTCG 079|Non_Targeting_Human 513 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GGAACATAGGAGCACGTAGT 080|Non_Targeting_Human 514 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTCATCATTATGGCGTAAGG 081|Non_Targeting_Human 515 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCGACTAGCGCCATGAGCGG 082|Non_Targeting_Human 516 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GGCGAAGTTCGACATGACAC 083|Non_Targeting_Human 517 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCTGTCGTGTGGAGGCTATG 084|Non_Targeting_Human 518 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCGGAGAGCATTGACCTCAT 085|Non_Targeting_Human 519 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GACTAATGGACCAAGTCAGT 086|Non_Targeting_Human 520 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCGGATTAGAGGTAATGCGG 087|Non_Targeting_Human 521 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCCGACGGCAATCAGTACGC 088|Non_Targeting_Human 522 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTAACCTCTCGAGCGATAGA 089|Non_Targeting_Human 523 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GACTTGTATGTGGCTTACGG 090|Non_Targeting_Human 524 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTCACTGTGGTCGAACATGT 091|Non_Targeting_Human 525 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTACTCCAATCCGCGATGAC 092|Non_Targeting_Human 526 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCGTTGGCACGATGTTACGG 093|Non_Targeting_Human 527 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GAACCAGCCGGCTAGTATGA 094|Non_Targeting_Human 528 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GTATACTAGCTAACCACACG 095|Non_Targeting_Human 529 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GAATCGGAATAGTTGATTCG 096|Non_Targeting_Human 530 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GAGCACTTGCATGAGGCGGT 097|Non_Targeting_Human 531 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GAACGGCGATGAAGCCAGCC 098|Non_Targeting_Human 532 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCAACCGAGATGAGAGGTTC 099|Non_Targeting_Human 533 1|sg_Non_Targeting_Human_0 Non_Targeting_Human GCAAGATCAATATGCGTGAT 100|Non_Targeting_Human 534 1|sg_Non_Targeting_Human_G Non_Targeting_Human ACGGAGGCTAAGCGTCGCAA A_0101|Non_Targeting_Human 535 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGCTTCCGCGGCCCGTTCAA A_0102|Non_Targeting_Human 536 1|Non_Targeting_Human_G Non_Targeting_Human ATCGTTTCCGCTTAACGGCG A_0103|Non_Targeting_Human 537 1|sg_Non_Targeting_Human_G Non_Targeting_Human GTAGGCGCGCCGCTCTCTAC A_0104|Non_Targeting_Human 538 1|sg_Non_Targeting_Human_G Non_Targeting_Human CCATATCGGGGCGAGACATG A_0105|Non_Targeting_Human 539 1|sg_Non_Targeting_Human_G Non_Targeting_Human TACTAACGCCGCTCCTACAG A_0106|Non_Targeting_Human 540 1|sg_Non_Targeting_Human_G Non_Targeting_Human TGAGGATCATGTCGAGCGCC A_0107|Non_Targeting_Human 541 1|sg_Non_Targeting_Human_G Non_Targeting_Human GGGCCCGCATAGGATATCGC A_0108|Non_Targeting_Human 542 1|sg_Non_Targeting_Human_G Non_Targeting_Human TAGACAACCGCGGAGAATGC A_0109|Non_Targeting_Human 543 1|sg_Non_Targeting_Human_G Non_Targeting_Human ACGGGCGGCTATCGCTGACT A_0110|Non_Targeting_Human 544 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGCGGAAATTTTACCGACGA A_0111|Non_Targeting_Human 545 1|sg_Non_Targeting_Human_G Non_Targeting_Human CTTACAATCGTCGGTCCAAT A_0112|Non_Targeting_Human 546 1|sg_Non_Targeting_Human_G Non_Targeting_Human GCGTGCGTCCCGGGTTACCC A_0113|Non_Targeting_Human 547 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGGAGTAACAAGCGGACGGA A_0114|Non_Targeting_Human 548 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGAGTGTTATACGCACCGTT A_0115|Non_Targeting_Human 549 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGACTAACCGGAAACTTTTT A_0116|Non_Targeting_Human 550 1|sg_Non_Targeting_Human_G Non_Targeting_Human CAACGGGTTCTCCCGGCTAC A_0117|Non_Targeting_Human 551 1|sg_Non_Targeting_Human_G Non_Targeting_Human CAGGAGTCGCCGATACGCGT A_0118|Non_Targeting_Human 552 1|sg_Non_Targeting_Human_G Non_Targeting_Human TTCACGTCGTCTCGCGACCA A_0119|Non_Targeting_Human 553 1|sg_Non_Targeting_Human_G Non_Targeting_Human GTGTCGGATTCCGCCGCTTA A_0120|Non_Targeting_Human 554 1|sg_Non_Targeting_Human_G Non_Targeting_Human CACGAACTCACACCGCGCGA A_0121|Non_Targeting_Human 555 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGCTAGTACGCTCCTCTATA A_0122|Non_Targeting_Human 556 1|sg_Non_Targeting_Human_G Non_Targeting_Human TCGCGCTTGGGTTATACGCT A_0123|Non_Targeting_Human 557 1|sg_Non_Targeting_Human_G Non_Targeting_Human CTATCTCGAGTGGTAATGCG A_0124|Non_Targeting_Human 558 1|sg_Non_Targeting_Human_G Non_Targeting_Human AATCGACTCGAACTTCGTGT A_0125|Non_Targeting_Human 559 1|sg_Non_Targeting_Human_G Non_Targeting_Human CCCGATGGACTATACCGAAC A_0126|Non_Targeting_Human 560 1|sg_Non_Targeting_Human_G Non_Targeting_Human ACGTTCGAGTACGACCAGCT A_0127|Non_Targeting_Human 561 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGCGACGACTCAACCTAGTC A_0128|Non_Targeting_Human 562 1|sg_Non_Targeting_Human_G Non_Targeting_Human GGTCACCGATCGAGAGCTAG A_0129|Non_Targeting_Human 563 1|sg_Non_Targeting_Human_G Non_Targeting_Human CTCAACCGACCGTATGGTCA A_0130|Non_Targeting_Human 564 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGTATTCGACTCTCAACGCG A_0131|Non_Targeting_Human 565 1|sg_Non_Targeting_Human_G Non_Targeting_Human CTAGCCGCCCAGATCGAGCC A_0132|Non_Targeting_Human 566 1|sg_Non_Targeting_Human_G Non_Targeting_Human GAATCGACCGACACTAATGT A_0133|Non_Targeting_Human 567 1|sg_Non_Targeting_Human_G Non_Targeting_Human ACTTCAGTTCGGCGTAGTCA A_0134|Non_Targeting_Human 568 1|sg_Non_Targeting_Human_G Non_Targeting_Human GTGCGATGTCGCTTCAACGT A_0135|Non_Targeting_Human 569 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGCCTAATTTCCGGATCAAT A_0136|Non_Targeting_Human 570 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGTGGCCGGAACCGTCATAG A_0137|Non_Targeting_Human 571 1|sg_Non_Targeting_Human_G Non_Targeting_Human ACCCTCCGAATCGTAACGGA A_0138|Non_Targeting_Human 572 1|sg_Non_Targeting_Human_G Non_Targeting_Human AAACGGTACGACAGCGTGTG A_0139|Non_Targeting_Human 573 1|sg_Non_Targeting_Human_G Non_Targeting_Human ACATAGTCGACGGCTCGATT A_0140|Non_Targeting_Human 574 1|sg_Non_Targeting_Human_G Non_Targeting_Human GATGGCGCTTCAGTCGTCGG A_0141|Non_Targeting_Human 575 1|sg_Non_Targeting_Human_G Non_Targeting_Human ATAATCCGGAAACGCTCGAC A_0142|Non_Targeting_Human 576 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGCCGGGCTGACAATTAACG A_0143|Non_Targeting_Human 577 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGTCGCCATATGCCGGTGGC A_0144|Non_Targeting_Human 578 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGGGCCTATAACACCATCGA A_0145|Non_Targeting_Human 579 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGCCGTTCCGAGATACTTGA A_0146|Non_Targeting_Human 580 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGGGACGTCGCGAAAATGTA A_0147|Non_Targeting_Human 581 1|sg_Non_Targeting_Human_G Non_Targeting_Human TCGGCATACGGGACACACGC A_0148|Non_Targeting_Human 582 1|sg_Non_Targeting_Human_G Non_Targeting_Human AGCTCCATCGCCGCGATAAT A_0149|Non_Targeting_Human 583 1|sg_Non_Targeting_Human_G Non_Targeting_Human ATCGTATCATCAGCTAGCGC A_0150|Non_Targeting_Human 584 1|sg_Non_Targeting_Human_G Non_Targeting_Human TCGATCGAGGTTGCATTCGG A_0151|Non_Targeting_Human 585 1|sg_Non_Targeting_Human_G Non_Targeting_Human CTCGACAGTTCGTCCCGAGC A_0152|Non_Targeting_Human 586 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGGTAGTATTAATCGCTGAC A_0153|Non_Targeting_Human 587 1|sg_Non_Targeting_Human_G Non_Targeting_Human TGAACGCGTGTTTCCTTGCA A_0154|Non_TargetingHuman 588 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGACGCTAGGTAACGTAGAG A_0155|Non_Targeting_Human 589 1|sg_Non_Targeting_Human_G Non_Targeting_Human CATTGTTGAGCGGGCGCGCT A0156|NonTargetingHuman 590 1|sg_Non_Targeting_Human_G Non_Targeting_Human CCGCTATTGAAACCGCCCAC A_0157|Non_Targeting_Human 591 1|sg_Non_Targeting_Human_G Non_Targeting_Human AGACACGTCACCGGTCAAAA A_0158|Non_Targeting_Human 592 1|sg_Non_Targeting_Human_G Non_Targeting_Human TTTACGATCTAGCGGCGTAG A_0159|Non_Targeting_Human 593 1|sg_Non_Targeting_Human_G Non_Targeting_Human TTCGCACGATTGCACCTTGG A0160|NonTargetingHuman 594 1|sg_Non_Targeting_Human_G Non_Targeting_Human GGTTAGAGACTAGGCGCGCG A_0161|Non_Targeting_Human 595 1|sg_Non_Targeting_Human_G Non_Targeting_Human CCTCCGTGCTAACGCGGACG A_0162|Non_Targeting_Human 596 1|sg_Non_Targeting_Human_G Non_Targeting_Human TTATCGCGTAGTGCTGACGT A_0163|Non_Targeting_Human 597 1|sg_Non_Targeting_Human_G Non_Targeting_Human TACGCTTGCGTTTAGCGTCC A0164|NonTargetingHuman 598 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGCGGCCCACGCGTCATCGC A_0165|Non_Targeting_Human 599 1|sg_Non_Targeting_Human_G Non_Targeting_Human AGCTCGCCATGTCGGTTCTC A_0166|Non_Targeting_Human 600 1|sg_Non_Targeting_Human_G Non_Targeting_Human AACTAGCCCGAGCAGCTTCG A_0167|Non_Targeting_Human 601 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGCAAGGTGTCGGTAACCCT A_0168|Non_Targeting_Human 602 1|sg_Non_Targeting_Human_G Non_Targeting_Human CTTCGACGCCATCGTGCTCA A_0169|Non_Targeting_Human 603 1|sg_Non_Targeting_Human_G Non_Targeting_Human TCCTGGATACCGCGTGGTTA A_0170|Non_Targeting_Human 604 1|sg_Non_Targeting_Human_G Non_Targeting_Human ATAGCCGCCGCTCATTACTT A_0171|Non_Targeting_Human 605 1|sg_Non_Targeting_Human_G Non_Targeting_Human GTCGTCCGGGATTACAAAAT A_0172|Non_Targeting_Human 606 1|sg_Non_Targeting_Human_G Non_Targeting_Human TAATGCTGCACACGCCGAAT A_0173|Non_Targeting_Human 607 1|sg_Non_Targeting_Human_G Non_Targeting_Human TATCGCTTCCGATTAGTCCG A_0174|Non_Targeting_Human 608 1|sg_Non_Targeting_Human_G Non_Targeting_Human GTACCATACCGCGTACCCTT A_0175|Non_Targeting_Human 609 1|sg_Non_Targeting_Human_G Non_Targeting_Human TAAGATCCGCGGGTGGCAAC A_0176|Non_Targeting_Human 610 1|sg_Non_Targeting_Human_G Non_Targeting_Human GTAGACGTCGTGAGCTTCAC A_0177|Non_Targeting_Human 611 1|sg_Non_Targeting_Human_G Non_Targeting_Human TCGCGGACATAGGGCTCTAA A_0178|Non_Targeting_Human 612 1|sg_Non_Targeting_Human_G Non_Targeting_Human AGCGCAGATAGCGCGTATCA A_0179|NonTargetingHuman 613 1|sg_Non_Targeting_Human_G Non_Targeting_Human GTTCGCTTCGTAACGAGGAA A_0180|Non_Targeting_Human 614 1|sg_Non_Targeting_Human_G Non_Targeting_Human GACCCCCGATAACTTTTGAC A_0181|Non_Targeting_Human 615 1|sg_Non_Targeting_Human_G Non_Targeting_Human ACGTCCATACTGTCGGCTAC A_0182|Non_Targeting_Human 616 1|sg_Non_Targeting_Human_G Non_Targeting_Human GTACCATTGCCGGCTCCCTA A_0183|Non_Targeting_Human 617 1|sg_Non_Targeting_Human_G Non_Targeting_Human TGGTTCCGTAGGTCGGTATA A_0184|Non_Targeting_Human 618 1|sg_Non_Targeting_Human_G Non_Targeting_Human TCTGGCTTGACACGACCGTT A_0185|Non_Targeting_Human 619 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGCTAGGTCCGGTAAGTGCG A_0186|Non_Targeting_Human 620 1|sg_Non_Targeting_Human_G Non_Targeting_Human AGCACGTAATGTCCGTGGAT A_0187|Non_Targeting_Human 621 1|sg_Non_Targeting_Human_G Non_Targeting_Human AAGGCGCGCGAATGTGGCAG A_0188|Non_Targeting_Human 622 1|sg_Non_Targeting_Human_G Non_Targeting_Human ACTGCGGAGCGCCCAATATC A_0189|Non_Targeting_Human 623 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGTCGAGTGCTCGAACTCCA A_0190|Non_Targeting_Human 624 1|sg_Non_Targeting_Human_G Non_Targeting_Human TCGCAGCGGCGTGGGATCGG A_0191|Non_Targeting_Human 625 1|sg_Non_Targeting_Human_G Non_Targeting_Human ATCTGTCCTAATTCGGATCG A_0192|Non_Targeting_Human 626 1|sg_Non_Targeting_Human_G Non_Targeting_Human TGCGGCGTAATGCTTGAAAG A_0193|Non_Targeting_Human 627 1|sg_Non_Targeting_Human_G Non_Targeting_Human CGAACTTAATCCCGTGGCAA A_0194|Non_Targeting_Human 628 1|sg_Non_Targeting_Human_G Non_Targeting_Human GCCGTGTTGCTGGATACGCC A_0195|Non_Targeting_Human 629 1|sg_Non_Targeting_Human_G Non_Targeting_Human TACCCTCCGGATACGGACTG A_0196|Non_Targeting_Human 630 1|sg_Non_Targeting_Human_G Non_Targeting_Human CCGTTGGACTATGGCGGGTC A_0197|Non_Targeting_Human 631 1|sg_Non_Targeting_Human_G Non_Targeting_Human GTACGGGGCGATCATCCACA A_0198|Non_Targeting_Human 632 1|sg_Non_Targeting_Human_G Non_Targeting_Human AAGAGTAGTAGACGCCCGGG A_0199|Non_Targeting_Human 633 1|sg_Non_Targeting_Human_G Non_Targeting_Human AAGAGCGAATCGATTTCGTG A_0200|Non_Targeting_Human 634 3|sg_hCDC16_CC_1|CDC16 CDC16 TCAACACCAGTGCCTGACGG 635 3|sg_hCDC16_CC_2|CDC16 CDC16 AAAGTAGCTTCACTCTCTCG 636 3|sg_hCDC16_CC_3|CDC16 CDC16 GAGCCAACCAATAGATGTCC 637 3|sg_hCDC16_CC_4|CDC16 CDC16 GCGCCGCCATGAACCTAGAG 638 3|sg_hGTF2B_CC_1|GTF2B GTF2B ACAAAGGTTGGAACAGAACC 639 3|sg_hGTF2B_CC_2|GTF2B GTF2B GGTGACCGGGTTATTGATGT 640 3|sg_hGTF2B_CC_3|GTF2B GTF2B TTAGTGGAGGACTACAGAGC 641 3|sg_hGTF2B_CC_4|GTF2B GTF2B ACATATAGCCCGTAAAGCTG 642 3|sg_hHSPA5_CC_1|HSPA5 HSPA5 CGTTGGCGATGATCTCCACG 643 3|sg_hHSPA5_CC_2|HSPA5 HSPA5 TGGCCIIIICTACCTCGCGC 644 3|sg_hHSPA5_CC_31HSPA5 HSPA5 AATGGAGATACTCATCTGGG 645 3|sg_hHSPA5CC_4|HSPA5 HSPA5 GAAGCCCGTCCAGAAAGTGT 646 3|sg_hHSPA9_CC_1|HSPA9 HSPA9 CAATCTGAGGAACTCCACGA 647 3|sg_hHSPA9_CC_2|HSPA9 HSPA9 AGGCTGCGGCGCCCACGAGA 648 3|sg_hHSPA9_CC_3|HSPA9 HSPA9 ACTTTGACCAGGCCTTGCTA 649 3|sg_hHSPA9_CC_4|HSPA9 HSPA9 ACCTTCCATAACTGCCACGC 650 3|sg_hPAFAH1_B1_CC_1|PAFA PAFAH1B1 CGAGGCGTACATACCCAAGG H1B1 651 3|sg_hPAFAH1_B1_CC_2|PAFA PAFAH1B1 ATGGTACGGCCAAATCAAGA H1B1 652 3|sg_hPAFAH1_B1_CC_3|PAFA PAFAH1B1 TCTTGTAATCCCATACGCGT H1B1 653 3|sg_hPAFAH1_B1_CC_4|PAFA PAFAH1B1 ATTCACAGGACACAGAGAAT H1B1 654 3|sg_hPCNA_CC_1|PCNA PCNA CCAGGGCTCCATCCTCAAGA 655 3|sg_hPCNA_CC_2|PCNA PCNA TGAGCTGCACCAAAGAGACG 656 3|sg_hPCNA_CC_3|PCNA PCNA ATGTCTGCAGATGTACCCCT 657 3|sg_hPCNA_CC_4|PCNA PCNA CGAAGATAACGCGGATACCT 658 3|sg_hPOLR2L_CC_1|POLR2L POLR2L GCTGCAGGCCGAGTACACCG 659 3|sg_hPOLR2L_CC_2|POLR2L POLR2L ACAAGTGGGAGGCTTACCTG 660 3|sg_hPOLR2L_CC_3|POLR2L POLR2L GCAGCGTACAGGGATGATCA 661 3|sg_hPOLR2L_CC_4|POLR2L POLR2L GCAGTAGCGCTTCAGGCCCA 662 3|sg_hRPL9_CC_1|RPL9 RPL9 CAAATGGTGGGGTAACAGAA 663 3|sg_hRPL9_CC_2|RPL9 RPL9 GAAAGGAACTGGCTACCGTT 664 3|sg_hRPL9_CC_3|RPL9 RPL9 AGGGCTTCCGTTACAAGATG 665 3|sg_hRPL9_CC_4|RPL9 RPL9 GAACAAGCAACACCTAAAAG 666 3|sg_hSF3A3_CC_1|SF3A3 SF3A3 TGAGGAGAAGGAACGGCTCA 667 3|sg_hSF3A3_CC_2|SF3A3 SF3A3 GGAAGAATGCAGAGTATAAG 668 3|sg_hSF3A3CC3|SF3A3 SF3A3 GGAATTTGAGGAACTCCTGA 669 3|sg_hSF3A3_CC_4|SF3A3 SF3A3 GCTCACCGGCCATCCAGGAA 670 3|sg_hSF3B3_CC_1|SF3B3 SF3B3 ACTGGCCAGGAACGATGCGA 671 3|sg_hSF3B3_CC_2|SF3B3 SF3B3 GCAGCTCCAAGATCTTCCCA 672 3|sg_hSF3B3CC3|SF3B3 SF3B3 GAATGAGTACACAGAACGGA 673 3|sg_hSF3B3_CC_4|SF3B3 SF3B3 GGAGCAGGACAAGGTCGGGG

    Example 2BRD9 Degrader Depletes BRD9 Protein

    [0409] The following example demonstrates the depletion of the BRD9 protein in synovial sarcoma cells treated with a BRD9 degrader.

    [0410] Procedure: Cells were treated with DMSO or the BRD9 degrader, Compound 1 (also known as dBRD9, see Remillard et al, Angew. Chem. Int. Ed. Engl. 56(21):5738-5743 (2017); see structure of compound 1 below), for indicated doses and timepoints.

    ##STR00146##

    [0411] Whole cell extracts were fractionated by SDS-PAGE and transferred to a polyvinylidene difluoride membrane using a transfer apparatus according to the manufacturer's protocols (Bio-Rad). After incubation with 5% nonfat milk in TBST (10 mM Tris, pH 8.0, 150 mM NaCl, 0.5% Tween 20) for 60 min, the membrane was incubated with antibodies against BRD9 (1:1,000, Bethyl laboratory A303-781A), GAPDH (1:5,000, Cell Signaling Technology), and/or MBP (1:1,000, BioRad) overnight at 4? C. Membranes were washed three times for 10 min and incubated with anti-mouse or anti-rabbit antibodies conjugated with either horseradish peroxidase (HRP, FIGS. 2-3) or IRDye (FIG. 4, 1:20,000, LI-COR) for at least 1 h. Blots were washed with TBST three times and developed with either the ECL system according to the manufacturer's protocols (FIGS. 2-3) or scanned on an Odyssey CLx Imaging system (FIG. 4).

    [0412] Results: Treatment of SYO1 synovial sarcoma cells with the BRD9 degrader Compound 1 results in dose dependent (FIG. 2) and time dependent (FIG. 3) depletion of BRD9 in the cells. Further, as shown in FIG. 4, the depletion of BRD9 by Compound 1 is replicated in a non-synovial sarcoma cell line (293T) and may be sustained for at least 5 days.

    Example 3Inhibition of Growth of Synovial Cell Lines by BRD9 Inhibitors and BRD9 Degraders

    [0413] The following example demonstrates that BRD9 degraders and inhibitors selectively inhibit growth of synovial sarcoma cells.

    [0414] Procedures:

    [0415] Cells were treated with DMSO or the BRD9 degrader, Compound 1, at indicated concentrations, and proliferation was monitored from day 7 to day 14 by measuring confluency over time using an IncuCyte live cell analysis system (FIG. 5). Growth medium and compounds were refreshed every 3-4 days.

    [0416] Cells were seeded into 12-well plates and treated with DMSO, 1 ?M BRD9 inhibitor, Compound 2 (also known as BI-7273, see Martin et al, J Med Chem. 59(10):4462-4475 (2016); see structure of compound 2 below), or 1 ?M BRD9 degrader, Compound 1.

    ##STR00147##

    [0417] The number of cells was optimized for each cell line. Growth medium and compounds were refreshed every 3-5 days. SYO1, Yamato, A549, 293T and HS-SY-II cells were fixed and stained at day 11. ASKA cells were fixed and stained at day 23. Staining was done by incubation with crystal violet solution (0.5 g Crystal Violet, 27 ml 37% Formaldehyde, 100 mL 10?PBS, 10 mL Methanol, 863 dH20 to 1 L) for 30 min followed by 3? washes with water and drying the plates for at least 24 h at room temperature. Subsequently plates were scanned on an Odyssey CLx Imaging system (FIG. 6).

    [0418] Cells were seeded into 96-well ultra low cluster plate (Costar, #7007) in 200 ?L complete media and treated at day 2 with DMSO, Staurosporin, or BRD9 degrader, Compound 1, at indicated doses (FIG. 7). Media and compounds were changed every 5 d and cell colonies were imaged at day 14.

    [0419] Results: As shown in FIGS. 5, 6, and 7, treatment of synovial sarcoma cell lines (SYO1, Yamato, HS-SY-II, and ASKA) with a BRD9 inhibitor, Compound 2, or a BRD9 degrader, Compound 1, results in inhibition of the growth of the cells, but does not result in inhibition of the growth of non-synovial control cancer cell lines (293T, A549, G401).

    Example 4Selective Inhibition of Growth of Synovial Cell Lines by BRD9 Degraders and BRD9 Binders

    [0420] The following example demonstrates that BRD9 degraders and binders selectively inhibit growth of synovial sarcoma cells.

    [0421] Procedure: Cells were seeded into 6-well or 12-well plates and were treated daily with a BRD9 degrader (Compound 1), a bromo-domain BRD9 binder (Compound 2), E3 ligase binder (lenalidomide), DMSO, or staurosporin (positive control for cell killing), at indicated concentrations. The number of cells was optimized for each cell line. Growth media was refreshed every 5 days. By day 14, medium was removed, cells were washed with PBS, and stained using 500 ?L of 0.005% (w/v) crystal violet solution in 25% (v/v) methanol for at least 1 hour at room temperature. Subsequently plates were scanned on an Odyssey CLx Imaging system.

    [0422] Results: As shown in FIGS. 8 and 9, treatment of synovial sarcoma cell lines (SYO1, HS-SY-II, and ASKA) with Compound 1 or Compound 2 resulted in inhibition of the growth of the cells, but did not result in inhibition of the growth of non-synovial control cancer cell lines (RD, HCT116, and Calu6). Overall, Compound 1 showed most significant growth inhibition in all synovial cell lines.

    Example 5Inhibition of Cell Growth in Synovial Sarcoma Cells

    [0423] The following example shows that BRD9 degraders inhibit cell growth and induce apoptosis in synovial sarcoma cells.

    [0424] Procedure: SYO1 cells were treated for 8 or 13 days with DMSO, a BRD9 degrader (Compound 1) at 200 nM or 1 ?M, or an E3 ligase binder (lenalidomide) at 200 nM. Compounds were refreshed every 5 days. Cell cycle analysis was performed using the Click-iT? Plus EdU Flow Cytometry Assay (Invitrogen). The apoptosis assay was performed using the Annexin V-FITC Apoptosis Detection Kit (Sigma A9210). Assays were performed according to the manufacturer's protocol.

    [0425] Results: As shown in FIGS. 10-13, treatment with Compound 1 for 8 or 13 days resulted in reduced numbers of cells in the S-phase of the cell cycle as compared to DMSO and lenalidomide. Treatment with Compound 1 for 8 days also resulted in increased numbers of early- and late-apoptotic cells as compared to DMSO controls.

    Example 6Composition for SS18-SSX1-BAF

    [0426] The following example shows the identification of BRD9 as a component of SS18-SSX containing BAF complexes.

    [0427] Procedure: A stable 293T cell line expressing HA-SS18SSX1 was generated using lentiviral integration. SS18-SSX1 containing BAF complexes were subject to affinity purification and subsequent mass spectrometry analysis revealed SS18-SSX1 interacting proteins.

    [0428] Results: As shown in FIG. 14, BAF complexes including the SS18-SSX fusion protein also included BRD9. More than 5 unique peptides were identified for ARID1A (95 peptides), ARID1B (77 peptides), SMARCC1 (69 peptides), SMARCD1 (41 peptides), SMARCD2 (37 peptides), DPF2 (32 peptides), SMARCD3 (26 peptides), ACTL6A (25 peptides), BRD9 (22 peptides), DPF1 Isoform 2 (18 peptides), DPF3 (13 peptides), and ACTL6B (6 peptides).

    Example 7Preparation of 1-(1-[imidazo[1,2-a]pyridin-5-yl]-7-(morpholin-4-yl)indolizin-3-yl)ethan-1-one (Compound B16)

    [0429] ##STR00148## ##STR00149##

    Step 1: Preparation of 4-(pyridin-4-yl)morpholine (i7-2)

    [0430] To the solution of 4-chloropyridine (1 g, 8.807 mmol, 1 equiv) in toluene (25 mL) was added morpholine (920.79 mg, 10.569 mmol, 1.2 equiv), Pd(OAC).sub.2 (197.74 mg, 0.881 mmol, 0.1 equiv), BINAP (1.10 g, 1.761 mmol, 0.2 equiv), and tert-BuONa (2.54 g, 26.422 mmol, 3 equiv). The resulting solution was stirred at 110? C. for 12 hours under nitrogen atmosphere. The resulting solution was concentrated. The residue was purified by Flash column chromatography with EtOAc/PE (0-100%), to give compound 4-(pyridin-4-yl)morpholine (600 mg, 41.49%) as yellow solid. LCMS (ESI) m/z: [M+H]+=165.

    Step 2: Preparation of 4-(morpholin-4-yl)-1-(2-oxopropyl)pyridin-1-ium bromide (i7-3)

    [0431] 1-bromopropan-2-one (275.27 mg, 2.010 mmol, 1.1 equiv) was added slowly to a solution of 4-(pyridin-4-yl)morpholine (300 mg, 1.827 mmol, 1 equiv) in ACN (5 mL), and the resulting mixture was stirred at room temperature for 3 hour. The solid was collected by filtration, washed, and dried in vacuo to give pure 4-(morpholin-4-yl)-1-(2-oxopropyl)pyridin-1-ium bromide (181 mg, 32.89%). LCMS (ESI) m/z: [M+H]+=221.

    Step 3: Preparation of 1-(1-[imidazo[1,2-a]pyridin-5-yl]-7-(morpholin-4-yl)indolizin-3-yl)ethan-1-one (Compound B16)

    [0432] ##STR00150##

    [0433] To the solution of 4-(morpholin-4-yl)-1-(2-oxopropyl)pyridin-1-ium bromide (181 mg, 0.601 mmol, 1 equiv) in DMF (5 mL) was added 5-ethynylimidazo[1,2-a]pyridine (256.30 mg, 1.803 mmol, 3 equiv) K.sub.2CO.sub.3 (249.17 mg, 1.803 mmol, 3 equiv). The resulting solution was stirred at 90? C. for 3 hours. The resulting solution was concentrated. The residue was purified by reverse flash chromatography (conditions: column, C18 silica gel; mobile phase, MeOH in water, 10% to 100% gradient in 45 minutes; detector, UV 254 nm). This resulted in 1-(1-[imidazo[1,2-a]pyridin-5-yl]-7-(morpholin-4-yl)indolizin-3-yl)ethan-1-one (105.7 mg, 46.51%) as a yellow solid. .sup.1H NMR (300 MHz, DMSO-d6) ? 9.66 (d, 1H), 8.19 (d, 1H), 8.11 (d, 2H), 8.03-7.85 (m, 2H), 7.57 (d, 1H), 7.21-7.12 (m, 1H), 6.72 (d, 1H), 3.72 (t, 4H), 3.29 (d, 4H), 2.52 (s, 3H). LCMS (ESI) m/z: [M+H]+=361.10.

    Step 4: Preparation of 5-[2-(trimethylsilyl)ethynyl]imidazo[1,2-a]pyridine (i7-5)

    [0434] To the solution of 5-bromoimidazo[1,2-a]pyridine (2 g, 10.150 mmol, 1 equiv) in dioxane (30 mL) was added ethynyltrimethylsilane (1196.38 g, 12.181 mmol, 1.2 equiv), CuI (386.63 mg, 2.030 mmol, 0.2 equiv), Pd(PPh.sub.3).sub.4 (1172.95 g, 1.015 mmol, 0.1 equiv), and TEA (3081.38 g, 30.451 mmol, 3.0 equiv). The resulting solution was stirred at room temperature for 3 hours under nitrogen atmosphere. The resulting solution was concentrated. The residue was purified by Flash column chromatography with EtOAc/PE (0-100%), to give compound 5-[2-(trimethylsilyl)ethynyl]imidazo[1,2-a]pyridine (1.13 g, 51.94%) as yellow solid. LCMS (ESI) m/z: [M+H]+=215.

    Step 5: Preparation of 5-ethynylimidazo[1,2-a]pyridine (i7-6)

    [0435] To the solution of 5-[2-(trimethylsilyl)ethynyl]imidazo[1,2-a]pyridine (1.127 g, 5.258 mmol, 1 equiv) in MeOH (20 mL), DCM (10 mL) was added NaOH (420.60 mg, 10.516 mmol, 2 equiv). The resulting solution was stirred at room temperature for 1 hour. The resulting solution was concentrated. The residue was purified by Flash column chromatography with EtOAc/PE (0-100%), to give compound 5-ethynylimidazo[1,2-a]pyridine (578 mg, 77.33%) as yellow solid. LCMS (ESI) m/z: [M+H]+=143.

    Example 8Preparation of 1-(1-[imidazo[1,2-a]pyridin-5-yl]-7-(4-methylpiperazin-1-yl)indolizin-3-yl)ethan-1-one (Compound B17)

    [0436] ##STR00151##

    [0437] To a stirred mixture of 1-(1-[imidazo[1,2-a]pyridin-5-yl]-7-(piperazin-1-yl)indolizin-3-yl)ethan-1-one (50 mg, 0.139 mmol, 1 equiv) and (HCHO)n (21.07 mg, 0.696 mmol, 5 equiv) in MeOH (2 mL) was added NaBH.sub.3CN (17.48 mg, 0.278 mmol, 2 equiv) in portions, and the resulting mixture was stirred for 2 hours at room temperature. The reaction mixture was then concentrated under reduced pressure. The crude product (50 mg) was purified by Prep-HPLC (conditions: X Bridge Shield RP18 OBD Column, 19*250 mm, 10 ?m; mobile phase, Water (10 mmol NH.sub.4HCO.sub.3) and ACN (35% Phase B up to 68% in 8 minutes); Detector, UV). This resulted in 1-(1-[imidazo[1,2-a]pyridin-5-yl]-7-(4-methylpiperazin-1-yl)indolizin-3-yl)ethan-1-one (19.5 mg, 37.54%) as a yellow solid. .sup.1H NMR (300 MHz, DMSO-d6) ? 9.64 (d, J=8.0 Hz, 1H), 8.06 (s, 1H), 7.81 (s, 1H), 7.66-7.52 (m, 2H), 7.35 (dd, J=9.1, 6.9 Hz, 1H), 7.12 (dd, J=7.9, 2.6 Hz, 1H), 7.03 (d, J=6.7 Hz, 1H), 6.60 (d, J=2.5 Hz, 1H), 3.27 (t, J=5.0 Hz, 4H), 2.55 (s, 3H), 2.42 (t, J=5.1 Hz, 4H), 2.21 (s, 3H). LCMS (ESI) m/z: [M+H]+=374.10.

    Example 9Preparation of 2-cyclopropyl-4-[3,5-dimethoxy-4-[(methylamino)methyl]phenyl]-2,7-naphthyridin-1-one (Compound B18)

    [0438] ##STR00152##

    Step 1: Preparation of 4-bromo-2-cyclopropyl-2,7-naphthyridin-1-one (i9-2)

    [0439] ##STR00153##

    [0440] To a solution of 4-bromo-2H-2,7-naphthyridin-1-one (400.00 mg, 1.777 mmol, 1.00 equiv), cyclopropylboronic acid (229.02 mg, 2.666 mmol, 1.5 equiv) and pyridine (281.19 mg, 3.555 mmol, 2.00 equiv) in toluene (20.00 mL) was added Cu(OAc).sub.2 (645.68 mg, 3.555 mmol, 2.00 equiv). The resulting mixture was stirred at 70 degrees C. for 16 hours. The solvent was removed under reduced pressure, and the residue was purified by chromatography on silica gel eluted with MeOH/DCM from 0% to 10% to give 4-bromo-2-cyclopropyl-2,7-naphthyridin-1-one (260 mg, 55.18%) as a brown solid. LCMS (ESI) m/z: [M+H].sup.+=265.

    Step 2: Preparation of N-[[4-(2-cyclopropyl-1-oxo-2,7-naphthyridin-4-yl)-2,6-dimethoxyphenyl]methyl]-N-methylcarbamate (i9-3)

    [0441] ##STR00154##

    [0442] To a solution of 4-bromo-2-cyclopropyl-2,7-naphthyridin-1-one (260.00 mg, 0.981 mmol, 1.00 equiv) and tert-butyl N-[[2,6-dimethoxy-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl]methyl]-N-methylcarbamate (439.41 mg, 1.079 mmol, 1.10 equiv) in DMF (5.00 mL) was added Pd(dppf)Cl.sub.2 (71.76 mg, 0.098 mmol, 0.10 equiv) and Na.sub.2CO.sub.3 (207.89 mg, 1.961 mmol, 2.00 equiv). After stirring at 100 degrees C. for 1 hour under nitrogen atmosphere, water (100 mL) was added, and the mixture was extracted with EtOAc (50 mL?4). The organic layer was washed with water (2?30 mL) and saturated brine (1?30 mL), then dried over anhydrous sodium sulfate, filtered, and concentrated to give crude product, which was purified by chromatography on silica gel eluted with PE/EA from 0% to 80% to give tert-butyl N-[[4-(2-cyclopropyl-1-oxo-2,7-naphthyridin-4-yl)-2,6-dimethoxyphenyl]methyl]-N-methylcarbamate (140 mg, 30.66%) as a brown solid. LCMS (ESI) m/z: [M+H].sup.+=466.

    Step 3: Preparation of 2-cyclopropyl-4-[3,5-dimethoxy-4-[(methylamino)methyl]phenyl]-2,7-naphthyridin-1-one (Compound B18)

    [0443] ##STR00155##

    [0444] To a solution of tert-butyl N-[[4-(2-cyclopropyl-1-oxo-2,7-naphthyridin-4-yl)-2,6-dimethoxyphenyl]methyl]-N-methylcarbamate (140.00 mg, 0.301 mmol, 1.00 equiv) in DCM (1.00 mL) was added TFA (1.00 mL). The resulting mixture was stirred at room temperature for 1 hour. The solvent was removed under reduced pressure. The crude product was purified by Prep-HPLC (conditions: XBridge Shield RP18 OBD Column, 5 um, 19*150 mm; Mobile Phase A:Water (10 mmol/L NH.sub.4HCO.sub.3), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 17% B to 23% B in 8 min; 254 nm; Rt: 6.2 min) to afford 2-cyclopropyl-4-[3,5-dimethoxy-4-[(methylamino)methyl]phenyl]-2,7-naphthyridin-1-one (45.1 mg, 41.04%) as a white solid. .sup.1H NMR (300 MHz, DMSO-d6) ? 9.44 (s, 1H), 8.72 (d, J=5.7 Hz, 1H), 7.59 (s, 1H), 7.51 (d, J=5.7 Hz, 1H), 6.73 (s, 2H), 3.82 (s, 6H), 3.72 (s, 2H), 3.46-3.38 (m, 1H), 2.28 (s, 3H), 1.10-0.97 (m, 4H). LCMS (ESI) m/z: [M+H].sup.+=366.25.

    Example 10Preparation of 1-(1-[imidazo[1,2-a]pyridin-5-yl]-7-(piperazin-1-yl)indolizin-3-yl)ethan-1-one (Compound B19)

    [0445] ##STR00156##

    Step 1: Preparation of tert-butyl-4-(pyridin-4-yl)piperazine-1-carboxylate (i10-2)

    [0446] To a stirred mixture of 4-fluoropyridine hydrochloride (4.78 g, 35.792 mmol, 1 equiv) and tert-butylpiperazine-1-carboxylate (8.00 g, 42.950 mmol, 1.2 equiv) in NMP (25 mL) was added TEA (10.87 g, 107.376 mmol, 3 equiv) at room temperature. The mixture was stirred for 3 hours at 100 degrees C. To the mixture was added EA (50 mL) and washed with water (3?20 mL). The organic layer was dried over anhydrous sodium sulfate and concentrated under vacuum, and the crude product was used in the next step directly without further purification. LCMS (ESI) m/z: [M+H]+=264.2.

    Step 2: Preparation of 4-[4-[(tert-butoxy)carbonyl]piperazin-1-yl]-1-(2-oxopropyl)pyridin-1-ium bromide (i10-3)

    [0447] A mixture of tert-butyl 4-(pyridin-4-yl)piperazine-1-carboxylate (526 mg, 1.997 mmol, 1 equiv) and 1-bromopropan-2-one (820.79 mg, 5.992 mmol, 3.00 equiv) in acetone (10 mL) was stirred for 3 hours at room temperature. The precipitated solids were collected by filtration and washed with acetone (3?5 mL), and the crude product was used in the next step directly without further purification. LCMS (ESI) m/z: [M+H]+=322.

    Step 3: Preparation of tert-butyl-4-(3-acetyl-1-[imidazo[1,2-a]pyridin-5-yl]indolizin-7-yl)piperazine-1-carboxylate (i10-4)

    [0448] To a stirred mixture of 4-[4-[(tert-butoxy)carbonyl]piperazin-1-yl]-1-(2-oxopropyl)pyridin-1-ium bromide (1 g, 2.498 mmol, 1 equiv) and 5-ethynylimidazo[1,2-a]pyridine (0.43 g, 2.998 mmol, 1.2 equiv) in DMF (16 mL) was added K.sub.2CO.sub.3 (0.69 g, 4.996 mmol, 2 equiv), and the resulting mixture was stirred for 15 hours at room temperature. The resulting mixture was diluted with water and extracted with EtOAc (2?20 mL). The organic layers were washed with water (3?10 mL) and dried over anhydrous sodium sulfate. After filtration, the filtrate was concentrated under reduced pressure. The residue was purified by Prep-TLC to afford tert-butyl 4-(3-acetyl-1-[imidazo[1,2-a]pyridin-5-yl]indolizin-7-yl)piperazine-1-carboxylate (178 mg, 14.27%). LCMS (ESI) m/z: [M+H]+=460.

    Step 4: Preparation of 1-(1-[imidazo[1,2-a]pyridin-5-yl]-7-(piperazin-1-yl)indolizin-3-yl)ethan-1-one (Compound B19)

    [0449] ##STR00157##

    [0450] To a stirred solution of tert-butyl 4-(3-acetyl-1-[imidazo[1,2-a]pyridin-5-yl]indolizin-7-yl)piperazine-1-carboxylate (60 mg, 0.131 mmol, 1 equiv) in DCM (5 mL) was added TFA (3.00 mL, 40.389 mmol, 309.35 equiv). The resulting mixture was stirred for 2 hours at room temperature, and then was concentrated under reduced pressure. The crude product was purified by Prep-HPLC (conditions: X Bridge Shield RP18 OBD Column, 5 ?m, 19*150 mm; mobile phase, Water (0.05% NH.sub.3H.sub.2O) and ACN (35% Phase B up to 58% in 8 minutes); Detector, UV). This resulted in 1-(1-[imidazo[1,2-a]pyridin-5-yl]-7-(piperazin-1-yl)indolizin-3-yl)ethan-1-one (43.6 mg, 30.06%) as a white solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.81 (d, J=7.8 Hz, 1H), 8.18-8.03 (m, 4H), 7.92 (d, J=8.9 Hz, 1H), 7.63 (d, J=7.3 Hz, 1H), 7.12 (d, J=8.0, 1H), 6.87 (s, 1H), 3.69-3.61 (m, 4H), 3.42-3.29 (m, 4H), 2.61 (d, J=1.5 Hz, 3H). LCMS (ESI) m/z: [M+H].sup.+=360.05.

    Example 11Preparation of 4-[4-[(3-aminoazetidin-1-yl)methyl]-3,5-dimethoxyphenyl]-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (Compound B20)

    [0451] ##STR00158## ##STR00159##

    Step 1: Preparation of 2-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,2-dihydro-2,7-naphthyridin-1-one (i11-2)

    [0452] ##STR00160##

    [0453] To the solution of 4-bromo-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (2.7 g, 11.294 mmol, 1 equiv) in dioxane (15 mL) was added 4,4,5,5-tetramethyl-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,3,2-dioxaborolane (3.44 g, 13.552 mmol, 1.2 equiv), Pd(dppf)Cl.sub.2 (0.83 g, 1.129 mmol, 0.1 equiv), and AcOK (3.33 g, 33.881 mmol, 3 equiv). The resulting solution was stirred at 90? C. for 2 hours under nitrogen atmosphere. The resulting solution was concentrated. The residue was purified by Flash column chromatography with EtOAc/PE (0-100%) to give compound 2-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,2-dihydro-2,7-naphthyridin-1-one (1.62 g, 50.13%) as light yellow solid. LCMS (ESI) m/z: [M+H]+=287.

    Step 2: Preparation of 2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzaldehyde (i11-3)

    [0454] ##STR00161##

    [0455] To the solution of 2-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,2-dihydro-2,7-naphthyridin-1-one (1.62 g, 5.662 mmol, 1 equiv) in dioxane (30 mL) was added 4-bromo-2,6-dimethoxybenzaldehyde (1.39 g, 5.662 mmol, 1 equiv), Pd(dppf)Cl.sub.2 (414.26 mg, 0.566 mmol, 0.1 equiv), Cs.sub.2CO.sub.3 (5.53 g, 16.985 mmol, 3 equiv), and H.sub.2O (3 mL). The resulting solution was stirred at 90? C. for 2 hours under nitrogen atmosphere. The resulting solution was concentrated. The residue was purified by Flash column chromatography with EtOAc/PE (0?100%) to give compound 2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzaldehyde (1.02 g, 55.55%) as yellow solid. LCMS (ESI) m/z: [M+H]+=325.

    Step 3: Preparation of tert-butyl N-(1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]azetidin-3-yl)carbamate (i11-4)

    [0456] ##STR00162##

    [0457] To a stirred solution of 2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzaldehyde (450.00 mg, 1.387 mmol, 1.00 equiv) in MeOH (10.00 mL) was added NaBH.sub.3CN (261.57 mg, 4.162 mmol, 3.00 equiv), tert-butyl N-(azetidin-3-yl)carbamate hydrochloride (347.46 mg, 1.665 mmol, 1.20 equiv). The resulting mixture was stirred for 1 hour at room temperature. The residue was purified by Flash column chromatography with EtOAc/PE (0-100%) to afford tert-butyl N-(1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]azetidin-3-yl)carbamate (475 mg, 71.24%) as a light yellow solid. LCMS (ESI) m/z: [M+H].sup.+=481.

    Step 4: Preparation of 4-[4-[(3-aminoazetidin-1-yl)methyl]-3,5-dimethoxyphenyl]-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (Compound B20)

    [0458] ##STR00163##

    [0459] To the solution of tert-butyl N-(1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]azetidin-3-yl)carbamate (50.00 mg, 0.104 mmol, 1.00 equiv) in DCM (2.00 mL) was added TFA (2.00 mL, 26.926 mmol, 258.79 equiv). The resulting solution was stirred at room temperature for 1 hour. The resulting solution was concentrated. The crude product was purified by Prep-HPLC (conditions: XSelect CSH Prep C18 OBD Column, 5 um, 19*150 mm; Mobile Phase A:Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 35% B to 65% B in 8 min; 254 nm; Rt: 7.38 min) to afford 4-[4-[(3-aminoazetidin-1-yl)methyl]-3,5-dimethoxyphenyl]-2-methyl-2,7-naphthyridin-1-one (9.8 mg, 24.76%) as a yellow solid. .sup.1H NMR (400 MHz, MeOD) ? 9.57 (s, 1H), 8.70 (d, 1H), 7.87 (s, 1H), 7.72 (d, 1H), 6.88 (s, 2H), 4.63 (s, 2H), 4.54 (t, 2H), 4.45 (t, 2H), 4.38 (d, 1H), 3.98 (d, 6H), 3.73 (d, 3H), 2.69 (s, 1H). LCMS (ESI) m/z: [M+H]+=381.25.

    Example 12Preparation of 1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]azetidine-3-carboxylic acid (Compound B21)

    [0460] ##STR00164## ##STR00165##

    Step 1: Preparation of 2-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,2-dihydro-2,7-naphthyridin-1-one (i12-2)

    [0461] ##STR00166##

    [0462] To the solution of 4-bromo-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (2.7 g, 11.294 mmol, 1 equiv) in dioxane (15 mL) was added 4,4,5,5-tetramethyl-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,3,2-dioxaborolane (3.44 g, 13.552 mmol, 1.2 equiv), Pd(dppf)Cl.sub.2 (0.83 g, 1.129 mmol, 0.1 equiv), and AcOK (3.33 g, 33.881 mmol, 3 equiv). The resulting solution was stirred at 90? C. for 2 hours under nitrogen atmosphere. The resulting solution was concentrated. The residue was purified by Flash column chromatography with EtOAc/PE (0-100%) to give compound 2-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,2-dihydro-2,7-naphthyridin-1-one (1.62 g, 50.13%) as light yellow solid. LCMS (ESI) m/z: [M+H].sup.+=287.

    Step 2: Preparation of 2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzaldehyde (i12-3)

    [0463] ##STR00167##

    [0464] To the solution of 2-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,2-dihydro-2,7-naphthyridin-1-one (1.62 g, 5.662 mmol, 1 equiv) in dioxane (30 mL) was added 4-bromo-2,6-dimethoxybenzaldehyde (1.39 g, 5.662 mmol, 1 equiv), Pd(dppf)Cl.sub.2 (414.26 mg, 0.566 mmol, 0.1 equiv), and Cs.sub.2CO.sub.3 (5.53 g, 16.985 mmol, 3 equiv), H.sub.2O (3 mL). The resulting solution was stirred at 90? C. for 2 hours under nitrogen atmosphere. The resulting solution was concentrated. The residue was purified by Flash column chromatography with EtOAc/PE (0?100%) to give compound 2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzaldehyde (1.02 g, 55.55%) as yellow solid. LCMS (ESI) m/z: [M+H]+=325.

    Step 3: Preparation of methyl 1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]azetidine-3-carboxylate (i12-4)

    [0465] ##STR00168##

    [0466] To a stirred solution of 2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzaldehyde (600.00 mg, 1.850 mmol, 1.00 equiv) in DCM (15.00 mL) was added methyl azetidine-3-carboxylate hydrochloride (336.52 mg, 2.220 mmol, 1.20 equiv) and NaBH.sub.3CN (348.76 mg, 5.550 mmol, 3.00 equiv). The resulting mixture was stirred for 1 hour at room temperature. The residue was purified by Flash column chromatography with EtOAc/PE (0?100%) to afford methyl 1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]azetidine-3-carboxylate (800 mg, 102.12%) as a light yellow solid. LCMS (ESI) m/z: [M+H]+=424.

    Step 4: Preparation of 1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]azetidine-3-carboxylic acid (Compound B21)

    [0467] ##STR00169##

    [0468] To the solution of methyl 1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]azetidine-3-carboxylate (50 mg, 0.118 mmol, 1 equiv) in MeOH (10 mL, 0.312 mmol, 2.64 equiv) was added LiOH (28.28 mg, 1.181 mmol, 10 equiv). The resulting solution was stirred at room temperature for 12 hours. The resulting solution was concentrated. The crude product was purified by Prep-HPLC (conditions: SunFire C18 OBD Prep Column, 19 mm?250 mm; Mobile Phase A:Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 4% B to 4% B in 2 min; 254 nm; Rt: 9.83 min) to afford 1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]azetidine-3-carboxylic acid (8.6 mg, 16.91%) as a yellow solid. .sup.1H NMR (400 MHz, MeOD) ? 9.55 (s, 1H), 8.70 (d, 1H), 7.80 (s, 1H), 7.64 (d, 1H), 6.88 (d, 2H), 4.56 (s, 2H), 4.39 (d, 4H), 3.99 (d, 6H), 3.72 (d, 4H). LCMS (ESI) m/z: [M+H].sup.+=410.10.

    Example 13Preparation of 2-cyclopropyl-4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2,7-naphthyridin-1-one (Compound B22)

    [0469] ##STR00170##

    [0470] To a solution of 2-cyclopropyl-4-[3,5-dimethoxy-4-[(methylamino)methyl]phenyl]-2,7-naphthyridin-1-one (40.00 mg, 0.109 mmol, 1.00 equiv) and a solution of formaldehyde in water (0.20 mL, 37%) was added NaBH.sub.3CN (20.64 mg, 0.328 mmol, 3.00 equiv). The resulting mixture was stirred at room temperature for 1 hour. The solvent was removed under reduced pressure. The crude product was purified by Prep-HPLC (conditions: XSelect CSH Prep C18 OBD Column, 5 um, 19*150 mm; Mobile Phase A:Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 32% B to 68% B in 8 min; 254 nm; Rt: 7.38 min) to afford 2-cyclopropyl-4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2,7-naphthyridin-1-one (10 mg, 24.08%) as a white solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.53 (s, 1H), 8.68 (d, J=5.7 Hz, 1H), 8.57 (s, 1H), 7.66 (s, 1H), 7.58 (d, J=5.7 Hz, 1H), 6.81 (s, 2H), 4.07 (s, 2H), 3.93 (s, 6H), 3.43 (s, 1H), 3.33 (s, 3H), 2.63 (s, 6H), 1.19 (t, J=6.8 Hz, 2H), 1.08-1.00 (m, 2H). LCMS (ESI) m/z: [M+H].sup.+=380.25.

    Example 14Preparation of 3-amino-5-(4-((dimethylamino)methyl)-3,5-dimethoxyphenyl)-1-methylpyridin-2(1H)-one (Compound B28)

    [0471] ##STR00171##

    Step 1: Preparation of 3-amino-1-methyl-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,2-dihydropyridin-2-one (i14-2)

    [0472] ##STR00172##

    [0473] To a stirred solution of 3-amino-5-bromo-1-methylpyridin-2-one (3.00 g, 14.775 mmol, 1.00 equiv) in 1,4-dioxane (50 mL) was added 4,4,5,5-tetramethyl-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,3,2-dioxaborolane (4.46 g, 17.556 mmol, 1.2 equiv), Pd(dppf)Cl.sub.2CH.sub.2Cl.sub.2 (1.19 g, 1.463 mmol, 0.1 equiv), and AcOK (4.31 g, 43.891 mmol, 3 equiv). The mixture was stirred for 1.5 hours at 90 degrees C. under N.sub.2 atmosphere. Then the solvent was evaporated, and the resulting residue was purified by flash chromatography eluting with PE/EA (1:2) to afford 3-amino-1-methyl-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,2-dihydropyridin-2-one (3.25 g, 88.82%) as a brown yellow solid. LCMS (ESI) m/z: [M+H].sup.+=251.

    Step 2: Preparation of 4-(5-amino-1-methyl-6-oxo-1,6-dihydropyridin-3-yl)-2,6-dimethoxybenzaldehyde (i14-3)

    [0474] ##STR00173##

    [0475] To a stirred solution of 3-amino-1-methyl-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,2-dihydropyridin-2-one (3.69 g, 14.754 mmol, 1 equiv) in 1,4-dioxane (80 mL) and H.sub.2O (8 mL) was added 4-bromo-2,6-dimethoxybenzaldehyde (3.25 g, 13.278 mmol, 0.90 equiv), Pd(dppf)Cl.sub.2.Math.CH.sub.2Cl.sub.2 (1.20 g, 1.475 mmol, 0.1 equiv), and Cs.sub.2CO.sub.3 (14.42 g, 44.261 mmol, 3 equiv). The solution was stirred for 1 hour at 90 degrees C. under N.sub.2 atmosphere. Then the mixture was diluted with water and extracted with EtOAc, and the combined organic layer was concentrated. The residue was purified by silica gel chromatography eluting with PE/EtOAc (1:3) to afford 4-(5-amino-1-methyl-6-oxo-1,6-dihydropyridin-3-yl)-2,6-dimethoxybenzaldehyde (3.0 g, 70.53%) as a brown solid. LCMS (ESI) m/z: [M+H].sup.+=289.

    Step 3: Preparation of 3-amino-5-(4-((dimethylamino)methyl)-3,5-dimethoxyphenyl)-1-methylpyridin-2(1H)-one (Compound B28)

    [0476] ##STR00174##

    [0477] To a stirred solution of dimethylamine hydrochloride (1.22 g, 14.984 mmol, 1.5 equiv) in MeOH (50 mL) was added 4-(5-amino-1-methyl-6-oxo-1,6-dihydropyridin-3-yl)-2,6-dimethoxybenzaldehyde (2.88 g, 9.989 mmol, 1 equiv). After 30 minutes of stirring, NaBH.sub.3CN (1.26 g, 19.979 mmol, 2 equiv) was added in portions, and the mixture was stirred for 1 hour at 25 degrees C. Then MeOH was evaporated, and the residue was purified by Prep-HPLC (conditions: XSelect CSH Prep C18 OBD Column, 5 um, 19*150 mm; Mobile Phase A:Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 5% B to 22% B in 8 min; 254 nm; Rt: 7.52 min). This resulted in 3-amino-5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-1-methyl-1,2-dihydropyridin-2-one (500 mg, 15.75%) as light green salt. .sup.1H NMR (300 MHz, Methanol-d4) ? 8.56 (s, 1H), 7.39 (d, J=2.2 Hz, 1H), 7.06 (d, J=2.3 Hz, 1H), 6.84 (s, 2H), 4.22 (s, 2H), 3.97 (s, 6H), 3.67 (s, 3H), 2.76 (s, 6H). LCMS (ESI) m/z: [M+H].sup.+=318.15.

    Example 15Preparation of N-(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-1-methyl-2-oxo-1,2-dihydropyridin-3-yl)acetamide (Compound B29)

    [0478] ##STR00175##

    Step 1: preparation of N-(5-bromo-1-methyl-2-oxo-1,2-dihydropyridin-3-yl)acetamide (i15-2)

    [0479] ##STR00176##

    [0480] To a stirred solution of 3-amino-5-bromo-1-methyl-1,2-dihydropyridin-2-one (406.08 mg, 2.000 mmol, 1 equiv) and Et.sub.3N (1619.05 mg, 16.000 mmol, 8 equiv) in DCM (5 mL) was added acetyl chloride (628.00 mg, 8.00 mmol, 4 equiv) dropwise at 0 degrees C. The mixture was stirred for 1 hour at room temperature. Then the solvent was evaporated, and the residue was purified by flash chromatography, eluted with EtOAc/PE (0-100%) to give the N-(5-bromo-1-methyl-2-oxo-1,2-dihydropyridin-3-yl)acetamide (487 mg, 99.36%). LCMS (ESI) m/z: [M+H].sup.+=245.

    Step 2: Preparation of N-[5-(4-formyl-3,5-dimethoxyphenyl)-1-methylidene-2-oxo-1,2-dihydro-1lambda4-pyridin-3-yl]acetamide (i15-3)

    [0481] ##STR00177##

    [0482] To a stirred solution of 2,6-dimethoxy-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzaldehyde (292 mg, 1.000 mmol, 1 equiv), and N-(5-bromo-1-methyl-2-oxo-1,2-dihydropyridin-3-yl)acetamide (244.96 mg, 1.000 mmol, 1 equiv) in 1,4-dioxane (5 mL) and H.sub.2O (0.5 mL) was added Pd(dppf)Cl.sub.2.Math.CH.sub.2Cl.sub.2 (81.62 mg, 0.100 mmol, 0.1 equiv) and Cs.sub.2CO.sub.3 (976.99 mg, 2.999 mmol, 3 equiv). The mixture was reacted for 1 hour at 90 degrees C. under N.sub.2 atmosphere. After cooling, the mixture was concentrated, and the residue was purified by flash chromatography, eluted with EtOAc/PE (0-10%) to afford N-[5-(4-formyl-3,5-dimethoxyphenyl)-1-methylidene-2-oxo-1,2-dihydro-1lambda4-pyridin-3-yl]acetamide (280 mg, 85.06%) as a white solid. LCMS (ESI) m/z: [M+H].sup.+=331.

    Step 3: Preparation of N-(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-1-methyl-2-oxo-1,2-dihydropyridin-3-yl)acetamide (Compound B29)

    [0483] ##STR00178##

    [0484] To a stirred solution of dimethylamine hydrochloride (98.73 mg, 1.211 mmol, 1.6 equiv) in MeOH (5 mL) was added N-[5-(4-formyl-3,5-dimethoxyphenyl)-1-methyl-2-oxo-1,2-dihydropyridin-3-yl]acetamide (250 mg, 0.757 mmol, 1 equiv). The mixture was stirred for 30 minutes at 25 degrees C. Then NaBH.sub.3CN (95.12 mg, 1.514 mmol, 2 equiv) was added in portions, and the reaction mixture was stirred for another 1 hour at 25 degrees C. The mixture was quenched with addition of water and extracted with DCM. The organic layer was concentrated, and the residue was purified by Prep-HPLC (conditions: XSelect CSH Prep C18 OBD Column, 5 um, 19*150 mm; Mobile Phase A:Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 12% B to 25% B in 8 min; 254 nm; Rt: 5.68 min), to give N-(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-1-methyl-2-oxo-1,2-dihydropyridin-3-yl)acetamide (26.4 mg, 9.32%) as white solid. 1H NMR (300 MHz, Methanol-d4) ? 8.69 (d, J=2.5 Hz, 1H), 8.56 (s, 0.3H, FA), 7.81 (d, J=2.5 Hz, 1H), 6.88 (s, 2H), 4.23 (s, 2H), 3.99 (s, 6H), 3.72 (s, 3H), 2.77 (s, 6H), 2.25 (s, 3H). LCMS (ESI) m/z: [M+H].sup.+=360.25.

    Example 16Preparation of N-(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-1-methyl-2-oxo-1,2-dihydropyridin-3-yl)propanamide (Compound B30)

    [0485] ##STR00179##

    Step 1: preparation of N-(5-bromo-1-methyl-2-oxopyridin-3-yl)propanamide (i16-2)

    [0486] ##STR00180##

    [0487] To a stirred solution of 3-amino-5-bromo-1-methylpyridin-2-one (150.00 mg, 0.738 mmol, 1.00 equiv) and Et.sub.3N (300 mg, 2.95 mmol, 4 equiv) in DCM (3.00 mL) was added propanoyl chloride (348.60 mg, 3.69 mmol, 5 equiv) dropwise at 0 degrees C., and the solution was stirred for 1 hour. Then the solvent was evaporated, and the residue was purified by silica gel column chromatography, eluted with EtOAc/PE (0-100%) to afford N-(5-bromo-1-methyl-2-oxopyridin-3-yl)propanamide (168 mg, 87.77%) as a purple solid. LCMS (ESI) m/z: [M+H]+=259.

    Step 2: Preparation of N-(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-1-methyl-2-oxo-1,2-dihydropyridin-3-yl)propanamide (Compound B30)

    [0488] ##STR00181##

    [0489] To a solution of N-(5-bromo-1-methyl-2-oxo-1,2-dihydropyridin-3-yl)propanamide (100 mg, 0.386 mmol, 1 equiv) and [[2,6-dimethoxy-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl]methyl]dimethylamine (123.97 mg, 0.386 mmol, 1 equiv) in 1,4-dioxane (3 mL) and H.sub.2O (0.3 mL) was added Cs.sub.2CO.sub.3 (377.25 mg, 1.158 mmol, 3 equiv) and Pd(dppf)Cl.sub.2.Math.CH.sub.2Cl.sub.2 (31.52 mg, 0.039 mmol, 0.1 equiv). The mixture was stirred for 1 hour at 90 degrees C. under N.sub.2 atmosphere. After the solvent was evaporated, the mixture was purified by flash chromatography, eluted with DCM/MeOH (0-10%) to afford 270 mg of crude product, which was further purified by Prep-HPLC (conditions: XSelect CSH Prep C18 OBD Column, 5 um, 19*150 mm; Mobile Phase A:Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 12% B to 22% B in 8 min; 254 nm; Rt: 4.95 min) to afford N-(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-1-methyl-2-oxo-1,2-dihydropyridin-3-yl)propanamide (26 mg, 18.04%) as a white solid. .sup.1H NMR (300 MHz, Chloroform-d) ? 12.14 (s, 1H), 8.73 (d, J=2.4 Hz, 1H), 8.48 (s, 1H), 7.26 (d, J=2.5 Hz, 1H), 6.64 (s, 2H), 4.29 (s, 2H), 3.92 (s, 6H), 3.72 (s, 3H), 2.80 (s, 6H), 2.51 (q, J=7.5 Hz, 2H), 1.28 (t, J=7.5 Hz, 3H). LCMS (ESI) m/z: [M+H].sup.+=374.40.

    Example 17Preparation of N-(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-1,4-dimethyl-2-oxo-1,2-dihydropyridin-3-yl)propanamide (Compound B31)

    [0490] ##STR00182##

    Step 1: Preparation of N-(5-bromo-1,4-dimethyl-2-oxo-1,2-dihydropyridin-3-yl)propanamide (i17-2)

    [0491] ##STR00183##

    [0492] To a solution of 5-bromo-1,4-dimethyl-2-oxo-1,2-dihydropyridin-3-aminium (400 mg, 1.83 mmol, 1.0 eq.) and TEA (742.43 mg, 7.34 mmol, 4.0 eq.) in DCM (5 mL) was added propanoyl chloride (186.68 mg, 2.02 mmol, 1.1 eq.) at 0? C. The resulting solution was stirred at room temperature for 16 hours. The mixture was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with CH.sub.2Cl.sub.2/MeOH (10:1) to afford N-(5-bromo-1,4-dimethyl-2-oxo-1,2-dihydropyridin-3-yl)propanamide (460 mg, 73%) as a yellow solid. LCMS (ESI) m/z: [M+H].sup.+=273.1.

    Step 2: Preparation of N-(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-1,4-dimethyl-2-oxo-1,2-dihydropyridin-3-yl)propanamide (Compound B35)

    [0493] ##STR00184##

    [0494] To a solution of N-(5-bromo-1,4-dimethyl-2-oxo-1,2-dihydropyridin-3-yl)propanamide (100 mg, 0.37 mmol, 1.0 eq.) and [4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]boronic acid (87.53 mg, 0.37 mmol, 1.0 eq.) in dioxane (2.5 mL) and H.sub.2O (0.5 mL) was added Cs.sub.2CO.sub.3 (238.58 mg, 0.73 mmol, 2.0 eq.) and Pd(dppf)Cl.sub.2CH.sub.2Cl.sub.2 (29.90 mg, 0.037 mmol, 0.1 eq.). The resulting solution was stirred at 90 degree C. for 1 hour (under N.sub.2 atmosphere). LCMS indicated that the reaction was completed. The mixture was allowed to cool down to room temperature. The resulting mixture was diluted water (30 mL) and extracted with EtOAc (30 mL?2). After dry over Na.sub.2SO.sub.4, the filtrate was concentrated in vacuo. The crude product was purified by Prep-HPLC (conditions: Xselect CSH F-Phenyl OBD Column 19*150 mm 5 umn; Mobile Phase A:Water (0.1% FA), Mobile Phase B: EtOH-HPLC; Flow rate: 25 mL/min; Gradient: 5% B to 11% B in 10 min; 220 nm; Rt: 7.60 min) to afford formate of N-(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-1,4-dimethyl-2-oxo-1,2-dihydropyridinyl)propanamide (8.6 mg, 6%) as light brown solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 8.56 (s, 1H), 7.59 (s, 1H), 6.77 (s, 2H), 4.36 (s, 2H), 3.96 (s, 6H), 3.64 (s, 3H), 3.33 (s, 5H), 2.87 (s, 6H), 2.51 (q, J=7.7 Hz, 2H), 2.06 (s, 3H), 1.26 (t, J=7.6 Hz, 3H). LCMS (ESI) m/z: [M+H].sup.+=388.35.

    Example 18Preparation of N-(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-1-methyl-2-oxo-1,2-dihydropyridin-3-yl)acetamide (Compound B32)

    [0495] ##STR00185##

    [0496] Compound B32 was prepared in a similar manner as described for compound B42. N-(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-1-methyl-2-oxo-1,2-dihydropyridin-3-yl)acetamide (40 mg, 27.27%) was obtained as a white solid. .sup.1H NMR (300 MHz, Chloroform-d) ? 8.64 (s, 0.35H, FA), 8.34 (d, J=2.3 Hz, 1H), 7.88 (s, 1H), 7.20 (d, J=2.4 Hz, 1H), 6.64 (s, 2H), 4.26 (q, J=7.1 Hz, 2H), 4.16 (s, 2H), 3.92 (s, 6H), 3.71 (s, 3H), 2.67 (s, 6H), 1.35 (t, J=7.1 Hz, 3H). LCMS (ESI) m/z: [M+H].sup.+=390.20.

    Example 19Preparation of 8-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methylpyrido[3,4-b]pyrazin-5-one (Compound B33)

    [0497] ##STR00186##

    [0498] To a stirred mixture of 8-bromo-6-methylpyrido [3,4-b]pyrazin-5-one (81.0 mg, 0.34 mmol, 1.0 equiv) and 4-[(dimethylamino)methyl]-3,5-dimethoxyphenylboronic acid (96.80 mg, 0.41 mmol, 1.2 equiv) in 1,4-dioxane (4 mL) and H.sub.2O (1 mL) was added Pd(dppf)Cl.sub.2 (49.38 mg, 0.067 mmol, 0.2 equiv) and Cs.sub.2CO.sub.3 (274.84 mg, 0.84 mmol, 2.5 equiv), and the reaction was stirred at 90 degrees C. under nitrogen atmosphere. After completion of the reaction, the mixture was allowed to cool down to room temperature. The reaction was diluted with water (25 mL) and extracted with EtOAc (3?20 mL). The filtrate was concentrated under reduced pressure. The crude product was purified by Prep-HPLC (conditions: Xselect CSH F-Phenyl OBD Column 19*150 mm 5 ?m; Mobile Phase A: Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/minute; Gradient: 6% B to 10% B in 6 minutes; 220 nm; R.sub.T: 4.37 minutes) to afford formate of 8-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methylpyrido [3,4-b]pyrazin-5-one (15.1 mg, 12.54%) as a yellow solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 8.98 (s, 1H), 8.87 (s, 1H), 8.58 (s, 0.75H, FA), 7.97 (s, 1H), 7.02 (d, J=1.6 Hz, 2H), 4.30 (s, 2H), 3.96 (d, J=1.5 Hz, 6H), 3.79 (s, 3H), 2.82 (s, 6H). LCMS (ESI) m/z: [M+H].sup.+=355.4.

    Example 20Preparation of 1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl] methyl]-N-methylazetidine-3-carboxamide formic acid (Compound B34 Formic Acid)

    [0499] ##STR00187##

    [0500] To a stirred mixture of 1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]azetidine-3-carboxylic acid (127.87 mg, 0.24 mmol, 1.0 equiv) and DIEA (189.43 mg, 1.47 mmol, 6.0 equiv) in DCM (3 mL) was added methanamine hydrochloride (19.79 mg, 0.29 mmol, 1.20 equiv). The mixture was stirred at room temperature for 5 minutes, then HATU (139.32 mg, 0.37 mmol, 1.50 equiv) was added. The mixture was stirred for another 2 hours at room temperature. The residue was directly purified by Prep-HPLC (conditions: Xselect CSH F-Phenyl OBD Column 19*150 mm 5 ?m; Mobile Phase A: Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/minute; Gradient: 7% B to 7% B in 7 minutes; 220 nm; RT: 5.17 minutes) to afford 1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]-N-methylazetidine-3-carboxamide formic acid (13.7 mg, 11%) as a yellow solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.54 (s, 1H), 8.69 (d, J=5.8 Hz, 1H), 8.55 (brs, 1.3H, FA), 7.77 (s, 1H), 7.62 (d, J=5.8 Hz, 1H), 6.86 (s, 2H), 4.45 (s, 2H), 4.24-4.16 (m, 4H), 3.97 (s, 6H), 3.72 (s, 3H), 3.56 (p, J=7.9 Hz, 1H), 2.79 (s, 3H). LCMS (ESI) m/z: [M+H].sup.+=423.25.

    Example 21Preparation of N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]-N-methylethane-1-sulfonamide (Compound B35)

    [0501] ##STR00188##

    [0502] To a stirred mixture of 4-[3,5-dimethoxy-4-[(methylamino)methyl]phenyl]-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (65 mg, 1.0 equiv) and TEA (58.29 mg, 3.0 equiv) in DCM (1 mL) was added propane-2-sulfonyl chloride (37.2 mg, 1.5 equiv). The mixture was stirred at 25 degrees C. for 2 hours. The resulting mixture was concentrated under vacuum. The crude product was purified by Prep-HPLC (conditions: XBridge Shield RP18 OBD Column, 5 ?m, 19*150 mm; Mobile Phase A: Water (0.05% NH.sub.3H.sub.2O), Mobile Phase B: ACN; Flow rate: 25 mL/minute; Gradient: 27% B to 46% B in 8 minutes; 220 nm; R.sub.T: 7.8 minutes) to afford N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]-N-methylethane-1-sulfonamide (8.4 mg, 10%) as a white solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.54 (d, J=0.9 Hz, 1H), 8.69 (d, J=5.8 Hz, 1H), 7.77 (s, 1H), 7.65 (dd, J=5.8, 1.0 Hz, 1H), 6.79 (s, 2H), 4.52 (s, 2H), 3.91 (s, 6H), 3.72 (s, 3H), 3.17 (q, J=7.3 Hz, 2H), 2.77 (s, 3H), 1.34 (q, J=8.4, 7.9 Hz, 3H). LCMS (ESI) m/z: [M+H].sup.+=432.25.

    Example 22Preparation of 4-[4-[(dimethylamino)methyl]-3-(methylsulfanyl)phenyl]-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (Compound B36)

    [0503] ##STR00189##

    Step 1: Preparation of 2-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,2-dihydro-2,7-naphthyridin-1-one (i22-2)

    [0504] ##STR00190##

    [0505] To a solution of 4-bromo-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (239 mg, 1.000 mmol, 1 equiv) and 4,4,5,5-tetramethyl-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,3,2-dioxaborolane (380.80 mg, 1.500 mmol, 1.5 equiv) in dioxane (3.00 mL) was added CH.sub.3COOK (294.34 mg, 2.999 mmol, 3 equiv) and Pd(dppf)Cl.sub.2 (36.57 mg, 0.050 mmol, 0.05 equiv). The resulting solution was stirred at 80 degree C. for 1 hour. The resulting mixture was concentrated under reduced pressure. The residue was applied onto a silica gel column with ethyl acetate/petroleum ether (1:1). This resulted in 2-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,2-dihydro-2,7-naphthyridin-1-one (228 mg, 79.71%) as a white solid. LCMS (ESI) m/z: [M+H]+=287.1.

    Step 2: Preparation of 4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)-2-(methylsulfanyl)benzaldehyde (i22-3)

    [0506] ##STR00191##

    [0507] To a solution of 2-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2,7-naphthyridin-1-one (228.00 mg, 0.797 mmol, 1.00 equiv), 4-bromo-2-(methylsulfanyl)benzaldehyde (184.15 mg, 0.797 mmol, 1.00 equiv), and Cs.sub.2CO.sub.3 (776.89 mg, 2.390 mmol, 3 equiv) in 1,4-dioxane (3.00 mL) was added Pd(dppf)Cl.sub.2 (58.30 mg, 0.080 mmol, 0.10 equiv) and H.sub.2O (1.00 mL) at 25 degrees C. The resulting solution was stirred for 2 hours at 80 degrees C. The resulting solution was diluted with 10 mL of water. The resulting solution was extracted with ethyl acetate (2?20 mL) and the organic layers combined and dried over anhydrous sodium sulfate and concentrated. The residue was applied onto a silica gel column with ethyl acetate/petroleum ether (1:1). This resulted in 4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)-2-(methylsulfanyl)benzaldehyde (200 mg, 80.87%) as a yellow solid. LCMS (ESI) m/z: [M+H].sup.+=311.1.

    Step 3: Preparation of 4-[4-[(dimethylamino)methyl]-3-(methylsulfanyl)phenyl]-2-methyl-2,7-naphthyridin-1-one (Compound B36)

    [0508] ##STR00192##

    [0509] To a solution of 4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)-2-(methylsulfanyl)benzaldehyde (200.00 mg, 0.644 mmol, 1.00 equiv) and dimethylamine (34.86 mg, 0.773 mmol, 1.20 equiv) in MeOH (3.00 mL) was added NaBH.sub.3CN (80.99 mg, 1.289 mmol, 2.00 equiv) at 0 degrees C. The resulting solution was stirred for 1 hours at 0 degrees C. The resulting solution was diluted with 10 mL of water and extracted with ethyl acetate (2?20 mL), and the organic layers combined and dried over anhydrous sodium sulfate and concentrated. The crude product was purified by Prep-HPLC (conditions: Atlantis HILIC OBD Column, 19 mm?150 mm; mobile phase, Water (0.1% FA) and ACN (hold 5% PhaseB in 2 minutes, up to 17% in 8 minutes); Detector, UV). This resulted in 4-[4-[(dimethylamino)methyl]-3-(methylsulfanyl)phenyl]-2-methyl-2,7-naphthyridin-1-one (150 mg, 68.57%) as a white solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.54 (s, 1H), 8.68 (d, J=5.8 Hz, 1H), 7.73 (s, 1H), 7.56 (d, J=5.7 Hz, 1H), 7.48 (d, J=7.8 Hz, 1H), 7.39 (d, J=1.7 Hz, 1H), 7.26 (dd, J=7.8, 1.7 Hz, 1H), 3.71 (s, 3H), 3.64 (s, 2H), 2.52 (s, 3H), 2.33 (s, 6H). LCMS (ESI) m/z: [M+H].sup.+=340.20.

    Example 23Preparation of 4-[4-[(dimethylamino)methyl]-3-methanesulfonylphenyl]-2-methyl-2,7-naphthyridin-1-one (Compound B37)

    [0510] ##STR00193##

    Step 1: Preparation of [(4-bromo-2-methanesulfonylphenyl)methyl]dimethylamine (i23-2)

    [0511] ##STR00194##

    [0512] To a solution of 4-bromo-2-methanesulfonylbenzaldehyde (263 mg, 1.000 mmol, 1 equiv) and dimethylamine (135.20 mg, 2.999 mmol, 3 equiv) in MeOH (3.00 mL) was added NaBH.sub.3CN (125.63 mg, 1.999 mmol, 2 equiv) at 0 degrees C. The resulting solution was stirred for 1 hour at 0 degrees C. The resulting solution was diluted with 10 mL of water. The resulting solution was extracted with ethyl acetate (2?20 mL), and the organic layers combined, dried over anhydrous sodium sulfate, and concentrated. The residue was applied onto a silica gel column with ethyl acetate/petroleum ether (0-50%). This resulted in [(4-bromo-2-methanesulfonylphenyl)methyl]dimethylamine (175 mg, 59.92%) as a yellow solid. LCMS (ESI) m/z: [M+H]+=278.0.

    Step 2: Preparation of 4-[4-[(dimethylamino)methyl]-3-methanesulfonylphenyl]-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (Compound B37)

    [0513] ##STR00195##

    [0514] To a solution of [(4-bromo-2-methanesulfonylphenyl)methyl]dimethylamine (175 mg, 0.599 mmol, 1.00 equiv) and 2-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2,7-naphthyridin-1-one (205.65 mg, 0.719 mmol, 1.20 equiv) in 1,4-dioxane (3.00 mL) was added Cs.sub.2CO.sub.3 (585.43 mg, 1.797 mmol, 3.00 equiv), Pd(dppf)Cl.sub.2 (43.82 mg, 0.060 mmol, 0.10 equiv), and H.sub.2O (1.00 mL) at 25 degrees C. The resulting solution was stirred for 2 hours at 80 degrees C. The resulting solution was diluted with 10 mL of water and extracted with ethyl acetate (2?20 mL), and the organic layers combined and dried over anhydrous sodium sulfate and concentrated. The crude product was purified by Prep-HPLC (conditions: Atlantis HILIC OBD Column, 19 mm?250 mm; mobile phase, Water (0.1% FA) and ACN (hold 5% PhaseB in 2 minutes, up to 17% in 8 minutes); Detector, UV). This resulted in 4-[4-[(dimethylamino)methyl]-3-methanesulfonylphenyl]-2-methyl-2,7-naphthyridin-1-one (120 mg, 53.94%) as a white solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.55 (s, 1H), 8.71 (d, J=5.7 Hz, 1H), 8.16 (d, J=1.9 Hz, 1H), 7.80 (d, J=9.0 Hz, 2H), 7.72 (d, J=7.8 Hz, 1H), 7.53 (d, J=5.8 Hz, 1H), 3.96 (s, 2H), 3.72 (s, 3H), 3.47 (s, 3H), 2.33 (s, 6H). LCMS (ESI) m/z: [M+H]+=372.10.

    Example 24Preparation N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]-N-methylmethanesulfonamide (Compound B38)

    [0515] ##STR00196##

    [0516] Compound B38 was prepared in a similar manner as described for compound B35. N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]-N-methylmethane sulfonamide (14.2 mg, 16%) was obtained as a white solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.57 (s, 1H), 8.70 (d, J=6.1 Hz, 1H), 7.90 (s, 1H), 7.79 (d, J=6.2 Hz, 1H), 6.80 (s, 2H), 4.50 (s, 2H), 3.92 (s, 6H), 3.74 (s, 3H), 2.94 (s, 3H), 2.75 (s, 3H). LCMS (ESI) m/z: [M+H].sup.+=418.10.

    Example 25Preparation of N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]-N-methyl cyclopropanesulfonamide (Compound B39)

    [0517] ##STR00197##

    [0518] Compound B39 was prepared in a similar manner as described for compound B35. N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]-N-methylcyclopropanesulfonamide (14.2 mg, 31%) was obtained as a white solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.54 (d, J=0.9 Hz, 1H), 8.70 (d, J=5.7 Hz, 1H), 7.77 (s, 1H), 7.65 (d, J=5.6 Hz, 1H), 6.79 (s, 2H), 4.54 (s, 2H), 3.91 (s, 6H), 3.72 (s, 3H), 3.29 (s, 1H), 2.77 (s, 3H), 1.14-1.05 (m, 4H). LCMS (ESI) m/z: [M+H].sup.+=444.20.

    Example 26Preparation of N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]-N,2-dimethylpropane-1-sulfonamide (compound B40)

    [0519] ##STR00198##

    [0520] Compound B40 was prepared in a similar manner as described for compound B35. N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]-N,2-dimethylpropane-1-sulfonamide (10.3 mg, 8%) was obtained as a white solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.54 (d, J=0.9 Hz, 1H), 8.69 (d, J=5.8 Hz, 1H), 7.77 (s, 1H), 7.65 (dd, J=5.8, 0.9 Hz, 1H), 6.79 (s, 2H), 4.52 (s, 2H), 3.91 (s, 6H), 3.72 (s, 3H), 2.99 (d, J=6.5 Hz, 2H), 2.76 (s, 3H), 2.26 (hept, J=6.6 Hz, 1H), 1.14 (d, J=6.7 Hz, 6H). LCMS (ESI) m/z: [M+H].sup.+=460.15.

    Example 27Preparation of 2-(1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]azetidin-3-yl)acetic acid formic acid (compound B41 formic acid)

    [0521] ##STR00199##

    Step 1: Preparation of 2-(1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]azetidin-3-yl)acetate (i27-2)

    [0522] ##STR00200##

    [0523] To a solution of 2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)benzaldehyde (100.00 mg, 0.308 mmol, 1.00 equiv) and methyl 2-(azetidin-3-yl)acetate; trifluoroacetic acid (82.48 mg, 0.339 mmol, 1.10 equiv) in MeOH (3.00 mL) was added NaBH.sub.3CN (38.75 mg, 0.617 mmol, 2.00 equiv). The resulting mixture was stirred at room temperature for 16 hours. The mixture was concentrated under reduced pressure. The crude product was purified by flash silica chromatography, elution gradient 0 to 10% MeOH in DCM. Pure fractions were evaporated to dryness to afford methyl 2-(1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]azetidin-3-yl)acetate (110 mg, 81.55%) as a brown solid. LCMS (ESI) m/z: [M+H].sup.+=438.

    Step 2: Preparation of 2-(1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]azetidin-3-yl)acetic acid formic acid (compound B41 formic acid)

    [0524] ##STR00201##

    [0525] To a solution of methyl 2-(1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]azetidin-3-yl)acetate (120 mg, 0.274 mmol, 1 equiv) in MeOH (5 mL) and H.sub.2O (1 mL) was added LiOH (65.69 mg, 2.743 mmol, 10 equiv). The resulting mixture was stirred at room temperature for 3 hours. The solvent was removed under reduced pressure, the residue was dissolved in water (10 mL). The mixture was acidified to pH 3 with 1 N HCl (aq.). The solvent was removed under reduced pressure. The crude product was purified by preparative HPLC (conditions: XSelect CSH Prep C18 OBD Column, 5 um, 19*150 mm; Mobile Phase A:Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 5% B to 35% B in 8 min; 254 nm; Rt: 7.25 min). Fractions containing the desired compound were evaporated to dryness to afford 2-(1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]azetidin-3-yl)acetic acid formic acid (8.1 mg, 6.16%) as an off-white solid. .sup.1H NMR (400 MHz, DMSO-d6) ? 9.44 (s, 1H), 8.72 (d, J=5.6 Hz, 1H), 8.26 (s, 0.67H, FA), 7.86 (s, 1H), 7.56 (d, J=5.6 Hz, 1H), 6.79 (d, J=11.8 Hz, OH), 6.74 (s, 2H), 4.36 (dd, J=8.8, 7.1 Hz, 1H), 4.04 (dd, J=8.8, 5.8 Hz, 1H), 3.90 (s, 6H), 3.76 (s, 2H), 3.60 (s, 3H), 2.72 (p, J=7.0 Hz, 1H), 2.65-2.52 (m, 3H), 2.28 (dd, J=17.3, 6.4 Hz, 1H). LCMS (ESI) m/z: [M+H].sup.+=424.25.

    Example 28Preparation ethyl N-(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-1,4-dimethyl-2-oxo-1,2-dihydropyridin-3-yl)carbamate (Compound B42)

    [0526] ##STR00202##

    Step 1: Preparation of N-(5-bromo-1,4-dimethyl-2-oxo-1,2-dihydropyridin-3-yl)propanamide (i28-2)

    [0527] ##STR00203##

    [0528] To a solution of 3-amino-5-bromo-1,4-dimethylpyridin-2-one (300.00 mg, 1.382 mmol, 1.00 equiv) in THF (3.00 mL) was added NaH (66.33 mg, 2.764 mmol, 2 equiv) and ethyl chloroformate (179.98 mg, 1.658 mmol, 1.2 equiv). The resulting solution was stirred for 1 hour at room temperature. Then the reaction was quenched with saturated NH.sub.4Cl (aq.) and purified by silica gel column chromatography, eluted with PE/EtOAc (5:1) to afford ethyl N-(5-bromo-1,4-dimethyl-2-oxopyridin-3-yl)carbamate (287 mg, 71.82%). LCMS (ESI) m/z: [M+H]+=289.1.

    Step 2: Preparation of ethyl N-(5-[4-[(dimethylamino) methyl]-3,5-dimethoxyphenyl]-1,4-dimethyl-2-oxo-1,2-dihydropyridin-3-yl)carbamate (Compound B42)

    [0529] ##STR00204##

    [0530] To a solution of ethyl N-(5-bromo-1,4-dimethyl-2-oxo-1,2-dihydropyridin-3-yl)carbamate (25 mg, 0.086 mmol, 1 equiv) and [4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]boronic acid (20.67 mg, 0.086 mmol, 1 equiv) in solvent dioxane (2 mL) and H.sub.2O (0.5 mL) was added Cs.sub.2CO.sub.3 (84.52 mg, 0.259 mmol, 3 equiv) and Pd(dppf)Cl.sub.2 (9.49 mg, 0.013 mmol, 0.15 equiv). The resulting solution was stirred at 90 degree C. for 2 hours (under N.sub.2 atmosphere). The crude product (140 mg) was purified by Prep-HPLC (conditions: X Bridge Shield RP18 OBD Column, 5 um, 19*150 mm; Mobile Phase A:Water (0.05% NH.sub.3H.sub.2O), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 30% B to 65% B in 8 minutes; 220 nm; Rt: 8.2 minutes) to afford ethyl N-(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-1,4-dimethyl-2-oxo-1,2-dihydropyridin-3-yl)carbamate (9.1 mg, 4.46%) as a light brown solid. .sup.1H NMR (300 MHz, Methanol-d4) ? 7.56 (s, 1H), 6.65 (s, 2H), 4.21 (q, J=7.1 Hz, 2H), 3.88 (s, 6H), 3.79 (s, 2H), 3.64 (s, 3H), 2.41 (s, 6H), 2.12 (s, 3H), 1.32 (t, J=7.1 Hz, 3H). LCMS (ESI) m/z: [M+H]+=404.3.

    Example 29Preparation of 4-(4-((dimethylamino) methyl)-3,5-dimethoxyphenyl)-6-methyl-1,6-dihydro-7H-pyrazolo[3,4-c]pyridin-7-one (Compound B43)

    [0531] ##STR00205##

    Step 1: Preparation of 3-amino-5-bromo-1,4-dimethylpyridin-2(1H)-one (i29-2)

    [0532] ##STR00206##

    [0533] To a stirred mixture of NH.sub.4Cl (17.3 g, 323.42 mmol, 10.0 equiv) in H.sub.2O/EtOH (1/1, 400 mL) was added 5-bromo-1,4-dimethyl-3-nitro-1,2-dihydropyridin-2-one (8.0 g, 32.38 mmol, 1.0 equiv) and Fe (18.1 g, 324.11 mmol, 10.0 equiv) at room temperature. The mixture was stirred at rt. for 2 hours, the solid was filtered off. The filtrate was diluted with water (100 mL) and extracted with ethyl acetate (200 mL?2). The organic layers were combined and washed with saturated NaCl (aq.), dried over with anhydrous Na.sub.2SO.sub.4. After filtration, the filtrate was concentrated under reduced pressure. This resulted in 6.56 g (93%) 3-amino-5-bromo-1,4-dimethyl-pyridin-2(1H)-one as a red solid that was used directly without further purification. LCMS (ESI) m/z: [M+H].sup.+=217.

    Step 2: Preparation of 4-bromo-6-methyl-1,6-dihydro-7H-pyrazolo[3,4-c]pyridin-7-one (i29-3)

    [0534] ##STR00207##

    [0535] To a solution of acetyl acetate (2.82 g, 27.62 mmol, 3.0 equiv) in toluene (50 mL) was added KOAc (1.01 g, 11.11 mmol, 1.20 equiv) at 25 degrees C. After stirring for 24 hours, to the yellow mixture was added 3-methylbutyl nitrite (174.86 mg, 1.49 mmol, 1.50 equiv), the resulting mixture was stirred at 110 degrees C. for another 18 hours. Then it was allowed to cool down and mixture was concentrated under vacuum, the residue was purified by silica gel column chromatography (EtOAc/PE from 1/2 to 1/1). This resulted in 1.15 g (38%) of 4-bromo-6-methyl-1,6-dihydro-7H-pyrazolo [3,4-c]pyridin-7-one as a yellow solid. LCMS (ESI) m/z: [M+H].sup.+=228.

    Step 3: Preparation of 4-(4-((dimethylamino)methyl)-3,5-dimethoxyphenyl)-6-methyl-1,6-dihydro-7H-pyrazolo [3,4-c] pyridin-7-one (Compound B43)

    [0536] ##STR00208##

    [0537] To a stirred mixture of 4-bromo-6-methyl-1H,6H,7H-pyrazolo[3,4-c]pyridin-7-one (220.34 mg, 0.97 mmol, 1.10 equiv) and [4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]boronic acid (210 mg, 0.88 mmol, 1.0 equiv) in dioxane (5 mL) and H.sub.2O (1 mL), was added Cs.sub.2CO.sub.3 (858.57 mg, 2.64 mmol, 3.0 equiv) and Pd(dppf)Cl.sub.2.Math.CH.sub.2Cl.sub.2 (107.6 mg, 0.13 mmol, 0.15 equiv) at 25 degrees C. The resulting mixture was heated to 90 degrees C. under nitrogen atmosphere. After 16 hours, it was cooled down and diluted with water (10 mL), then extracted with ethyl acetate (20 mL?2). The organic layers were combined and washed with saturated NaCl (aq.), dried over with anhydrous Na.sub.2SO.sub.4. After filtration, the filtrate was concentrated under reduced pressure, then the crude product was purified by preparative-HPLC Column (XBridge Shield RP18 OBD Column, 5 um, 19*150 mm; Mobile Phase A: Water (0.1% FA), Mobile Phase B: MeOH-HPLC; Flow rate: 25 mL/min; Gradient: 5% B to 35% B in 8 min; 254 nm; Rt: 3.87 min). This resulted in 19.1 mg (3%) formate of 4-(4-((dimethylamino) methyl)-3,5-dimethoxyphenyl)-6-methyl-1,6-dihydro-7H-pyrazolo[3,4-c]pyridin-7-one as a yellow solid. .sup.1H NMR (300 MHz, Methanol-d4) ? 8.51 (s, 1H, FA), 8.16 (s, 1H), 7.51 (s, 1H), 7.02 (s, 2H), 4.40 (s, 2H), 4.03 (s, 6H), 3.74 (s, 3H), 2.90 (s, 6H). LCMS (ESI) m/z: [M+H].sup.+=343.3.

    Example 30Preparation of 1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl] methyl]-N-[8-(phenylamino)octyl]azetidine-3-carboxamide (Compound B44)

    [0538] ##STR00209##

    Step 1: Preparation of tert-butyl (8-(phenylamino)octyl)carbamate (i30-2)

    [0539] ##STR00210##

    [0540] To a stirred mixture of bromobenzene (25.42 mg, 0.162 mmol, 0.23 equiv) and tert-butyl N-(8-aminooctyl)carbamate (172.05 mg, 0.70 mmol, 1.0 equiv) in dioxane was added Cs.sub.2CO.sub.3 (314.26 mg, 0.97 mmol, 1.37 equiv) and G.sub.3-Bretphos Pd (53.63 mg, 0.063 mmol, 0.09 equiv). The mixture was stirred at 100 degrees C. for 2 h under nitrogen atmosphere. After cooling, the mixture was diluted with water (20 mL) and extracted with DCM (30 mL?3). The organic layers were combined and dried over anhydrous sodium sulfate, filtered and concentrated to give a crude product. The residue was purified by silica gel column chromatography, eluted with (PE/EtOAc 10:1) to afford tert-butyl N-[8-(phenylamino)octyl]carbamate (150 mg, 53%) as an off-white solid. LCMS (ESI) m/z: [M+H].sup.+=321.

    Step 2: Preparation of N.SUB.1.-phenyloctane-1,8-diamine (i30-3)

    [0541] ##STR00211##

    [0542] To a solution of tert-butyl N-[8-(phenylamino)octyl]carbamate (110.0 mg, 0.34 mmol, 1.0 equiv) in DCM (8 mL) was added TFA (2 mL), and the mixture was stirred 2 h at room temperature. Then it was concentrated under reduced pressure to afford N.sub.1-phenyloctane-1,8-diamine (105 mg, 95%) as a yellow solid, that was used directly without further purification. LCMS (ESI) m/z: [M+H].sup.+=221.

    Step 4: 1-(2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzyl)-N-(8-(phenylamino)octyl)azetidine-3-carboxamide (Compound B44)

    [0543] ##STR00212##

    [0544] To a stirred solution of 1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl) phenyl]methyl]azetidine-3-carboxylic acid (95 mg, 0.23 mmol, 1.0 equiv) and N1-phenyloctane-1,8-diamine (102.26 mg, 0.46 mmol, 2.0 equiv) in DMF (2 mL), was added EDCl (53.38 mg, 0.278 mmol, 1.20 equiv) and HOBT (37.62 mg, 0.278 mmol, 1.20 equiv). The resulting mixture was stirred at room temperature under nitrogen atmosphere. The reaction was quenched by the addition of water (5 mL) and extracted with DCM (30 mL?3). The organic layers were combined and dried over anhydrous sodium sulfate, filtered and concentrated to give a crude product. The crude product was purified by Prep-HPLC (conditions: XBridge Shield RP18 OBD Column, 5 um, 19*150 mm; Mobile Phase A: Water (0.05% NH.sub.3.Math.H.sub.2O), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 49% B to 69% B in 8 min; 220 nm; Rt: 7.8 min) to afford 1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]-N-[8-(phenyl-amino)octyl]azetidine-3-carboxamide (6.0 mg, 4%) as a light yellow solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.53 (s, 1H), 8.68 (d, J=5.8 Hz, 1H), 7.73 (s, 1H), 7.63 (d, J=5.8 Hz, 1H), 7.09 (t, J=7.8 Hz, 2H), 6.74 (s, 2H), 6.66-6.56 (m, 3H), 3.88 (s, 6H), 3.80 (s, 2H), 3.71 (s, 3H), 3.50 (d, J=8.0 Hz, 4H), 3.19 (dt, J=11.1, 7.6 Hz, 3H), 3.06 (t, J=7.2 Hz, 2H), 1.61 (p, J=7.1 Hz, 2H), 1.51 (q, J=6.9 Hz, 2H), 1.46-1.37 (m, 2H), 1.37-1.28 (m, 8H). LCMS (ESI) m/z: [M+H]+=612.50.

    Example 31Preparation of (2S)-1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl] azetidine-2-carboxylic acid (Compound B45)

    [0545] ##STR00213##

    Step 1: Preparation of methyl (2S)-1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]azetidine-2-carboxylate (i31-2)

    [0546] ##STR00214##

    [0547] To a solution of 2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzaldehyde (40.00 mg, 0.123 mmol, 1.00 equiv) and methyl (2S)-azetidine-2-carboxylate (15.62 mg, 0.136 mmol, 1.10 equiv) in MeOH (3.00 mL) was added Et.sub.3N (14.98 mg, 0.148 mmol, 1.20 equiv) and NaBH.sub.3CN (23.25 mg, 0.370 mmol, 3.00 equiv) at 0? C. The resulting solution was stirred for 1 hour at 0? C. The resulting solution was diluted with 10 mL of water. The resulting solution was extracted with ethyl acetate (2?20 mL) and the organic layers combined and dried over anhydrous sodium sulfate and concentrated. The residue was applied onto a silica gel column with CH.sub.2Cl.sub.2/MeOH (50:1), which resulted in 42 mg (80.42%) of methyl (2S)-1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]azetidine-2-carboxylate as a yellow solid. LCMS (ESI) m/z: [M+H].sup.+=423.2.

    Step 2: Preparation of (2S)-1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]azetidine-2-carboxylic acid (Compound B45)

    [0548] ##STR00215##

    [0549] To a solution of methyl (2S)-1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]azetidine-2-carboxylate (42 mg, 0.099 mmol, 1.00 equiv) in THF (1.50 mL) was added LiOH (11.88 mg, 0.496 mmol, 5.00 equiv) and H.sub.2O (1.00 mL) at 0? C. The resulting solution was stirred for 2 hours at 25? C. The resulting solution was diluted with 10 mL of water. Then HCl (6 M) (0.50 mL, 16.456 mmol, 165.92 equiv) was added, and the resulting solution was extracted with ethyl acetate (2?20 mL). The organic layers combined and dried over anhydrous sodium sulfate and concentrated. The crude product was purified by Prep-HPLC (conditions: Atlantis HILIC OBD Column, 19 mm?250 mm; mobile phase, Water (0.1% FA) and ACN (hold 5% PhaseB in 2 minutes, up to 17% in 8 minutes); Detector, uv). This resulted in 25 mg (61.65%) (2S)-1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]azetidine-2-carboxylic acid as a white solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.55 (s, 1H), 8.69 (d, J=5.8 Hz, 1H), 7.82 (s, 1H), 7.66 (d, J=5.8 Hz, 1H), 6.85 (s, 2H), 5.00 (t, J=9.5 Hz, 1H), 4.53 (s, 2H), 4.14 (q, J=9.6 Hz, 1H), 3.98 (s, 7H), 3.72 (s, 3H), 2.72 (d, J=10.6 Hz, 1H), 2.61 (q, J=10.1 Hz, 1H). LCMS (ESI) m/z: [M+H].sup.+=410.15

    Example 32Preparation of 1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]azetidine-3-carboxylic acid (Compound B46)

    [0550] ##STR00216##

    Step 1: preparation of methyl (2R)-azetidine-2-carboxylate hydrochloride (i32-2)

    [0551] ##STR00217##

    [0552] A mixture of 1-tert-butyl 2-methyl (2R)-azetidine-1,2-dicarboxylate (40.30 mg, 0.187 mmol, 1.00 equiv) and HCl (4M) in 1,4-dioxane (3.00 mL) was stirred at room temperature for 1 hour. Then the solvent was evaporated, and the result crude methyl (2R)-azetidine-2-carboxylate hydrochloride was used directly in the next step without further purification. LCMS (ESI) m/z: [M+H].sup.+=116.

    Step 2: Preparation of methyl (2R)-1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]azetidine-2-carboxylate (i32-3)

    [0553] ##STR00218##

    [0554] To a stirred solution of methyl (2R)-azetidine-2-carboxylate hydrochloride (28.23 mg, 0.186 mmol, 1.00 equiv) and Et.sub.3N (37.69 mg, 0.372 mmol, 2 equiv) in MeOH (2.00 mL) was added 2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)benzaldehyde (60.40 mg, 0.186 mmol, 1.00 equiv), and the mixture was stirred for 0.5 hours before NaBH.sub.3CN (23.41 mg, 0.372 mmol, 2 equiv) was added in portions at room temperature under ambient atmosphere. Then the reaction was quenched by the addition of water (10 mL) at 0? C., and the mixture extracted with EtOAc (20 mL?2). The organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated to give crude product that was purified by chromatography on silica gel, eluted with MeOH/DCM (0-10%) to afford methyl (2R)-1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]azetidine-2-carboxylate (68 mg, 86.23%) as a yellow solid. LCMS (ESI) m/z: [M+H].sup.+=424.

    Step 3: Preparation of 1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]azetidine-3-carboxylic acid (Compound B46)

    [0555] ##STR00219##

    [0556] To a stirred solution of methyl1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]azetidine-3-carboxylate (840 mg, 1.984 mmol, 1 equiv) in the mixed solvent of THE (4 mL) and H.sub.2O (2 mL) was added LiOH (475.04 mg, 19.836 mmol, 10.00 equiv), and the solution was stirred for 1 hour at ambient atmosphere. The mixture was purified by reverse phase flash to get a crude product, and the result residue was further purified by Prep-HPLC (conditions: XSelect CSH Prep C18 OBD Column, 5 ?m, 19*150 mm; Mobile Phase A: Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 38% B to 58% B in 8 minutes; 254 nm; Rt: 7.35 minutes) to afford 1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]azetidine-3-carboxylic acid (421 mg, 51.84%) as a light yellow semi-solid. .sup.1H NMR (300 MHz, Methanol-d4) ? 9.62 (s, 1H), 8.72 (d, J=6.4 Hz, 1H), 8.08 (s, 1H), 7.92 (d, J=6.3 Hz, 1H), 6.88 (s, 2H), 5.18 (t, J=9.7 Hz, 1H), 4.56 (s, 2H), 4.19 (q, J=9.6 Hz, 1H), 3.98 (s, 7H), 3.75 (s, 3H), 2.72-2.59 (m, 2H). LCMS (ESI) m/z: [M+H]+=410.20.

    Example 33Preparation of 7-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-5-methyl-3H-imidazo[4,5-c]pyridin-4-one formic acid (Compound B47 Formic Acid)

    [0557] ##STR00220## ##STR00221##

    Step 1: Preparation of 7-bromo-3,5-dihydro-4H-imidazo[4,5-c]pyridin-4-one (i33-2)

    [0558] ##STR00222##

    [0559] A solution of 2,5-dibromopyridine-3,4-diamine (1.06 g, 3.97 mmol, 1.0 equiv) in HCOOH (3 mL) was refluxed at 100 degrees C. for 6 hours. The resulting mixture was concentrated under reduced pressure. The crude product was purified by flash silica chromatography, elution gradient 0 to 60% EtOAc in petroleum ether. Pure fractions were evaporated to dryness to afford 7-bromo-3,5-dihydro-4H-imidazo[4,5-c]pyridin-4-one (594 mg, 70%) as an off-white solid. LCMS (ESI) m/z: [M+H].sup.+=214.

    Step 2: Preparation of 7-bromo-3-[[2-(trimethylsilyl)ethoxy]methyl]-5H-imidazo[4,5-c]pyridin-4-one (i33-3)

    [0560] ##STR00223##

    [0561] To a stirred mixture of 7-bromo-3,5-dihydro-4H-imidazo[4,5-c]pyridin-4-one (400.0 mg, 1.87 mmol, 1.0 equiv) and [2-(chloromethoxy)ethyl]trimethylsilane (467.39 mg, 2.80 mmol, 1.50 equiv) in DMF was added TEA (567.36 mg, 5.61 mmol, 3.0 equiv) at room temperature. The resulting mixture was stirred for 3 h at 80 degrees C. After cooling, the solution was diluted with DCM (50 mL) and washed with water (3?20 mL), dried over anhydrous sodium sulfate, filtered and concentrated to give 7-bromo-3-[[2-(trimethylsilyl)ethoxy]methyl]-5H-imidazo-[4,5-c]pyridin-4-one (711.6 mg, 88%) as a light-yellow syrup that was used directly without further purification. LCMS (ESI) m/z: [M+H].sup.+=344.

    Step 3: Preparation of 7-bromo-5-methyl-3-[[2-(trimethylsilyl)ethoxy]methyl]imidazo[4,5-c]pyridin-4-one (i33-4)

    [0562] ##STR00224##

    [0563] A mixture of 7-bromo-3-[[2-(trimethylsilyl)ethoxy]methyl]-5H-imidazo[4,5-c]pyridin-4-one (643.0 mg, 1.87 mmol, 1.0 equiv) in THE (10.0 mL) was cooled to 0 degrees C., then NaH (53.78 mg, 2.24 mmol, 1.20 equiv) was added in portions. The mixture was stirred for 20 min, and then CH.sub.3I (795.27 mg, 5.60 mmol, 3.0 equiv) was added. After stirring for 1 h at room temperature under nitrogen atmosphere, the reaction was quenched with water (100 mL) and the mixture extracted with EA (4?100 mL). The organic layers were combined and dried over anhydrous sodium sulfate, filtered and concentrated to give 7-bromo-5-methyl-3-[[2-(trimethylsilyl)ethoxy]methyl]imidazo[4,5-c]pyridin-4-one (660 mg, 83%) as a brown-yellow syrup, that was used directly without further purification. LCMS (ESI) m/z: [M+H].sup.+=358.

    Step 4: Preparation of 7-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-5-methyl-3-[[2-(trimethylsilyl) ethoxy]methyl]imidazo[4,5-c]pyridin-4-one (i33-5)

    [0564] ##STR00225##

    [0565] To a solution of 7-bromo-5-methyl-3-[[2-(trimethylsilyl)ethoxy]methyl]imidazo[4,5-c]pyridin-4-one (200.0 mg, 0.56 mmol, 1.0 equiv) and 4-[(dimethylamino)methyl]-3,5-dimethoxyphenylboronic acid (160.14 mg, 0.67 mmol, 1.20 equiv) in dioxane (10 mL) and H.sub.2O (2 mL) was added Cs.sub.2CO.sub.3 (545.59 mg, 1.68 mmol, 3.0 equiv) and Pd(dppf)Cl.sub.2.Math.CH.sub.2Cl.sub.2 (40.84 mg, 0.056 mmol, 0.10 equiv). The mixture was stirred for 2 hours at 90 degrees C. under a nitrogen atmosphere. After cooling, the mixture was diluted with water (20 mL) and extracted with EtOAc (30 mL?3). The organic layers were combined and dried over anhydrous sodium sulfate, filtered and concentrated to give a crude product. The crude product was purified by flash silica chromatography, elution gradient 0 to 7% CH.sub.3OH in CH.sub.2Cl.sub.2. Pure fractions were evaporated to dryness to afford 7-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-5-methyl-3-[[2-(trimethylsilyl)ethoxy]methyl]imidazo[4,5-c]pyridin-4-one (140 mg, 53%). LCMS (ESI) m/z: [M+H].sup.+=473

    Step 5: Preparation of 7-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-5-methyl-3H-imidazo[4,5-c]pyridin-4-one formic acid (Compound B47 Formic Acid)

    [0566] ##STR00226##

    [0567] A mixture of 7-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-5-methyl-3-[[2-(trimethylsilyl)ethoxy]methyl]imidazo[4,5-c]pyridin-4-one (120.0 mg, 0.25 mmol, 1.0 equiv) in 2M HCl-1,4-dioxane (5 mL) was stirred for 2 hours at 70 degrees C. After cooling, the mixture was concentrated under reduced pressure. The crude product was purified by Prep-HPLC with the following conditions: Column: SunFire C18 OBD Prep Column, 100 ?, 5 ?m, 19 mm?250 mm; Mobile Phase A:Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 7% B to 26% B in 8 min; 254 nm; Rt: 6.25 min. to afford formate of 26 mg (25%) of 7-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-5-methyl-3H-imidazo [4,5-c]pyridin-4-one as a white solid. 1H NMR (400 MHz, Methanol-d4) ? 8.55 (s, 1H), 8.24 (s, 1H), 7.78 (s, 1H), 7.20 (s, 2H), 4.39 (s, 2H), 4.03 (s, 6H), 3.77 (s, 3H), 2.89 (s, 6H). LCMS (ESI) m/z: [M+H]+=343.15.

    Example 34Preparation of 1-[[4-(1,5-dimethyl-6-oxopyridin-3-yl)-2,6-dimethoxyphenyl]methyl]azetidine-3-carboxylic acid (Compound B48)

    [0568] ##STR00227##

    Step 1: Preparation of 4-(1,5-dimethyl-6-oxopyridin-3-yl)-2,6-dimethoxybenzaldehyde (i34-2)

    [0569] ##STR00228##

    [0570] To a stirred solution of 1,3-dimethyl-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyridin-2-one (430 mg, 1.73 mmol, 1.0 equiv) and 4-bromo-2,6-dimethoxybenzaldehyde (634.52 mg, 2.59 mmol, 1.50 equiv) in 1,4-dioxane (25 mL)/H.sub.2O (5 mL), was added Pd(dppf)Cl.sub.2 (126.3 mg, 0.17 mmol, 0.10 equiv) and Cs.sub.2CO.sub.3 (1 124.78 mg, 3.45 mmol, 2.0 equiv). The resulting solution was stirred at 90 degrees C. for 2 h under nitrogen atmosphere. Then the mixture was allowed to cool down to room temperature, the mixture was diluted with water (25 mL) and extracted with EtOAc (3?25 mL). The organic layers were combined and dried over anhydrous sodium sulfate, filtered and concentrated to give a crude product. The residue was purified by silica gel column chromatography, eluted with CH.sub.2Cl.sub.2/MeOH (20:1) to afford 4-(1,5-dimethyl-6-oxopyridin-3-yl)-2,6-dimethoxybenzaldehyde (313 mg, 51.42%) as an off-white solid. LCMS (ESI) m/z: [M+H].sup.+=288

    Step 2: Preparation of methyl 1-[[4-(1,5-dimethyl-6-oxopyridin-3-yl)-2,6-dimethoxyphenyl]methyl]azetidine-3-carboxylate (i34-3)

    [0571] ##STR00229##

    [0572] To a stirred mixture of 4-(1,5-dimethyl-6-oxopyridin-3-yl)-2,6-dimethoxybenzaldehyde (313.00 mg, 1.09 mmol, 1.0 equiv) and methyl azetidine-3-carboxylate (188.14 mg, 1.63 mmol, 1.50 equiv) in MeOH was added NaBH.sub.3CN (136.92 mg, 2.18 mmol, 2.0 equiv), the mixture was stirred at room temperature under nitrogen atmosphere. Then the mixture was diluted with water (25 mL) and extracted with EtOAc (3?25 mL). The organic layers were combined and dried over anhydrous sodium sulfate, filtered and concentrated to give a crude product. The residue was purified by silica gel column chromatography, eluted with CHCl.sub.3/MeOH (10:1) to afford methyl 1-[[4-(1,5-dimethyl-6-oxopyridin-3-yl)-2,6-dimethoxyphenyl] methyl]-azetidine-3-carboxylate (172.5 mg, 35%) as a off-white solid. LCMS (ESI) m/z: [M+H].sup.+=386.4

    Step 3: Preparation of 1-[[4-(1,5-dimethyl-6-oxopyridin-3-yl)-2,6-dimethoxyphenyl]methyl]azetidine-3-carboxylic acid (Compound B48)

    [0573] ##STR00230##

    [0574] A mixture of methyl 1-[[4-(1,5-dimethyl-6-oxopyridin-3-yl)-2,6-dimethoxyphenyl]methyl]azetidine-3-carboxylate (169.0 mg, 0.48 mmol, 1.0 equiv) and LiOH (52.36 mg, 2.19 mmol, 5.0 equiv) in THF (3 mL) and H.sub.2O (3 mL) was stirred for 1 h at room temperature. Then the mixture was acidified with 12 N HCl until pH 4. The mixture was extracted with DCM (30 mL?3), dried over anhydrous sodium sulfate, filtered and concentrated to give the crude product which was purified by Prep-HPLC with the following conditions (Column: SunFire C18 OBD Prep Column, 100 ?, 5 ?m, 19 mm?250 mm; Mobile Phase A:Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 7% B to 24% B in 8 min; 254 nm; Rt: 7.85 min) to afford 1-[[4-(1,5-dimethyl-6-oxopyridin-3-yl)-2,6-dimethoxyphenyl]methyl]azetidine-3-carboxylic acid (48 mg, 29%) as a white solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 7.98 (d, J=2.5 Hz, 1H), 7.84 (s, 1H), 6.91 (s, 2H), 4.48 (s, 2H), 4.30 (d, J=9.8 Hz, 4H), 4.01 (s, 6H), 3.69 (s, 3H), 3.59 (s, 1H), 2.23 (s, 3H). LCMS (ESI) m/z: [M+H].sup.+=373.20.

    Example 35Preparation of N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]-N-methyl propane-2-sulfonamide (Compound B49)

    [0575] ##STR00231##

    [0576] Compound B49 was prepared in a similar manner as described for compound B35. N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl) phenyl] methyl]-N-methylpropane-2-sulfonamide (19.1 mg, 9%) was obtained as a white solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.56 (s, 1H), 8.70 (d, J=5.9 Hz, 1H), 7.85 (s, 1H), 7.72 (d, J=6.0 Hz, 1H), 6.80 (s, 2H), 4.53 (s, 2H), 3.91 (s, 6H), 3.73 (s, 3H), 3.62-3.49 (m, 1H), 2.77 (s, 3H), 1.35 (d, J=6.8 Hz, 6H). LCMS (ESI) m/z: [M+H].sup.+=446.25.

    Example 36Preparation of 4-(4-((dimethylamino) methyl)-3,5-dimethoxyphenyl)-2methyl-2,6-naphthyridin-1(2H)-one (Compound B50)

    [0577] ##STR00232##

    Step 1: Preparation of 4-bromo-2,6-naphthyridin-1(2H)-one (i36-2)

    [0578] ##STR00233##

    [0579] To a stirred solution of 1,2-dihydro-2,6-naphthyridin-1-one (500 mg, 3.421 mmol, 1.00 equiv) in CH.sub.3CN (10 mL) was added 1-bromopyrrolidine-2,5-dione (669.81 mg, 3.763 mmol, 1.10 equiv) at room temperature. The resulting mixture was stirred for 3 hours at room temperature. The mixture was concentrated under vacuum. The residue was purified by flash silica gel column chromatography, eluted with ethyl acetate/petroleum ether from 50% to 100%. This resulted in 4-bromo-2,6-naphthyridin-1(2H)-one (760 mg, 99.08%) of as a yellow solid. LCMS (ESI) m/z: [M+H].sup.+=225.

    Step 2: Preparation of 4-bromo-2-methyl-2,6-naphthyridin-1(2H)-one (i36-3)

    [0580] ##STR00234##

    [0581] To a stirred solution of 4-bromo-2,6-naphthyridin-1(2H)-one (396.0 mg, 1.76 mmol, 1.0 equiv) in DMF (6 mL) was added NaH (59.12 mg, 2.464 mmol, 1.40 equiv) at 0 degrees C. After 10 minutes of stirring, iodomethane (499.53 mg, 3.519 mmol, 2.00 equiv) was added to the solution. The solution was stirred at 25 degrees C. for 10 hours. Then water (50 mL) was added, and the reaction mixture was then extracted with DCM (50 mL?3). The combined organic layers were washed with saturated brine (30 mL?2), dried over anhydrous sodium sulfate, filtered, and concentrated to give 331 mg of crude product. This material was used directly in the next step without further purification. LCMS (ESI) m/z: [M+H].sup.+=239.

    Step 3: Preparation of 4-(4-((dimethylamino) methyl)-3,5-dimethoxyphenyl)-2-methyl-2,6-naphthyridin-1 (2H)-one (Compound B50)

    [0582] ##STR00235##

    [0583] To a stirred mixture of 4-bromo-2-methyl-1,2-dihydro-2,6-naphthyridin-1-one (80.30 mg, 0.336 mmol, 1.10 equiv) and [4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]boronic acid (73 mg, 0.305 mmol, 1.00 equiv) in dioxane (5 mL) and H.sub.2O (1 mL) was added Cs.sub.2CO.sub.3 (298.45 mg, 0.916 mmol, 3.00 equiv) and Pd(dppf)Cl.sub.2.Math.CH.sub.2Cl.sub.2 (37.40 mg, 0.046 mmol, 0.15 equiv). The resulting reaction mixture was stirred for 5 hours at 90 degrees C. under N.sub.2 atmosphere. The reaction mixture was concentrated under reduced pressure, and then the residue was diluted with DCM (100 mL) and filtered through a short pad of Celite. The solvent was evaporated and the crude product was purified by preparative HPLC (conditions: XBridge Shield RP18 OBD Column, 5 um, 19*150 mm; Mobile Phase A: Water (10 mmol/L NH.sub.4HCO.sub.3), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 35% B to 75% B in 8 minutes; 220 nm; Rt: 7.9 minutes). This resulted in 4-(4-((dimethylamino) methyl)-3,5-dimethoxyphenyl)-2-methyl-2,6-naphthyridin-1 (2H)-one (9.6 mg, 8.90%) as a yellow solid. .sup.1H NMR (300 MHz, Methanol-d4) ? 9.02 (s, 1H), 8.69 (d, J=5.3 Hz, 1H), 8.28 (d, J=5.4 Hz, 1H), 7.60 (s, 1H), 6.81 (s, 2H), 3.89 (s, 6H), 3.74 (d, J=4.1 Hz, 5H), 2.36 (s, 6H). LCMS (ESI) m/z: [M+H].sup.+=354.15.

    Example 37Preparation of 4-(3-(difluoromethoxy)-4-((dimethylamino)methyl)phenyl)-2-methyl-2,7-naphthyridin-1(2H)-one (Compound B51)

    [0584] ##STR00236##

    [0585] Compound B51 was prepared in a similar manner as described for compound B50. .sup.1H NMR (400 MHz, DMSO-d6) ? 9.43 (d, J=0.9 Hz, 1H), 8.71 (d, J=5.6 Hz, 1H), 7.85 (s, 1H), 7.56 (d, J=7.9 Hz, 1H), 7.45 (dd, J=5.6, 0.9 Hz, 1H), 7.34 (dd, J=7.8, 1.7 Hz, 1H), 7.28-7.24 (m, 1H), 3.57 (s, 3H), 3.47 (s, 2H), 2.19 (s, 6H). LCMS (ESI) m/z: [M+H].sup.+=360.2.

    Example 38Preparation of 8-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methyl-5H,6H-pyrido[3,4-d]pyridazin-5-one (Compound B52)

    [0586] ##STR00237##

    Step 1: Preparation of ethyl 5-[(E)-2-(dimethylamino)ethenyl]pyridazine-4-carboxylate (i38-2)

    [0587] ##STR00238##

    [0588] A mixture of ethyl 5-methylpyridazine-4-carboxylate (200.0 mg, 1.20 mmol, 1.0 equiv) in (dimethoxymethyl)dimethylamine (5.00 mL) was stirred at 80 degrees C. for 3 hours. After completion of the reaction, the solvent was removed under reduced pressure to afford ethyl 5-[(E)-2-(dimethylamino)ethenyl]pyridazine-4-carboxylate (320 mg) as a black solid. The crude was not further purification and directly used in next step. LCMS (ESI) m/z: [M+H].sup.+=222.1.

    Step 3: Preparation of 6-methylpyrido[3,4-d]pyridazin-5-one (i38-3)

    [0589] ##STR00239##

    [0590] To a stirred mixture of ethyl 5-[(E)-2-(dimethylamino)ethenyl]pyridazine-4-carboxylate (300.0 mg, 1.36 mmol, 1.0 equiv) in EtOH (5 mL) was added methanamine hydrochloride (915.48 mg, 1.56 mmol, 10.0 equiv). The reaction was stirred for 3 hours at 75 degrees C. After cooling, the solvent was removed under reduced pressure, and the residue was purified by silica gel column chromatography eluted with DCM/MeOH (20:1) to give 6-methylpyrido[3,4-d]pyridazin-5-one (200 mg, 91%) as a brown solid. LCMS (ESI) m/z: [M+H].sup.+=162.2.

    Step 4: Preparation of 8-bromo-6-methylpyrido[3,4-d]pyridazin-5-one (i38-4)

    [0591] ##STR00240##

    [0592] To a stirred mixture of 6-methylpyrido[3,4-d]pyridazin-5-one (170.0 mg, 1.06 mmol, 1.0 equiv) in DMF (1 mL) was added NBS (226.42 mg, 1.27 mmol, 1.2 equiv). The reaction was stirred room temperature for 2 hours. The reaction mixture was diluted with EA (50 mL), washed with water (3?30 mL) and saturated brine (1?30 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered and evaporated to afford crude product. The residue was purified by silica gel column chromatography, eluted with DCM/MeOH (10:1) to afford 8-bromo-6-methylpyrido[3,4-d]pyridazin-5-one (82 mg, 32%) as a brown solid. LCMS (ESI) m/z: [M+H].sup.+=240.1.

    Step 4: Preparation of 8-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methyl-5H,6H-pyrido[3,4-d]pyridazin-5-one (Compound B52)

    [0593] ##STR00241##

    [0594] To a solution of 8-bromo-6-methyl-5H,6H-pyrido[3,4-d]pyridazin-5-one (60.0 mg, 0.25 mmol, 1.0 equiv), [4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl] boronic acid (59.76 mg, 0.25 mmol, 1.0 equiv), Cs.sub.2CO.sub.3 (162.87 mg, 0.5 mmol, 2.0 equiv) in dioxane (3 mL) and H.sub.2O (0.8 mL) was added Pd(dppf)Cl.sub.2 (18.29 mg, 0.025 mmol, 0.1 equiv). The resulting mixture was stirred at 90 degrees C. for 1 hour under nitrogen atmosphere. After cooling, the solvent was removed under reduced pressure. The residue was purified by chromatography on silica gel eluted with DCM/MeOH (20:1) to give the crude product. The crude product was further purified by Prep-HPLC (conditions: XBridge Shield RP18 OBD Column, 5 ?m, 19*150 mm; Mobile Phase A: Water (10 mmol/L NH.sub.4HCO.sub.3), Mobile Phase B: ACN; Flow rate: 25 mL/minute; Gradient: 17% B to 47% B in 8 minutes; 220 nm; Rt: 7.8 minutes) to afford 8-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methyl-5H,6H-pyrido[3,4-d]pyridazin-5-one (17.3 mg, 19.5%) as an off-white solid. .sup.1H NMR (300 MHz, DMSO-d6) ? 9.72 (d, J=1.4 Hz, 1H), 9.51 (d, J=1.4 Hz, 1H), 8.18 (s, 1H), 6.81 (s, 2H), 3.82 (s, 6H), 3.66 (s, 3H), 3.47 (s, 2H), 2.14 (s, 6H). LCMS (ESI) m/z: [M+H].sup.+=355.20.

    Example 39Preparation of 4-[3,5-dimethoxy-4-[(methylamino)methyl]phenyl]-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (Compound B53)

    [0595] ##STR00242##

    Step 1: Preparation of (4-formyl-3,5-dimethoxyphenyl)boronic acid (i39-2)

    [0596] ##STR00243##

    [0597] To a solution of 4-bromo-2,6-dimethoxybenzaldehyde (4.00 g, 16.322 mmol, 1.00 equiv) and KOAc (4.81 g, 48.965 mmol, 3.00 equiv) in 1,4-dioxane (30.00 ml) was added Bis(pinacolato)diboron (4.97 g, 19.586 mmol, 1.20 equiv) and Pd(dppf)Cl.sub.2 CH.sub.2Cl.sub.2 (1.33 g, 1.632 mmol, 0.10 equiv). The resulting solution was stirred for 3 hours at 90? C. The solids were filtered out. The resulting mixture was concentrated. This resulted in 2.5 g (72.94%) of (4-formyl-3,5-dimethoxyphenyl)boronic acid as a brown solid.

    Step 2: Preparation of 2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzaldehyde (i39-3)

    [0598] ##STR00244##

    [0599] To a solution of (4-formyl-3,5-dimethoxyphenyl)boronic acid (2.80 g, 13.334 mmol, 1.00 equiv), 4-bromo-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (4.78 g, 20.001 mmol, 1.50 equiv), and Cs.sub.2CO.sub.3 (13.03 g, 40.002 mmol, 3 equiv) in 1,4-dioxane (17.50 mL, 198.599 mmol, 15.49 equiv) was added Pd(dppf)Cl.sub.2.Math.CH.sub.2Cl.sub.2 (1.09 g, 1.333 mmol, 0.1 equiv) and H.sub.2O (3.50 mL, 194.276 mmol, 14.57 equiv). The resulting solution was stirred for 2 hours at 80? C. The resulting solution was diluted with 20 mL of water. The resulting solution was extracted with ethyl acetate (2?20 mL) and the organic layers combined and dried over anhydrous sodium sulfate and concentrated. The residue was applied onto a silica gel column with dichloromethane/methanol (2:1). This resulted in 3 g (69.37%) of 2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzaldehyde as a yellow solid.

    Step 3: Preparation of 4-[3,5-dimethoxy-4-[(methylamino)methyl]phenyl]-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (compound B53)

    [0600] ##STR00245##

    [0601] To a solution of 2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzaldehyde (200.00 mg, 0.617 mmol, 1.00 equiv) in MeOH (5.00 mL) was added methylamine (28.73 mg, 0.925 mmol, 1.50 equiv) at 25? C. and the reaction mixture was stirred for 10 minutes. Then NaBH.sub.3CN (116.25 mg, 1.850 mmol, 3.00 equiv) was added to the reaction mixture. The resulting solution was stirred for 1 hour at 25? C. The resulting mixture was concentrated. The crude product was purified by Prep-HPLC (conditions: XBridge Prep C18 OBD Column, 5 ?m, 19*150 mm; mobile phase, Water (0.1% FA) and ACN (hold 5% PhaseB in 2 minutes, up to 26% in 8 minutes); Detector, uv). This resulted in 70 mg (33.45%) of 4-[3,5-dimethoxy-4-[(methylamino)methyl]phenyl]-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one as a white solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.55 (s, 1H), 8.69 (d, J=5.8 Hz, 1H), 8.54 (s, 1H), 7.78 (s, 1H), 7.61 (dd, J=5.7, 0.9 Hz, 1H), 6.87 (s, 2H), 4.33 (s, 2H), 3.97 (s, 6H), 3.72 (s, 3H), 2.74 (s, 3H). LCMS (ESI) m/z: [M+H].sup.+=340.4.

    Example 40Preparation of 4-[4-[(dimethylamino)methyl]-3-methoxy-5-(methylsulfanyl)phenyl]-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (Compound B54)

    [0602] ##STR00246##

    Step 1: Preparation of 4-bromo-2-fluoro-6-methoxybenzaldehyde (i40-2)

    [0603] ##STR00247##

    [0604] To the solution of 4-bromo-2,6-difluorobenzaldehyde (5.00 g, 22.624 mmol, 1.00 equiv) in MeOH (43.00 mL) was added sodium methoxide (1.83 g, 33.936 mmol, 1.5 equiv). The resulting solution was stirred at 65? C. for 12 hours. The resulting solution was concentrated. The residue was purified by silica gel column chromatography, eluted with PE/EtOAc (1:1) to afford 4-bromo-2-fluoro-6-methoxybenzaldehyde (2.87 g, 54.44%) as a light yellow solid. LCMS (ESI) m/z: [M+H]+=233.

    Step 2: Preparation of 4-bromo-2-methoxy-6-(methylsulfanyl)benzaldehyde (i40-3)

    [0605] ##STR00248##

    [0606] To the solution of 4-bromo-2-fluoro-6-methoxybenzaldehyde (1.00 g, 4.291 mmol, 1.00 equiv) in DMSO (20.00 mL) was added (methylsulfanyl)sodium (0.45 g, 6.437 mmol, 1.50 equiv). The resulting solution was stirred at room temperature for 12 hours. The reaction was quenched with water at room temperature. The resulting mixture was extracted with EtOAc (3?75 mL). The combined organic layers were washed with water (3?75 mL) and dried over anhydrous Na.sub.2SO.sub.4. After filtration, the filtrate was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with PE/EtOAc (1:1) to afford 4-bromo-2-methoxy-6-(methylsulfanyl)benzaldehyde (988 mg, 88.17%) as a light yellow solid. LCMS (ESI) m/z: [M+H]+=261.

    Step 3: Preparation of 2-methoxy-6-(methylsulfanyl)-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzaldehyde (i40-4)

    [0607] ##STR00249##

    [0608] To the solution of 4-bromo-2-methoxy-6-(methylsulfanyl)benzaldehyde (400.00 mg, 1.532 mmol, 1.00 equiv) in dioxane (15.00 mL) was added KOAc (451.00 mg, 4.595 mmol, 3 equiv), Pd(dppf)Cl.sub.2 (112.08 mg, 0.153 mmol, 0.1 equiv), and 4,4,4,4,5,5,5,5-octamethyl-2,2-bi-1,3,2-dioxaborolane. The resulting solution was stirred at 90? C. for 6 hours under nitrogen atmosphere. The resulting mixture was filtered, the filter cake was washed with EtOAc (3?15 mL). The filtrate was concentrated under reduced pressure. This resulted in crude 2-methoxy-6-(methylsulfanyl)-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzaldehyde (300 mg, 63.55%) as a light yellow oil, that was used directly without further purification. LCMS (ESI) m/z: [M+H]+=309.

    Step 4: Preparation of 2-methoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)-6-methylsulfanyl)benzaldehyde (i40-5)

    [0609] ##STR00250##

    [0610] To the solution of 4-bromo-2-methyl-2,7-naphthyridin-1-one (442.15 mg, 1.849 mmol, 1.2 equiv) and 2-methoxy-6-(methylsulfanyl)-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzaldehyde in dioxane (15.00 mL) was added H.sub.2O (1.50 mL), Pd(dppf)Cl.sub.2 (112.77 mg, 0.154 mmol, 0.1 equiv), and Cs.sub.2CO.sub.3 (1.51 g, 4.624 mmol, 3 equiv). The resulting solution was stirred at 90? C. for 3 hours. The crude was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with CH.sub.2Cl.sub.2/MeOH (10:1) to afford 2-methoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)-6-(methylsulfanyl)benz aldehyde (70 mg, 13.34%) as a light yellow solid. LCMS (ESI) m/z: [M+H]+=341.

    Step 5: Preparation of 4-[4-[(dimethylamino)methyl]-3-methoxy-5-(methylsulfanyl)phenyl]-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (Compound B54)

    [0611] ##STR00251##

    [0612] To the solution of 2-methoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)-6-(methylsulfanyl)benzaldehyde (70 mg, 0.206 mmol, 1 equiv) in MeOH (2 mL) was added dimethylamine (13.91 mg, 0.308 mmol, 1.5 equiv) and NaBH.sub.3CN (38.77 mg, 0.617 mmol, 3 equiv). The resulting solution was stirred at room temperature for 1 hour. The resulting solution was concentrated. The crude product was purified by Prep-HPLC (conditions: SunFire C18 OBD Prep Column, 100 mm, 5 ?m, 19 mm?250 mm; Mobile Phase A: Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/minute; Gradient: 9% B to 15% B in 8 minutes; 254 nm; Rt: 8.68 minutes) to afford 4-[4-[(dimethylamino)methyl]-3-methoxy-5-(methylsulfanyl)phenyl]-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one as a white solid. .sup.1H NMR (300 MHz, MeOD) ? 9.54 (d, 1H), 8.69 (d, 1H), 7.75 (s, 1H), 7.60 (dd, 1H), 7.02 (d, 1H), 6.92 (d, 1H), 3.89 (s, 3H), 3.73 (d, 5H), 2.51 (s, 3H), 2.34 (s, 6H). LCMS (ESI) m/z: [M+H]+=370.20.

    Example 41Preparation of (2R)-1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]-N-methylazetidine-2-carboxamide (Compound B55)

    [0613] ##STR00252##

    [0614] To a stirred solution of (2R)-1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]azetidine-2-carboxylic acid (40.9 mg, 0.100 mmol, 1.00 equiv) and DIPEA (64.6 mg, 0.499 mmol, 5.00 equiv) in DMF (0.5 mL) was added HATU (76 mg, 0.200 mmol, 2.00 equiv) and methylamine (12.4 mg, 0.400 mmol, 4 equiv). The solution was stirred for 2 hours at room temperature. The resulting mixture was purified directly by Prep-HPLC (conditions: XBridge Shield RP18 OBD Column, 5 ?m, 19*150 mm; Mobile Phase A:Water (0.05% NH.sub.3H.sub.2O), Mobile Phase B: ACN; Flow rate: 25 mL/minute; Gradient: 45% B to 75% B in 8 minutes; 220 nm; Rt: 8.2 minutes) to afford (2R)-1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]-N-methylazetidine-2-carboxamide (6 mg) as a white solid. .sup.1H NMR (300 MHz, Methanol-d4) ? 9.53 (s, 1H), 8.69 (d, J=5.8 Hz, 1H), 7.74 (s, 1H), 7.61 (dd, J=5.8, 0.9 Hz, 1H), 6.75 (s, 2H), 3.89 (s, 6H), 3.94-3.80 (m, 1H), 3.78-3.66 (m, 1H), 3.72 (s, 4H), 3.31-3.14 (m, 2H), 2.76 (s, 3H), 2.31-2.20 (m, 1H), 2.07-1.89 (m, 1H). LCMS (ESI) m/z: [M+H].sup.+=423.15.

    Example 42Preparation of (2S)-1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]-N-methylazetidine-2-carboxamide (Compound B56)

    [0615] ##STR00253##

    [0616] To a solution of (2S)-1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]azetidine-2-carboxylic acid (40 mg, 0.098 mmol, 1.00 equiv) in DMF (2.00 mL) was added methylamine hydrochloride (7.92 mg, 0.117 mmol, 1.20 equiv), HATU (74.29 mg, 0.195 mmol, 2.00 equiv), and DIEA (37.88 mg, 0.293 mmol, 3.00 equiv) at 0? C. The resulting solution was stirred for 2 hours at 25? C. The resulting solution was diluted with 10 mL of water. The resulting solution was extracted with ethyl acetate (2?20 mL) and the organic layers combined and dried over anhydrous sodium sulfate and concentrated. The crude product was purified by Prep-HPLC (conditions: Atlantis HILIC OBD Column, 19 mm?250 mm; mobile phase, Water (0.1% FA) and ACN (hold 5% PhaseB in 2 minutes, up to 17% in 8 minutes); Detector, uv). This resulted in 30 mg (72.68%) (2S)-1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]-N-methylazetidine-2-carboxamide as a yellow solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.59 (s, 1H), 8.71 (d, J=6.1 Hz, 1H), 7.93 (s, 1H), 7.77 (dd, J=6.1, 0.8 Hz, 1H), 6.86 (s, 2H), 5.01 (t, J=9.3 Hz, 1H), 4.51 (d, J=1.6 Hz, 2H), 4.20 (q, J=9.6 Hz, 1H), 4.03 (t, J=9.4 Hz, 1H), 3.98 (s, 6H), 3.74 (s, 3H), 2.78 (s, 3H), 2.74-2.61 (m, 1H), 2.61-2.46 (m, 1H). LCMS (ESI) m/z: [M+H].sup.+=423.20.

    Example 43Preparation of 1-(6-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-3-methyl-[1,2,4]triazolo[4,3-a]pyridin-8-yl)-3,3-dimethylurea (compound B57)

    [0617] ##STR00254##

    Step 1: Preparation of [(4-[8-isocyanato-3-methyl-[1,2,4]triazolo[4,3-a]pyridin-6-yl]-2,6-dimethoxyphenyl) methyl]dimethylamine (i43-2)

    [0618] ##STR00255##

    [0619] To a solution of 6-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-3-methyl-[1,2,4]triazolo[4,3-a]pyridin-8-amine (50.00 mg, 0.146 mmol, 1.00 equiv) and TEA (44.46 mg, 0.439 mmol, 3.00 equiv) in DCM (5.00 mL) was added bis(pyridin-2-yl) carbonate (31.66 mg, 0.146 mmol, 1.00 equiv) at 25? C. The resulting solution was stirred for 1 overnight at 25? C. The resulting mixture was concentrated. This resulted in 30 mg (55.76%) of [(4-[8-isocyanato-3-methyl-[1,2,4]triazolo[4,3-a]pyridin-6-yl]-2,6-dimethoxyphenyl)methyl]dimethylamine as a brown crude solid.

    Step 2: Preparation of 1-(6-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-3-methyl-[1,2,4]triazolo[4,3-a]pyridin-8-yl)-3,3-dimethylurea (Compound B57)

    [0620] ##STR00256##

    [0621] To a solution of [(4-[8-isocyanato-3-methyl-[1,2,4]triazolo[4,3-a]pyridin-6-yl]-2,6-dimethoxyphenyl) methyl]dimethylamine (20.00 mg, 0.054 mmol, 1.00 equiv) in THE (5.00 mL) was added dimethylamine (2.45 mg, 0.054 mmol, 1.00 equiv) and NaH (3.92 mg, 0.163 mmol, 3.00 equiv). The resulting solution was stirred for 2 hours at 25? C. The reaction was then quenched by the addition of 2 mL of MeOH. The resulting mixture was concentrated. The crude product was purified by Prep-HPLC (conditions: XSelect CSH Prep C18 OBD Column, 19*250 mm, 5 ?m; mobile phase, Water (0.1% FA) and ACN (hold 5% PhaseB in 2 minutes, up to 22% in 6 minutes); Detector, UV). This resulted in 2 mg (8.91%) of 1-(6-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-3-methyl-[1,2,4]triazolo[4,3-a]pyridin-8-yl)-3,3-dimethylurea as a brown solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 8.56 (s, 1.3H, FA), 8.29 (d, J=1.4 Hz, 1H), 8.23 (d, J=1.4 Hz, 1H), 7.08 (s, 2H), 4.23 (s, 2H), 4.03 (s, 6H), 3.18 (s, 6H), 2.86 (s, 3H), 2.75 (s, 6H). LCMS (ESI) m/z: [M+H].sup.+=413.30.

    Example 44Preparation of 1-(6-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-[1,2,4]triazolo[4,3-a]pyridin-8-yl)-3,3-dimethylurea (Compound B58)

    [0622] ##STR00257## ##STR00258##

    Step 1: Preparation of 6,8-dibromo-[1,2,4]triazolo[4,3-a]pyridine (i44-2)

    [0623] ##STR00259##

    [0624] A mixture of 3,5-dibromo-2-hydrazinylpyridine (1 g, 3.746 mmol, 1 eq.) and TsOH (0.02 g, 0.112 mmol, 0.03 eq.) in triethoxymethane (25 mL) was stirred at 110? C. for 4 hours. The mixture was cooled and quenched by the addition of 20 mL of water. It was extracted with ethyl acetate (3?20 mL), and the organic layers combined and dried, concentrated under reduced pressure to afford the 6,8-dibromo-[1,2,4]triazolo[4,3-a]pyridine (801 mg crude) as a white solid, which was used directly without further purification. LCMS (ESI) m/z: [M+H]+=277.

    Step 2: Preparation of tert-butyl N-[6-bromo-[1,2,4]triazolo[4,3-a]pyridin-8-yl]carbamate (i44-3)

    [0625] ##STR00260##

    [0626] To a solution of 6,8-dibromo-[1,2,4]triazolo[4,3-a]pyridine (800 mg, 2.889 mmol, 1 eq.) and tert-butyl carbamate (507.65 mg, 4.333 mmol, 1.5 eq.) in dioxane (16 mL) was added Pd.sub.2(dba).sub.3 (132.27 mg, 0.144 mmol, 0.05 eq.), Cs.sub.2CO.sub.3 (1882.54 mg, 5.778 mmol, 2.0 eq.), and XantPhos (250.74 mg, 0.433 mmol, 0.15 eq.). The resulting solution was stirred for 8 hours at 100? C. under a nitrogen atmosphere. The reaction was then quenched by the addition of 20 mL of water and extracted with ethyl acetate (3?30 mL), and the organic layers were combined and dried over anhydrous sodium sulfate. The residue was applied onto a silica gel column with dichloromethane/methanol (10:1) to afford tert-butyl (6-bromo-[1,2,4]triazolo[4,3-a]pyridin-8-yl)carbamate (400 mg, 44.0%) as a gray solid. LCMS (ESI) m/z: [M+H]+=315.

    Step 3: Preparation of tert-butyl N-(6-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-[1,2,4]triazolo[4,3-a]pyridin-8-yl) carbamate (i44-4)

    [0627] ##STR00261##

    [0628] To a solution of tert-butyl (6-bromo-[1,2,4]triazolo[4,3-a]pyridin-8-yl)carbamate (400 mg, 1.277 mmol, 1 eq.) and [4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]boronic acid (244.31 mg, 1.022 mmol, 0.8 eq.) in H.sub.2O (2.00 mL) and dioxane (8.00 mL) was added PdCl2(dppf) (93.46 mg, 0.128 mmol, 0.1 eq.) and Cs.sub.2CO.sub.3 (832.35 mg, 2.555 mmol, 2.0 eq.). The resulting solution was stirred for 13 hours at 80? C. under a nitrogen atmosphere. The reaction was cooled and then quenched by the addition of 20 mL of water and extracted with ethyl acetate (3?20 mL). The organic layer was dried over anhydrous sodium sulfate and concentrated. The residue was applied onto a silica gel column with dichloromethane/methanol (5:1) to afford tert-butyl (6-(4-((dimethylamino)methyl)-3,5-dimethoxyphenyl)-[1,2,4]triazolo[4,3-a]pyridin-8-yl)carbamate (216 mg, 16.8%) as a gray solid. LCMS (ESI) m/z: [M+H]+=428.

    Step 4: Preparation of 6-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-[1,2,4]triazolo[4,3-a]pyridin-8-amine (i44-5)

    [0629] ##STR00262##

    [0630] A solution of tert-butyl (6-(4-((dimethylamino)methyl)-3,5-dimethoxyphenyl)-[1,2,4]triazolo[4,3-a]pyridin-8-yl)carbamate (216 mg, 1 equiv) in HCl (4 M) in 1,4-dioxane (8 mL) was stirred for 4 hours at room temperature. The resulting mixture was concentrated to afford 6-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-[1,2,4]triazolo[4,3-a]pyridin-8-amine (120 mg, 73.7%) as a gray solid, which was used directly without further purification. LCMS (ESI) m/z: [M+H]+=328.

    Step 5: Preparation of 1-(6-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-[1,2,4]triazolo[4,3-a] pyridin-8-yl)-3,3-dimethylurea (compound B58)

    [0631] ##STR00263##

    [0632] To a solution of 6-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-[1,2,4]triazolo[4,3-a]pyridin-8-amine (120 mg, 0.367 mmol, 1 equiv) in pyridine (5 mL, 62.118 mmol, 169.47 equiv) was added dimethylcarbamic chloride (78.83 mg, 0.733 mmol, 2.0 equiv) The resulting solution was stirred for 2 hours at 80? C. The mixture was cooled and concentrated, the crude product was purified by Prep-HPLC (conditions: Atlantis HILIC OBD Column 19*150 mm*5 ?m; mobile phase, Phase A: Water (0.05% TFA) Phase B: MeOH-HPLC; Detector, uv: 254/220 nm). This resulted in 14 mg (9.59%) of 1-(6-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-[1,2,4]triazolo[4,3-a]pyridine-8-yl)-3,3-dimethylurea as a grey solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 8.75 (d, J=2.0 Hz, 1H), 8.49 (s, 1H), 8.42 (d, J=2.0 Hz, 1H), 7.09 (s, 2H), 4.42 (s, 2H), 4.05 (s, 6H), 3.23 (q, J=7.3 Hz, 1H), 3.13 (s, 6H), 2.91 (s, 6H). LCMS (ESI) m/z: [M+H].sup.+=399.1.

    Example 45Preparation of 4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-N,2-dimethyl-1-oxoisoquinoline-7-carboxamide (Compound B59)

    [0633] ##STR00264##

    Step 1: Preparation of methyl 4-bromo-2-methyl-1-oxoisoquinoline-7-carboxylate (i45-2)

    [0634] ##STR00265##

    [0635] To a solution of methyl 2-methyl-1-oxoisoquinoline-7-carboxylate (200.00 mg, 0.921 mmol, 1.00 equiv) in solvent CH.sub.2Cl.sub.2 (3.00 mL) was added NBS (327.74 mg, 1.841 mmol, 2.00 equiv), and the resulting solution was stirred at 0? C. for 1 hour. The resulting mixture was concentrated under reduced pressure. The residue was applied onto a silica gel column with ethyl acetate/petroleum ether (0-50%). This resulted in 210 mg (77.02%) of methyl 4-bromo-2-methyl-1-oxoisoquinoline-7-carboxylate as a yellow solid. LCMS (ESI) m/z: [M+H]+=296.1.

    Step 2: Preparation of methyl 4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-1-oxoisoquinoline-7-carboxylate (i45-3)

    [0636] ##STR00266##

    [0637] To a solution of methyl 4-bromo-2-methyl-1-oxoisoquinoline-7-carboxylate (210.00 mg, 0.709 mmol, 1.00 equiv), 4-[(dimethylamino)methyl]-3,5-dimethoxyphenylboronic acid (203.46 mg, 0.851 mmol, 1.20 equiv), and Cs.sub.2CO.sub.3 (693.19 mg, 2.128 mmol, 3.00 equiv) in 1,4-dioxane (3.00 mL) was added Pd(dppf)Cl.sub.2 (51.89 mg, 0.071 mmol, 0.10 equiv) and H.sub.2O (1.00 mL) at 25? C. The resulting solution was stirred for 2 hours at 80? C. The resulting solution was diluted with 10 mL of water. The resulting solution was extracted with ethyl acetate (2?20 mL) and the organic layers combined and dried over anhydrous sodium sulfate and concentrated. The residue was applied onto a silica gel column with ethyl acetate/petroleum ether (0-100%). This resulted in 195 mg (66.99%) of methyl 4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-1-oxoisoquinoline-7-carboxylate as a yellow solid. LCMS (ESI) m/z: [M+H]+=411.2.

    Step 3: Preparation of 4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-1-oxoisoquinoline-7-carboxylic acid (i45-4)

    [0638] ##STR00267##

    [0639] To a solution of methyl methyl 4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-1-oxoisoquinoline-7-carboxylate (195.00 mg, 0.475 mmol, 1.00 equiv) in Hydrochloric acid 37% solution in water (3.00 mL) at 25? C. The resulting solution was stirred for 2 hours at 90? C. The resulting mixture was concentrated under vacuum. This resulted in 185 mg (98.23%) of 4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-1-oxoisoquinoline-7-carboxylic acid as a yellow solid, that was used directly without further purification. LCMS (ESI) m/z: [M+H].sup.+=397.1.

    Step 4: Preparation of 4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-N,2-dimethyl-1-oxoisoquinoline-7-carboxamide (Compound B59)

    [0640] ##STR00268##

    [0641] To a solution of 4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-1-oxoisoquinoline-7-carboxylic acid (180 mg, 0.454 mmol, 1.00 equiv) in CH.sub.2C.sub.12 (3.00 mL) was added HATU (345.28 mg, 0.908 mmol, 2.00 equiv). After that, CH.sub.3NH.sub.2 (28.20 mg, 0.908 mmol, 2.00 equiv) and DIEA (293.41 mg, 2.270 mmol, 5.00 equiv) was added at 0? C. The resulting solution was stirred for 2 hours at 25? C. The resulting solution was diluted with 10 mL of water and extracted with ethyl acetate (2?20 mL) and the organic layers combined and dried over anhydrous sodium sulfate and concentrated. The crude product was purified by Prep-HPLC (conditions: Atlantis HILIC OBD Column, 19 mm?250 mm; mobile phase, Water (0.1% FA) and ACN (hold 5% PhaseB in 2 minutes, up to 17% in 8 minutes); Detector, uv). This resulted in 150 mg (80.65%) 4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-N,2-dimethyl-1-oxoisoquinoline-7-carboxamide as a yellow solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 8.89 (d, J=2.0 Hz, 1H), 8.12 (dd, J=8.6, 2.1 Hz, 1H), 7.75 (d, J=8.6 Hz, 1H), 7.57 (s, 1H), 6.88 (s, 2H), 4.44 (s, 2H), 3.97 (s, 6H), 3.71 (s, 3H), 2.98 (s, 3H), 2.93 (s, 6H). LCMS (ESI) m/z: [M+H]+=410.30.

    Example 46Preparation of N-(6-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-3-methyl-[1,2,4]triazolo[4,3-a]pyridin-8-yl)acetamide (Compound B60)

    [0642] ##STR00269##

    Step 1: Preparation of 6-bromo-3-methyl-[1,2,4]triazolo[4,3-a]pyridin-8-amine (i46-2)

    [0643] ##STR00270##

    [0644] Into a 50-mL round-bottom flask, was placed tert-butyl N-[6-bromo-3-methyl-[1,2,4]triazolo[4,3-a]pyridin-8-yl]carbamate (300.00 mg, 0.917 mmol, 1.00 equiv), HCl (gas) in 1,4-dioxane (7.50 mL, 205.696 mmol, 269.20 equiv). The resulting solution was stirred for 2 hours at 25? C. The resulting mixture was concentrated. This resulted in 180 mg (86.46%) of 6-bromo-3-methyl-[1,2,4]triazolo[4,3-a]pyridin-8-amine as a white solid.

    Step 2: Preparation of N-[6-bromo-3-methyl-[1,2,4]triazolo[4,3-a]pyridin-8-yl]acetamide (i46-3)

    [0645] ##STR00271##

    [0646] To a solution of 6-bromo-3-methyl-[1,2,4]triazolo[4,3-a]pyridin-8-amine (180.00 mg, 0.793 mmol, 1.00 equiv) in THE (10.00 mL) was added NaH (38.05 mg, 1.585 mmol, 2.00 equiv) and acetyl chloride (74.67 mg, 0.951 mmol, 1.20 equiv) at 25? C. The resulting solution was stirred for 2 hours at 25? C. The reaction was then quenched by the addition of 5 mL of MeOH. The resulting mixture was concentrated. The residue was applied onto a silica gel column with ethyl acetate/petroleum ether (1:1). This resulted in 100 mg (46.88%) of N-[6-bromo-3-methyl-[1,2,4]triazolo[4,3-a]pyridin-8-yl]acetamide as a yellow solid.

    Step 3: Preparation of N-(6-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-3-methyl-[1,2,4]triazolo[4,3-a]pyridin-8-yl)acetamide (Compound B60)

    [0647] ##STR00272##

    [0648] To a solution of N-[6-bromo-3-methyl-[1,2,4]triazolo[4,3-a]pyridin-8-yl]acetamide (60.00 mg, 0.223 mmol, 1.00 equiv), [4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]boronic acid (53.31 mg, 0.223 mmol, 1.00 equiv), and Cs.sub.2CO3 (145.29 mg, 0.446 mmol, 2.00 equiv) in 1,4-dioxane (5.00 mL) was added Pd(dppf)Cl2 CH.sub.2Cl.sub.2 (18.21 mg, 0.022 mmol, 0.10 equiv) and H.sub.2O (1.00 mL) at 25? C. The resulting solution was stirred for 2 hours at 80? C. The resulting solution was diluted with 10 mL of water. The resulting solution was extracted with ethyl acetate (2?20 mL) and the organic layers were combined and dried over anhydrous sodium sulfate and concentrated. The crude product was purified by Prep-HPLC (conditions: SunFire C18 OBD Prep Column, 19 mm?250 mm; mobile phase, Water (0.1% FA (formic acid)) and ACN (hold 5% PhaseB in 2 minutes, up to 17% in 8 minutes); Detector, uv). This resulted in 10.3 mg (12.05%) of N-(6-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-3-methyl-[1,2,4]triazolo[4,3-a]pyridin-8-yl)acetamide as a brown semi-solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 8.55 (s, 1H, FA), 8.48 (d, J=1.4 Hz, 1H), 8.35 (d, J=1.5 Hz, 1H), 7.08 (s, 2H), 4.38 (s, 2H), 4.05 (s, 6H), 2.88 (s, 6H), 2.85 (s, 3H), 2.33 (s, 3H). LCMS (ESI) m/z: [M+H].sup.+=384.25.

    Example 47Preparation of 2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzaldehyde (Compound B61)

    [0649] ##STR00273##

    Step 1: Preparation of 4-bromo-2-methyl-2,7-naphthyridin-1(2H)-one (i47-2)

    [0650] ##STR00274##

    [0651] To a solution of 4-bromo-1,2-dihydro-2,7-naphthyridin-1-one (20.00 g, 88.871 mmol, 1 equiv) in DMF (150 mL) was added NaH (8.80 g, 60%, 222.178 mmol, 2.5 equiv) in portions at 0? C., and the resulting mixture was stirred at 0? C. for 30 minutes. Then CH.sub.3I (1.90 g, 133.307 mmol, 1.5 equiv) was added dropwise. The resulting mixture was stirred at 0? C. for 1 hour. The mixture was poured into ice water (200 mL) and stirred for 30 minutes. The mixture was filtered and the solid was dried to afford 4-bromo-2-methyl-2,7-naphthyridin-1(2H)-one (20.00 g, 94.13%) as light grey solid. LCMS (ESI, m/z): [M+H].sup.+=239.1, [M+H+2].sup.+=241.1.

    Step 2: Preparation of 2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzaldehyde (Compound B61)

    [0652] ##STR00275##

    [0653] To a solution of 4-bromo-2,6-dimethoxybenzaldehyde (5.00 g, 20.402 mmol, 1 equiv) in 1,4-dioxane (300 mL) was added 4,4,5,5-tetramethyl-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,3,2-dioxaborolane (6.22 g, 24.483 mmol, 1.2 equiv), Pd(dppf)Cl.sub.2 (298.57 mg, 0.408 mmol, 0.02 equiv), and KOAc (4.00 g, 40.804 mmol, 2 equiv) at 25? C. The resulting mixture was stirred at 80? C. for 1 hour under N.sub.2 atmosphere. The mixture was cooled to 60? C. Then 4-bromo-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (4.91 g, 20.538 mmol, 1 equiv), Cs.sub.2CO.sub.3 (13.38 g, 41.076 mmol, 2 equiv), Pd(dppf)Cl.sub.2 (298.57 mg, 0.408 mmol, 0.02 equiv), and water (60 mL) were added. The resulting mixture was stirred at 80? C. for 1 hour. The mixture was filtered and activated charcoal (5 g) was added to the filtrate and refluxed at 100? C. for 1 hour. The mixture was filtered and concentrated to get crude product, which was slurried in EA, EtOH, and water respectively to afford light brown solid. This solid was dissolved in DCM and MeOH (200 mL, v/v=20/1), and then precipitated with EA (200 mL) dropwise under stirring. The solid was filtered and dried to afford 2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzaldehyde (2.3 g, 34.63%) as light grey solid. LCMS (ESI, m/z): [M+H].sup.+=325.2. .sup.1H NMR (300 MHz, DMSO) ? 10.41 (s, 1H), 9.46 (s, 1H), 8.74 (d, J=5.7 Hz, 1H), 7.99 (s, 1H), 7.64 (d, J=5.7 Hz, 1H), 6.85 (s, 2H), 3.89 (s, 6H), 3.62 (s, 3H).

    Example 48Preparation of 1-(4-((dimethylamino)methyl)-3,5-dimethoxyphenyl)-3-methylpyrido[3,4-d]pyridazin-4(3H)-one 2,2,2-trifluoroacetate (Compound B62)

    [0654] ##STR00276##

    Step 1: Preparation of 3-methyl-2,3-dihydropyrido[3,4-d]pyridazine-1,4-dione (i48-2)

    [0655] ##STR00277##

    [0656] To a stirred mixture of furo[3,4-c]pyridine-1,3-dione (2.00 g, 13.413 mmol, 1.00 equiv) and methylhydrazine sulfate (5.80 g, 40.240 mmol, 3 equiv) in EtOH (20.00 mL) was added Et.sub.3N (8.14 g, 80.480 mmol, 6.00 equiv), the resulting solution was stirred at 80 degrees C. under nitrogen atmosphere for 10 hours. Then the resulting mixture was concentrated under reduced pressure to give 4.2 g of crude product. This material was used directly in the next step without further purification. LCMS (ESI) m/z: [M+H].sup.+=178.

    Step 2: Preparation of N 1-chloro-3-methylpyrido[3,4-d]pyridazin-4(3H)-one (i48-3)

    [0657] ##STR00278##

    [0658] Into POCl.sub.3 (20.00 mL, 214.567 mmol, 9.05 equiv) was added 3-methyl-2H-pyrido[3,4-d]pyridazine-1,4-dione (4.20 g, 23.707 mmol, 1.00 equiv), and then it was stirred for 8 h at 105 degrees C. under nitrogen atmosphere. The resulting mixture was concentrated to remove POCl.sub.3, then neutralized with the saturated solution of NaHCO.sub.3 (200 mL), extracted with EA (300 mL?3). The combined organic layers were washed with the solution of saturated NaCl, dried over anhydrous Na.sub.2SO.sub.4. After filtration, the filtrate was concentrated under reduced pressure, then purified by flash chromatography (ethyl acetate/petroleum ether from 1:4 to 1:1). This resulted -chloro-3-methylpyrido[3,4-d]pyridazin-4(3H)-one. This material was used directly in the next step without further purification. LCMS (ESI) m/z: [M+H].sup.+=196.

    Step 3: Preparation of 1-(4-((dimethylamino)methyl)-3,5-dimethoxyphenyl)-3-methylpyrido[3,4-d]pyridazin-4(3H)-one 2,2,2-trifluoroacetate (PH-FOG-P3-B87)

    [0659] ##STR00279##

    [0660] Into a stirred mixture of 1-chloro-3-methyl-3H,4H-pyrido[3,4-d]pyridazin-4-one (150.00 mg, 0.767 mmol, 1.00 equiv) and [4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]boronic acid (275.00 mg, 1.150 mmol, 1.50 equiv) in dioxane (5.00 mL) and H.sub.2O (0.50 mL) was added Pd(dppfCl.sub.2.Math.CH.sub.2Cl.sub.2 (62.62 mg, 0.077 mmol, 0.10 equiv) and Cs.sub.2CO.sub.3(999.40 mg, 3.067 mmol, 4.00 equiv) at 25 degrees C. under N.sub.2 atmosphere. Then the reaction was stirred at 90 degrees C. for 12 h. The resulting mixture was extracted with EtOAc (2?40 mL). The combined organic layers were washed with saturated NaCl solution, dried over anhydrous Na.sub.2SO.sub.4. After filtration, the filtrate was concentrated under reduced pressure. The crude product was purified by Prep-HPLC (conditions: Sunfire C18 OBD Prep Column, 5 um, 19 mm*250 mm; Mobile Phase A: Water (0.05% TFA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 2% B to 2% B in 2 min; 254 nm; Rt: 13.78 min). This resulted in 20.3 mg (5.57%) of 1-(4-((dimethylamino)methyl)-3,5-dimethoxyphenyl)-3-methylpyrido[3,4-d]pyridazin-4(3H) as a white solid. .sup.1H NMR (300 MHz, Methanol-d4) ? 9.66 (s, 1H), 8.99 (d, J=5.6 Hz, 1H), 7.79 (d, J=5.6 Hz, 1H), 7.04 (s, 2H), 4.46 (s, 2H), 4.00 (s, 6H), 3.93 (s, 3H), 2.94 (s, 6H). LCMS (ESI) m/z: [M+H].sup.+=355.15.

    Example 49Preparation of 4-(4-((dimethylamino)methyl)-3,5-dimethoxyphenyl)-N,2-dimethyl-1-oxo-1,2-dihydroisoquinoline-6-carboxamide (Compound B63)

    [0661] ##STR00280## ##STR00281##

    Step 1: Preparation of 6-bromo-3-methyl-[1,2,4]triazolo[4,3-a]pyridin-8-amine (i49-2)

    [0662] ##STR00282##

    [0663] To a solution of 6-bromo-2H-isoquinolin-1-one (5.0 g, 22.316 mmol, 1.00 equiv) in DMF was added sodium hydride (60% in oil, 803.3 mg) at 0? C. The mixture was stirred for 15 minutes. Mel (9.5 g, 66.947 m mol, 3.00 equiv) was added, and the mixture was allowed to warm to room temperature and stirred for additional 1 hour. The reaction mixture was quenched by water and extracted with DCM (3?100 mL). The DCM layer was concentrated under vacuum. This resulted in 6-bromo-2-methylisoquinolin-1-one as a white solid (6.45 g, crude) that was used directly without further purification. LCMS (ESI) m/z: [M+H].sup.+=238.

    Step 2: Preparation of methyl 2-methyl-1-oxo-1,2-dihydroisoquinoline-6-carboxylate (i49-3)

    [0664] ##STR00283##

    [0665] To a solution of 6-bromo-2-methylisoquinolin-1-one (1 g, 4.200 mmol, 1.00 equiv) and PdCl.sub.2(dppf) (307.3 mg, 0.420 m mol, 0.10 equiv) in MeOH (9 mL) was added Et.sub.3N (7.00 mL, 50.361 mmol, 11.99 equiv) in a pressure tank. The mixture was purged with nitrogen for 20 minutes and then was pressurized to 50 atm with carbon monoxide. The mixture was then stirred at 100? C. for 15 hours. The reaction mixture was cooled to room temperature and filtered to remove insoluble solids. The resulting mixture was concentrated under vacuum. The residue was purified by silica gel column chromatography, eluted with PE (petroleum ether)/EtOAc (ethyl acetate) (2:1) to afford methyl 2-methyl-1-oxoisoquinoline-6-carboxylate as yellow solid (501 mg, 55%). LCMS (ESI) m/z: [M+H]+=218.

    Step 3: Preparation of methyl 4-bromo-2-methyl-1-oxo-1,2-dihydroisoquinoline-6-carboxylate (i49-4)

    [0666] ##STR00284##

    [0667] To a stirred solution of methyl 2-methyl-1-oxoisoquinoline-6-carboxylate (200 mg, 0.921 mmol, 1.00 equiv) in THE (10 mL) was added NBS (245.8 mg, 1.381 mmol, 1.50 equiv) in portions over 25 minutes at 0? C. The resulting mixture was stirred for additional 2 hours at room temperature. The resulting mixture was diluted with 10 mL of water and extracted with EtOAc (3?30 mL). The combined organic layers were washed with saturated NaCl (20 mL) and dried over anhydrous Na.sub.2SO.sub.4. After filtration, the filtrate was concentrated under reduced pressure. The crude product (161 mg) was used in the next step directly without further purification.

    Step 4: Preparation of 4-bromo-2-methyl-1-oxo-1,2-dihydroisoquinoline-6-carboxylic acid (i49-5)

    [0668] ##STR00285##

    [0669] A solution of methyl 4-bromo-2-methyl-1-oxoisoquinoline-6-carboxylate (161 mg, 0.544 mmol, 1.00 equiv) in conc. HCl (5 mL) was stirred for 4 hours at 100? C. The resulting mixture was concentrated under vacuum. The crude product (177 mg) was used in the next step directly without further purification. LCMS (ESI) m/z: [M+H]+=283.

    Step 5: Preparation of 4-bromo-N,2-dimethyl-1-oxo-1,2-dihydroisoquinoline-6-carboxamide (i49-6)

    [0670] ##STR00286##

    [0671] A solution of 4-bromo-2-methyl-1-oxoisoquinoline-6-carboxylic acid (85 mg, 0.301 mmol, 1.00 equiv) in DMF was treated with HATU (137.5 mg, 0.362 m mol, 1.20 equiv) for 30 minutes at room temperature followed by the addition of DIEA (194.7 mg, 1.507 mmol, 5.00 equiv) and methylamine (9.4 mg, 0.301 mmol, 1.00 equiv) at room temperature. The resulting mixture was stirred for 2 hours at room temperature under nitrogen atmosphere. The resulting mixture was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with CH.sub.2Cl.sub.2/MeOH (10:1) to afford 4-bromo-N,2-dimethyl-1-oxoisoquinoline-6-carboxamide (81 mg, 91%) as a white solid. LCMS (ESI) m/z: [M+H]+=296.

    Step 6: Preparation of 4-(4-((dimethylamino)methyl)-3,5-dimethoxyphenyl)-N,2-dimethyl-1-oxo-1,2-dihydroisoquinoline-6-carboxamide (Compound B63)

    [0672] ##STR00287##

    [0673] To a solution of 4-bromo-N,2-dimethyl-1-oxo-1,2-dihydroisoquinoline-6-carboxamide (80 mg, 0.271 mmol, 1.00 equiv) and [4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]boronic acid (97.2 mg, 0.407 mmol, 1.50 equiv) in dioxane (2 mL) and water (0.4 mL) was added Cs.sub.2CO.sub.3 (264.95 mg, 0.813 mmol, 3.00 e.q.) and Pd(dppf)Cl.sub.2 (19.8 mg, 0.027 mmol, 0.10 equiv). After stirring for 2 hours at 75? C. under nitrogen atmosphere, the resulting mixture was concentrated under reduced pressure. The residue was purified by silica gel column chromatography and eluted with CH.sub.2Cl.sub.2/MeOH (5:1). The crude product was further purified by Prep-HPLC (conditions:Atlantis HILIC OBD Column 19*150 mm*5 ?m; mobile phase, Phase A: Water (10 mmol/L NH.sub.4HCO.sub.3); Phase B: ACN, Gradient; Detector, uv 254/220 nm). This gave 4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-N,2-dimethyl-1-oxo-1,2-dihydroisoquinoline-6-carboxamide (10.1 mg, 9.1%) as a yellow solid. .sup.1H NMR (300 MHz, DMSO-d6) ? 8.64 (d, J=4.9 Hz, 1H), 8.38 (d, J=8.4 Hz, 1H), 8.13 (d, J=1.6 Hz, 1H), 7.93 (dd, J=8.4, 1.7 Hz, 1H), 7.65 (s, 1H), 6.73 (s, 2H), 3.79 (s, 6H), 3.60 (s, 3H), 3.47 (s, 2H), 2.78 (d, J=4.5 Hz, 3H), 2.15 (s, 6H). LCMS (ESI) m/z: [M+H]+=410.20.

    Example 50Preparation of 4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-7-[1H-imidazo[4,5-c]pyridin-2-yl]-2-methylisoquinolin-1-one (Compound B64)

    [0674] ##STR00288##

    [0675] To a solution of 4-bromo-7-[3H-imidazo[4,5-c]pyridin-2-yl]-2-methylisoquinolin-1-one (80.00 mg, 0.225 mmol, 1.00 equiv) and [[2,6-dimethoxy-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl]methyl]dimethylamine (108.52 mg, 0.338 mmol, 1.5 equiv) in mixed DMF (3.00 mL) and H.sub.2O (0.30 mL) was added Cs.sub.2CO.sub.3 (220.15 mg, 0.676 mmol, 3 equiv) and Pd(dppf)Cl.sub.2.Math.CH.sub.2Cl.sub.2 (18.39 mg, 0.023 mmol, 0.10 equiv). After stirring for 2 hours at 90? C. under a nitrogen atmosphere, the resulting mixture was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with CH.sub.2Cl.sub.2/MeOH (12:1) to afford a crude product. The crude product was further purified by Prep-HPLC (conditions: XSelect CSH Prep C18 OBD Column, 5 ?m, 19*150 mm; Mobile Phase A: Water (10 mmol/L NH.sub.4HCO.sub.3), Mobile Phase B: ACN; Flow rate: 25 mL/minute; Gradient: 40% B to 55% B in 8 minutes; 254/220 nm; Rt (retention time): 6.50 minutes) to afford 4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-7-[1H-imidazo[4,5-c]pyridin-2-yl]-2-methylisoquinolin-1-one (7 mg, 6.62%) as a grey solid. .sup.1H NMR (300 MHz, Methanol-d4) ? 9.21 (d, J=2.0 Hz, 1H), 8.91 (d, J=1.0 Hz, 1H), 8.48 (dd, J=8.6, 2.0 Hz, 1H), 8.32 (d, J=5.8 Hz, 1H), 7.86 (d, J=8.6 Hz, 1H), 7.68 (dd, J=5.8, 1.0 Hz, 1H), 7.55 (s, 1H), 6.80 (s, 2H), 3.91 (s, 6H), 3.76 (d, J=18.1 Hz, 5H), 2.41 (s, 6H). LCMS (ESI) m/z: [M+H]+=470.20.

    Example 51Preparation of 4-(4-((dimethylamino)methyl)-3,5-dimethoxyphenyl)-6-(1H-imidazo[4,5-c]pyridin-2-yl)-2-methylisoquinolin-1(2H)-one (Compound B65)

    [0676] ##STR00289##

    [0677] To a solution of 4-bromo-6-[1H-imidazo[4,5-c]pyridin-2-yl]-2-methylisoquinolin-1-one (100.00 mg, 0.282 m mol, 1.00 e.q.) and 4-[(dimethylamino)methyl]-3,5-dimethoxyphenylboronic acid (100.96 mg, 0.422 mmol, 1.50 e.q.) in DMF (2 mL) and water (0.4 mL), was added Cs.sub.2CO.sub.3 (275.19 mg, 0.845 mmol, 3.00 e.q.) and Pd(dppf)Cl.sub.2 (20.60 mg, 0.028 mmol, 0.10 e.q.). After stirring for 2 h at 80 degrees C. under a nitrogen atmosphere, the resulting mixture was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with CH.sub.2Cl.sub.2/MeOH (5:1). The crude product was purified by Prep-HPLC with the following conditions (2 #SHIMADZU (HPLC-01)): Column, Atlantis HILIC OBD Column, 19 mm?250 mm?5 um; mobile phase, Water (0.1% FA) and ACN (hold 5% Phase B in 5 min, up to 10% in 10.5 min); Detector, uv, 254. This resulted in 5.0 mg (11.35%) of to afford 4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-[1H-imidazo[4,5-c]pyridin-2-yl]-2-methy-lisoquinolin-1-one as a yellow solid. .sup.1H NMR (300 MHz, Methanol-d4) ? 8.90 (s, 1H), 8.64 (d, J=8.5 Hz, 1H), 8.59 (s, 1H), 8.55 (br s, 1H, FA), 8.33 (d, J=6.5 Hz, 2H), 7.70 (d, J=5.9 Hz, 1H), 7.58 (s, 1H), 6.96 (s, 2H), 4.44 (s, 2H), 3.99 (s, 6H), 3.75 (s, 3H), 2.95 (s, 6H). LCMS (ESI) m/z: [M+H]+=470.45.

    Example 52Preparation of 4-(4-((dimethylamino)methyl)-2-fluoro-3-methoxyphenyl)-2-methyl-2,7-naphthyridin-1(2H)-one (Compound B66)

    [0678] ##STR00290##

    [0679] Compound B66 was prepared in a similar manner as described for compound B50. .sup.1H NMR (400 MHz, DMSO-d6) ? 9.42 (d, J=0.8 Hz, 1H), 8.69 (d, J=5.7 Hz, 1H), 7.88 (s, 1H), 7.28 (dd, J=8.0, 1.2 Hz, 1H), 7.19-7.09 (m, 2H), 3.86 (d, J=1.2 Hz, 3H), 3.57 (s, 3H), 3.48 (s, 2H), 2.20 (s, 6H). LCMS (ESI) m/z: [M+H].sup.+=342.2.

    Preparation of 4-(4-((dimethylamino)methyl)-3-fluoro-5-methoxyphenyl)-2-methyl-2,7-naphthyridin-1(2H)-one (Compound B67)

    [0680] ##STR00291##

    [0681] Compound B67 was prepared in a similar manner as described for compound B50. .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? 9.42 (d, J=0.9 Hz, 1H), 8.71 (d, J=5.7 Hz, 1H), 7.89 (s, 1H), 7.52 (dd, J=5.7, 0.9 Hz, 1H), 6.94 (d, J=1.8 Hz, 1H), 6.90 (dd, J=10.0, 1.5 Hz, 1H), 3.84 (s, 3H), 3.57 (s, 4H), 3.48 (d, J=1.8 Hz, 2H), 2.15 (s, 6H). LCMS (ESI) m/z: [M+H]+=342.2.

    Example 53Preparation of 4-[2-(2-[[2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)(methyl)amino)ethyl](methyl)amino]ethoxy)ethoxy]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione formic acid (Compound D1 Formic Acid)

    [0682] ##STR00292##

    [0683] A solution of 2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)benzaldehyde (30.00 mg, 0.092 mmol, 1.00 equiv) and 4-(2-[2-[(2-aminoethyl)(methyl)amino]ethoxy]ethoxy)-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione (38.71 mg, 0.093 mmol, 1.00 equiv) in MeOH (1 mL) was stirred for 3 hours at room temperature under nitrogen atmosphere. To the above mixture was added NaBH.sub.3CN (11.63 mg, 0.185 mmol, 2.00 equiv) and stirred for 1 h at room temperature under nitrogen atmosphere. Then HCHO (27.77 mg, 0.925 mmol, 10.00 equiv) was added. After 1 hour. The above mixture was added NaBH.sub.3CN (11.63 mg, 0.185 mmol, 2.00 equiv) and stirred for 1 h at room temperature under nitrogen atmosphere. The crude product (30 mg) was purified by Prep-HPLC (conditions: SunFire Prep C18 OBD Column, 19?150 mm 5 ?m 10 nm; Mobile Phase A:Water (0.1% FA), Mobile Phase B:ACN; Flow rate:25 mL/min; Gradient:7 B to 17 B in 12 min; 254/220 nm; RT: 7.68 minutes) to afford 4-[2-(2-[[2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)ethyl](methyl)amino]ethoxy)ethoxy]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione; formic acid (10.1 mg) as a white solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 2.03-2.14 (1H, m), 2.42 (3H, s), 2.60-2.77 (3H, m), 2.82 (6H, d), 2.96 (5H, s), 3.28 (3H, s), 3.70 (3H, s), 3.80 (2H, s), 3.93 (8H, s), 4.34 (4H, d), 5.04-5.13 (1H, m), 6.79 (2H, s), 7.31-7.38 (2H, m), 7.57 (1H, d), 7.66 (1H, t), 7.73 (1H, s), 8.44 (1H, s), 8.66 (1H, d), 9.52 (1H, s). LCMS (ESI) m/z: [M+H]+=741.45.

    Example 54Preparation of 2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)-N-(8-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]amino]octyl)acetamide formic acid (Compound D2 Formic Acid)

    [0684] ##STR00293##

    To the solution of 2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)acetic acid (40 mg, 0.101 mmol, 1 equiv) in DCM (2 mL) was added 4-[(8-aminooctyl)amino]-2-(2,6-dioxopiperidin-3-yl)-2,3-dihydro-1H-isoindole-1,3-dione (48.37 mg, 0.121 mmol, 1.2 equiv), HATU (57.40 mg, 0.151 mmol, 1.5 equiv), and DIEA (39.02 mg, 0.302 mmol, 3 equiv). The resulting solution was stirred at room temperature for 1 hour. The mixture was concentrated. The crude product was purified by Prep-HPLC (conditions: XSelect CSH Prep C18 OBD Column, 5 um, 19*150 mm; Mobile Phase A:Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 15% B to 40% B in 8 min; 254 nm; Rt: 7.04 min) to afford 2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)-N-(8-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]amino]octyl)acetamide formic acid (14.9 mg, 17.13%) as a yellow solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.51 (d, J=0.8 Hz, 1H), 8.67 (d, J=5.7 Hz, 1H), 7.73 (s, 1H), 7.62 (d, J=5.7 Hz, 1H), 7.52 (dd, J=8.6, 7.1 Hz, 1H), 6.99 (dd, J=12.1, 7.8 Hz, 2H), 6.76 (s, 2H), 5.05 (dd, J=12.4, 5.5 Hz, 1H), 3.90 (s, 6H), 3.81 (s, 2H), 3.69 (s, 3H), 3.24 (dt, J=9.7, 7.0 Hz, 4H), 3.14 (s, 2H), 2.87 (ddd, J=19.0, 14.1, 5.2 Hz, 1H), 2.81-2.64 (m, 2H), 2.38 (s, 3H), 2.17-2.07 (m, 1H), 1.59 (q, J=6.9 Hz, 2H), 1.53 (d, J=7.3 Hz, 2H), 1.36 (s, 8H). LCMS (ESI) m/z: [M+H].sup.+=780.40.

    Example 55Preparation of 2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl] methyl](methyl)amino)-N-(5-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]amino]pentyl)acetamide formic acid (Compound D3 Formic Acid)

    [0685] ##STR00294##

    [0686] To the solution of 2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)acetic acid (40 mg, 0.101 mmol, 1 equiv) in DCM (2 mL) was added 4-[(5-aminopentyl)amino]-2-(2,6-dioxopiperidin-3-yl)-2,3-dihydro-1H-isoindole-1,3-dione (43.29 mg, 0.121 mmol, 1.2 equiv), HATU (57.40 mg, 0.151 mmol, 1.5 equiv), and DIEA (39.02 mg, 0.302 mmol, 3 equiv). The resulting solution was stirred at room temperature for 1 hour. The mixture was concentrated. The crude product was purified by Prep-HPLC (conditions: XSelect CSH Prep C18 OBD Column, 5 um, 19*150 mm; Mobile Phase A:Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 12% B to 30% B in 8 min; 254 nm; Rt: 7.15 min) to afford 2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)-N-(5-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]amino]pentyl)acetamide formic acid (15.2 mg, 18.44%) as a yellow solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.49 (d, J=0.9 Hz, 1H), 8.67 (d, J=5.7 Hz, 1H), 7.72 (s, 1H), 7.63 (d, J=5.7 Hz, 1H), 7.46 (dd, J=8.5, 7.1 Hz, 1H), 6.96 (dd, J=12.3, 7.8 Hz, 2H), 6.75 (s, 2H), 5.04 (dd, J=12.4, 5.4 Hz, 1H), 3.89 (s, 6H), 3.78 (s, 2H), 3.69 (s, 3H), 3.27 (q, J=6.5 Hz, 4H), 3.13 (s, 2H), 2.87 (ddd, J=18.8, 14.1, 5.2 Hz, 1H), 2.81-2.63 (m, 2H), 2.38 (s, 3H), 2.17-2.09 (m, 1H), 1.67 (p, J=7.0 Hz, 2H), 1.58 (p, J=6.8 Hz, 2H), 1.45 (q, J=8.0 Hz, 2H). LCMS (ESI) m/z: [M+H].sup.+=738.30.

    Example 56Preparation of N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]-6-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]oxy]-N-methylhexanamide (Compound D4)

    [0687] ##STR00295##

    [0688] To a solution of 6-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]oxy]hexanoic acid (50.00 mg, 0.13 mmol, 1 eq.) and DIPEA (49.92 mg, 0.39 mmol, 3 eq.) in DCM (2 mL) was added PyBOP (100.49 mg, 0.19 mmol, 1.5 eq.) and 4-[3,5-dimethoxy-4-[(methylamino)methyl]phenyl]-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (43.69 mg, 0.13 mmol, 1.00 eq.). The resulting solution was stirred at room temperature for 1 hour. The solution was concentrated. The crude product was purified by Prep-HPLC (conditions: X Select CSH Prep C18 OBD Column, 5 um, 19*150 mm; Mobile Phase A:Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 15% B to 32% B in 8 min; 254 nm; Rt: 6.45 min) to afford N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]-6-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]oxy]-N-methylhexanamide (8.4 mg, 9.16%) as a yellow solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.54 (d, J=7.5 Hz, 1H), 8.71-8.64 (m, 1H), 7.84 (d, J=5.5 Hz, 1H), 7.79-7.70 (m, 1H), 7.74-7.63 (m, 1H), 7.47-7.33 (m, 2H), 6.76 (d, J=15.9 Hz, 2H), 5.08 (dd, J=12.5, 5.5 Hz, 1H), 4.76 (s, 1H), 4.69 (d, J=6.7 Hz, 1H), 4.24 (dt, J=11.6, 6.1 Hz, 2H), 3.89 (d, J=16.9 Hz, 6H), 3.71 (d, J=9.7 Hz, 3H), 2.88 (s, 3H), 2.70 (td, J=16.0, 14.2, 6.7 Hz, 4H), 2.11 (s, 1H), 1.90 (dt, J=14.7, 7.6 Hz, 2H), 1.80-1.57 (m, 4H). LCMS (ESI) m/z: [M+H].sup.+=710.30.

    Example 57Preparation of N-[8-[2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)acetamido]octyl]-2-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]oxy]acetamide (Compound D5)

    [0689] ##STR00296## ##STR00297##

    Step 1: preparation of tert-butyl 2-[[(4-bromo-2,6-dimethoxyphenyl)methyl](methyl)amino]acetate (i57-2)

    [0690] ##STR00298##

    [0691] To a stirred solution of tert-butyl 2-(methylamino)acetate hydrochloride (5.93 g, 32.643 mmol, 1.60 equiv) in MeOH (60 mL) was added 4-bromo-2,6-dimethoxybenzaldehyde (5 g, 20.402 mmol, 1 equiv), and the mixture was stirred for 30 minutes before NaBH.sub.3CN (2.56 g, 40.737 mmol, 2.00 equiv) was added in portions. The resulting solution was stirred for another 3 hours at 25 degrees C. Then the mixture was concentrated. The residue was purified by silica gel column chromatography, eluted with EA/PE (1:1) to solid. LCMS (ESI) m/z: [M+H].sup.+=374.

    Step 2: Preparation of tert-butyl 2-([[2,6-dimethoxy-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl]methyl] (methyl)amino)acetate (i57-3)

    [0692] ##STR00299##

    [0693] To a stirred solution of tert-butyl 2-[[(4-bromo-2,6-dimethoxyphenyl)methyl](methyl)amino] acetate (4.5 g, 12.023 mmol, 1 equiv) and Pd(dppf)Cl.sub.2.Math.CH.sub.2Cl.sub.2 (981.87 mg, 1.202 mmol, 0.1 equiv) in 1,4-dioxane (60 mL) was added AcOK (3.6 g, 36.681 mmol, 3.05 equiv) and 4,4,5,5-tetramethyl-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,3,2-dioxaborol-ane (3.7 g, 14.570 mmol, 1.21 equiv). The mixture was stirred at 90 degrees C. under N.sub.2 atmosphere for 3 hours. Then the reaction was cooled to room temperature and filtered. The filter cake was washed with EtOAc, and the filtrate was concentrated. The residue was used directly in the next step. LCMS (ESI) m/z: [M+H].sup.+=422.

    Step 3: Preparation of tert-butyl 2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl) phenyl]methyl](methyl)amino)acetate (i57-4)

    [0694] ##STR00300##

    [0695] To a stirred solution of tert-butyl 2-([[2,6-dimethoxy-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl]methyl](methyl)amino)acetate (7.28 g, 17.278 mmol, 1 equiv) and Pd(dppf)Cl.sub.2.Math.CH.sub.2Cl.sub.2 (1.41 g, 1.728 mmol, 0.1 equiv) in 1,4-dioxane (80 mL)/H.sub.2O (4 mL) was added Cs.sub.2CO.sub.3 (16.89 g, 51.835 mmol, 3 equiv) and 4-bromo-2-methyl-1,2-dihydro-2,7-naph-thyridin-1-one (4.13 g, 17.278 mmol, 1 equiv). The resulting mixture was stirred at 90 degrees C. under N.sub.2 atmosphere for 3.5 hours. The resulting solution was concentrated, and the residue was purified by silica gel column chromatography, eluted with DCM/MeOH (0-10%) to afford tert-butyl 2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)acetate (4.43 g, 56.53%) as a yellow solid. LCMS (ESI) m/z: [M+H].sup.+=454.

    Step 4: Preparation of 2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)acetic acid (i57-5)

    [0696] ##STR00301##

    [0697] A mixture of tert-butyl 2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)acetate (4.23 g, 9.327 mmol, 1 equiv) in TFA (17 mL) and DCM (50 mL) was stirred for 17 hours at 25 degrees C. The resulting solution was concentrated, and the residue was purified by reverse flash chromatography (conditions: column, C18 silica gel; mobile phase, MeCN in water (0.1% FA), 10% to 50% gradient in 10 min; detector, UV 254 nm, to afford the 2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl] (methyl)amino)acetic acid (3.20 g, 86.48%) as a yellow solid. LCMS (ESI) m/z: [M+H].sup.+=398.

    Step 5: Preparation of N-[8-[2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)acetamido]octyl]-2-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]oxy]acetamide (Compound D5)

    [0698] ##STR00302##

    [0699] To a solution of 2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)acetic acid (20.82 mg, 0.052 mmol, 1 equiv) in DMF (1 mL) was added DIEA (20.32 mg, 0.157 mmol, 3 equiv), PyBOP (29.89 mg, 0.079 mmol, 1.50 equiv), and N-(8-aminooctyl)-2-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]oxy]acetamide trifluoro-acetic acid (30 mg, 0.052 mmol, 1 equiv). The mixture was stirred for 2 hours at room temperature under ambient atmosphere. The resulting solution was purified by Prep-HPLC (conditions: XSelect CSH Prep C18 OBD Column, 5 um, 19*150 mm; Mobile Phase A:Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 20% B to 55% B in 8 min; 254 nm; Rt: 5.75 min) to afford N-[8-[2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)acetamido]octyl]-2-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]oxy]acetamide (24.6 mg, 56.03%) as a white solid. .sup.1H NMR (300 MHz, Methanol-d4) ? 9.50 (s, 1H), 8.68 (d, J=5.7 Hz, 1H), 7.87-7.72 (m, 2H), 7.63 (d, J=5.8 Hz, 1H), 7.54 (d, J=7.4 Hz, 1H), 7.41 (d, J=8.4 Hz, 1H), 6.79 (s, 2H), 5.13 (dd, J=12.4, 5.4 Hz, 1H), 4.73 (s, 2H), 3.92 (s, 8H), 3.70 (s, 3H), 3.29-3.20 (m, 6H), 2.93-2.71 (m, 3H), 2.50 (s, 3H), 2.120-2.10 (m, 1H), 1.52 (d, J=8.2 Hz, 4H), 1.32 (s, 8H). LCMS (ESI) m/z: [M+H].sup.+=838.35.

    Example 58Preparation of N-(8-((2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindolin-4-yl)amino)octyl)-2-(3-methoxy-5-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenoxy)acetamide (Compound D6)

    [0700] ##STR00303##

    Step 1: Preparation of ethyl 2-(3-bromo-5-methoxyphenoxy)acetate (i58-2)

    [0701] ##STR00304##

    [0702] To a solution of 3-bromo-5-methoxyphenol (1 g, 4.925 mmol, 1 equiv) and ethyl 2-bromoacetate (0.99 g, 5.928 mmol, 1.20 equiv) in acetone (10 mL, 136.021 mmol, 27.62 equiv) was added K.sub.2CO.sub.3 (1.36 g, 9.851 mmol, 2 equiv), and the resulting solution was stirred at 25? C. for 1 hour. After filtration, the filtrate was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with EA/PE (1:4) to afford methyl 2-(3-bromo-5-methoxyphenoxy)acetate (1.23 g, 90.78%) as a colorless liquid. LCMS (ESI) m/z: [M+H]+=289.

    Step 2: Preparation of ethyl 2-(3-methoxy-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenoxy)acetate (i58-3)

    [0703] ##STR00305##

    [0704] To a solution of ethyl 2-(3-bromo-5-methoxyphenoxy)acetate (630 mg, 2.179 mmol, 1 equiv) and 4,4,5,5-tetramethyl-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,3,2-dioxaborolane (664.00 mg, 2.615 mmol, 1.2 equiv) in dioxane (6 mL) was added Pd(dppf)Cl.sub.2 (159.44 mg, 0.218 mmol, 0.1 equiv) and KOAC (427.70 mg, 4.358 mmol, 2 equiv. The resulting solution was stirred at 90? C. for 2 hours (under N.sub.2 atmosphere). After filtration, the filtrate was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with EA/PE (1:4) to afford ethyl 2-[3-methoxy-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenoxy]acetate (550 mg, 78.0%) as an off-white solid. LCMS (ESI) m/z: [M+H].sup.+=337.

    Step 3: Preparation of ethyl 2-(3-methoxy-5-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenoxy) acetate (i58-4)

    [0705] ##STR00306##

    [0706] To a solution of ethyl 2-[3-methoxy-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenoxy] acetate (550 mg, 1.636 mmol, 1.40 equiv) and 4-bromo-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (280 mg, 1.171 mmol, 1 equiv) in dioxane (16 mL) and H.sub.2O (4 mL) was added Cs.sub.2CO.sub.3 (763.20 mg, 2.342 mmol, 2 equiv) and Pd(dppf)Cl.sub.2 (85.70 mg, 0.117 mmol, 0.1 equiv), and the resulting solution was stirred at 80? C. for 1 hour (under N.sub.2 atmosphere). After filtration, the filtrate was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with EA/PE (60:40) to afford ethyl 2-[3-methoxy-5-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenoxy]acetate (303 mg, 70.23%) as a brown solid. LCMS (ESI) m/z: [M+H]+=369.

    Step 4: Preparation of 2-(3-methoxy-5-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenoxy)acetic acid (i58-5)

    [0707] ##STR00307##

    [0708] A solution of ethyl 2-[3-methoxy-5-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenoxy]acetate (50 mg) in HCl (12 M, 2 mL) was stirred at 90? C. for 40 minutes. The resulting mixture was cooled and was concentrated under reduced pressure to give 2-[3-methoxy-5-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenoxy]acetic acid (86.8 mg) as an off-white solid, which was used directly without further purification. LCMS (ESI) m/z: [M+H]+=341.

    Step 5: Preparation of N-(8-((2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindolin-4-yl)amino)octyl)-2-(3-methoxy-5-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenoxy)acetamide (compound D6)

    [0709] ##STR00308##

    [0710] To a solution of 2-[3-methoxy-5-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenoxy]acetic acid (42.49 mg, 0.125 mmol, 1.00 equiv) and 4-[(8-aminooctyl)amino]-2-(2,6-dioxopiperidin-3-yl)-2,3-dihydro-1H-isoindole-1,3-dione (50 mg, 0.125 mmol, 1 equiv) in DMF (2 mL) was added HATU (71.21 mg, 0.187 mmol, 1.50 equiv) and DIEA (96.82 mg, 0.749 mmol, 6.00 equiv). The resulting solution was stirred at 25? C. for 1 hour. The crude product was purified by Prep-HPLC (conditions: XBridge Prep C18 OBD Column, 5 ?m, 19*150 mm; mobile phase, Water (0.1% FA) and ACN; Detector, uv 254 nm) to give N-(8-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]amino]octyl)-2-[3-methoxy-5-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenoxy]acetamide (36 mg, 39.89%) as a yellow solid. .sup.1H NMR (300 MHz, DMSO-d6) ? 11.10 (s, 1H), 9.46 (s, 1H), 8.72 (d, J=5.8 Hz, 1H), 8.08 (t, J=5.8 Hz, 1H), 7.88 (d, J=2.3 Hz, 1H), 7.57 (dd, J=8.6, 7.0 Hz, 2H), 7.08 (d, J=8.6 Hz, 1H), 7.01 (d, J=7.0 Hz, 1H), 6.64 (q, J=1.8 Hz, 3H), 6.51 (s, 1H), 5.05 (dd, J=12.8, 5.4 Hz, 1H), 4.52 (s, 2H), 3.80 (s, 3H), 3.59 (s, 3H), 3.27 (d, J=5.8 Hz, 2H), 3.12 (q, J=6.6 Hz, 2H), 2.98-2.80 (m, 1H), 2.65-2.52 (m, 2H), 2.11-1.98 (m, 1H), 1.55 (t, J=7.0 Hz, 2H), 1.40 (d, J=6.5 Hz, 2H), 1.24 (t, J=7.4 Hz, 8H).; LCMS (ESI) m/z: [M+H]+=723.15.

    Example 59Preparation of 2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)-N-(5-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]amino]pentyl)-N-methylacetamide formic acid (Compound D7 Formic Acid)

    [0711] ##STR00309##

    Step 1: Preparation of tert-butyl N-[5-(1,3-dioxoisoindol-2-yl)pentyl]carbamate (i59-2)

    [0712] ##STR00310##

    [0713] A mixture of tert-butyl N-(5-aminopentyl)carbamate (4.00 g, 19.773 mmol, 1.00 equiv) and phthalic anhydride (3.22 g, 21.750 mmol, 1.1 equiv) in toluene (50.00 mL, 469.945 mmol, 23.77 equiv) was stirred at reflux for 3 hours. The solvent was removed under reduced pressure, and the crude product was purified by flash silica chromatography, elution gradient 0 to 40% EtOAc in petroleum ether. Pure fractions were evaporated to dryness to afford tert-butyl N-[5-(1,3-dioxoisoindol-2-yl)pentyl]carbamate (5.8 g, 88.25%) as a white solid. LCMS (ESI) m/z: [M+H].sup.+=333.

    Step 2: Preparation of tert-butyl N-[5-(1,3-dioxoisoindol-2-yl)pentyl]-N-methylcarbamate (i59-3)

    [0714] ##STR00311##

    [0715] To a solution of tert-butyl N-[5-(1,3-dioxoisoindol-2-yl)pentyl]carbamate (2.00 g, 6.017 mmol, 1.00 equiv) in DMF (30.00 mL) was added NaH (0.48 g, 12.034 mmol, 2.00 equiv, 60%) at 0? C., the resulting mixture was stirred at 0? C. for 30 minutes, and methyl iodide (1.28 g, 9 mmol, 1.50 equiv) was added to the reaction mixture at 0? C. After stirring at room temperature for 16 hours, and the reaction was quenched by the addition of water (50 mL) at 0? C. The mixture was extracted with EtOAc (100 mL?4). The organic layer was washed with water (100 mL) and saturated brine (100 mL), and then dried over anhydrous sodium sulfate, filtered, and concentrated to give crude product that was purified by flash silica chromatography, elution gradient 0 to 60% EtOAc in petroleum ether. Pure fractions were evaporated to dryness to afford tert-butyl N-[5-(1,3-dioxoisoindol-2-yl)pentyl]-N-methylcarbamate (1.8 g, 86.36%) as a colorless oil. LCMS (ESI) m/z: [M+H].sup.+=347.

    Step 3: Preparation of tert-butyl N-(5-aminopentyl)-N-methylcarbamate (i59-4)

    [0716] ##STR00312##

    [0717] A mixture of tert-butyl N-[5-(1,3-dioxoisoindol-2-yl)pentyl]-N-methylcarbamate (1.00 g, 2.887 mmol, 1.00 equiv) and NH.sub.2NH.sub.2.Math.H.sub.2O (0.36 g, 0.006 mmol, 2.00 equiv, 80%) in EtOH (10.00 mL) was stirred at reflux for 1 hour. The solid was filtered out, and the filtrate was concentrated under reduced pressure to afford tert-butyl N-(5-aminopentyl)-N-methylcarbamate (372 mg, 59.57%) as a yellow oil that was used directly without further purification. LCMS (ESI) m/z: [M+H].sup.+=217.

    Step 4: Preparation of N-(5-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl]amino]pentyl)-N-methylcarbamate (i59-5)

    [0718] ##STR00313##

    [0719] To a solution of tert-butyl N-(5-aminopentyl)-N-methylcarbamate (215.37 mg, 0.996 mmol, 1.10 equiv) and 2-(2,6-dioxopiperidin-3-yl)-4-fluoroisoindole-1,3-dione (250.00 mg, 0.905 mmol, 1.00 equiv) in NMP (3.00 mL) was added DIEA (233.95 mg, 1.810 mmol, 2.00 equiv). The resulting mixture was stirred at 90? C. for 4 hours. The reaction mixture was diluted with EA (50 mL). The resulting mixture was washed with water (3?30 mL) and saturated brine (30 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered, and evaporated to afford crude product. The crude product was purified by flash silica chromatography, elution gradient 0 to 75% EtOAc in petroleum ether. Pure fractions were evaporated to dryness to afford tert-butyl N-(5-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl]amino]pentyl)-N-methylcarbamate (198 mg, 46.30%) as a yellow oil. LCMS (ESI) m/z: [M+H].sup.+=473.

    Step 5: Preparation of 2-(2,6-dioxopiperidin-3-yl)-4-[[5-(methylamino)pentyl]amino]isoindole-1,3-dione (i59-6)

    [0720] ##STR00314##

    [0721] A solution of tert-butyl N-(5-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl]amino]pentyl)-N-methylcarbamate (198.00 mg) in a solution of HCl in 1,4-dioxane (5.00 mL, 4 M) was stirred at room temperature for 1 hour. The solvent was removed under reduced pressure to afford 2-(2,6-dioxopiperidin-3-yl)-4-[[5-(methylamino)pentyl]amino]isoindole-1,3-dione (153 mg, 97.8%) as a yellow solid that was used directly without further purification. LCMS (ESI) m/z: [M+H].sup.+=373.

    Step 6: Preparation of 2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)-N-(5-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]amino]pentyl)-N-methylacetamide formic acid (Compound D7 Formic Acid)

    [0722] ##STR00315##

    [0723] To a solution of 2-(2,6-dioxopiperidin-3-yl)-4-[[5-(methylamino)pentyl]amino]-2,3-dihydro-1H-isoindole-1,3-dione (60.00 mg, 0.161 mmol, 1.00 equiv), 2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)acetic acid (64.03 mg, 0.161 mmol, 1.00 equiv), and DIEA (41.64 mg, 0.322 mmol, 2.00 equiv) in DMF (1.00 mL) was added HATU (91.89 mg, 0.242 mmol, 1.50 equiv). The resulting mixture was stirred at room temperature for 16 hours. The crude product (mg) was purified by Prep-HPLC (conditions: XBridge Shield RP18 OBD Column, 5 ?m, 19*150 mm; Mobile Phase A: Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/minute; Gradient: 10% B to 40% B in 8 minutes; 254/220 nm; Rt: 7.32 minutes) to afford 2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)-N-(5-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]amino]pentyl)-N-methylacetamide formic acid (99.4 mg) as a yellow solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.51 (s, 0.5H), 9.41 (s, 0.5H), 8.67 (dd, J=14.1, 5.7 Hz, 1H), 8.55 (s, 0.28H, FA), 7.74 (d, J=15.6 Hz, 1H), 7.63 (dd, J=18.0, 5.8, 1H), 7.51 (dd, J=8.6, 7.1 Hz, 0.5H), 7.30 (dd, J=8.5, 7.1 Hz, 0.5H), 7.00 (dd, J=7.9, 3.5 Hz, 1H), 6.92 (d, J=7.0 Hz, 1H), 6.78 (d, J=17.9 Hz, 2H), 5.05 (dd, J=12.8, 5.6, 1H), 4.23 (s, 1H), 3.91 (d, J=5.4 Hz, 8H), 3.86 (s, 1.5H), 3.70 (s, 1.5H), 3.61 (s, 2H), 3.49-3.41 (m, 1H), 3.30 (s, 1H), 3.13 (d, J=6.8 Hz, 1H), 3.02 (s, 1.5H), 2.93 (s, 1.5H), 2.89-2.80 (m, 1H), 2.80-2.71 (m, 4H), 2.54 (s, 2H), 2.12 (td, J=8.0, 2.7 Hz, 1H), 1.76-1.53 (m, 4H), 1.45 (q, J=8.1 Hz, 1H), 1.22 (d, J=7.9 Hz, 1H). LCMS (ESI) m/z: [M+H].sup.+=752.20.

    Example 60Preparation of 2-cyclopropyl-4-[3,5-dimethoxy-4-[(methylamino)methyl]phenyl]-2,7-naphthyridin-1-one (Compound D8)

    [0724] ##STR00316##

    Step 1: Preparation of ethyl 2-[(3-bromo-5-methoxyphenyl)amino]acetate (i60-2)

    [0725] ##STR00317##

    [0726] To a solution of 3-bromo-5-methoxyaniline (5.00 g, 24.746 mmol, 1.00 equiv) and K.sub.2CO.sub.3 (5.13 g, 37.119 mmol, 1.50 equiv) in acetone (100.00 mL) was added ethyl bromoacetate (4.96 g, 29.695 mmol, 1.20 equiv). The resulting mixture was stirred at reflux for 3 days. The reaction mixture was filtered, and the filtrate was evaporated to afford crude product. The crude product was purified by flash silica chromatography, elution gradient 0 to 30% EtOAc in petroleum ether. Pure fractions were evaporated to dryness to afford ethyl 2-[(3-bromo-5-methoxyphenyl)amino]acetate (1.8 g, 25.24%) as a yellow gum. LCMS (ESI) m/z: [M+H]+=288.

    Step 2: Preparation of 2-[[3-methoxy-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl]amino]acetate (i60-3)

    [0727] ##STR00318##

    [0728] To a solution of bis(pinacolato)diboron (528.78 mg, 2.082 mmol, 1.2 equiv), ethyl 2-[(3-bromo-5-methoxyphenyl)amino]acetate (500.00 mg, 1.735 mmol, 1.00 equiv) and KOAc (340.61 mg, 3.471 mmol, 2 equiv) in dioxane (10.00 mL) was added Pd(dppf)Cl.sub.2(126.97 mg, 0.174 mmol, 0.1 equiv). The resulting mixture was stirred at 90? C. for 2 hours under a nitrogen atmosphere. The resulting mixture was diluted with ethyl acetate (100 mL), washed with water (3?100 mL) and saturated brine (100 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered, and evaporated to afford crude product. The crude product was purified by flash silica chromatography, elution gradient 0 to 50% EtOAc in petroleum ether. Pure fractions were evaporated to dryness to afford ethyl 2-[[3-methoxy-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl]amino]acetate (365 mg, 62.75%) as a yellow gum. LCMS (ESI) m/z: [M+H]+=336.

    Step 3: Preparation of 2-[[3-methoxy-5-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]amino]acetate (i60-4

    [0729] ##STR00319##

    [0730] To a solution of ethyl 2-[[3-methoxy-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl]amino]acetate (100.00 mg, 0.298 mmol, 1.00 equiv), 4-bromo-2-methyl-2,7-naphthyridin-1-one (71.32 mg, 0.298 mmol, 1.00 equiv) and Cs.sub.2CO.sub.3 (194.40 mg, 0.597 mmol, 2.00 equiv) in dioxane (4.00 mL) and H.sub.2O (1.00 mL) was added Pd(dppf)Cl.sub.2 (21.83 mg, 0.030 mmol, 0.10 equiv). The resulting mixture was stirred at 80? C. for 2 hours under a nitrogen atmosphere. The reaction mixture was diluted with EA (100 mL) and washed with water (3?100 mL) and saturated brine (100 mL) The organic layer was dried over Na.sub.2SO.sub.4, filtered, and evaporated to afford crude product. The crude product was purified by flash silica chromatography, elution gradient 0 to 80% EtOAc in petroleum ether. Pure fractions were evaporated to dryness to afford ethyl 2-[[3-methoxy-5-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]amino]acetate (70 mg, 63.87%) as a brown solid. LCMS (ESI) m/z: [M+H].sup.+=368.

    Step 4: Preparation of [[3-methoxy-5-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]amino]acetic acid (i60-5)

    [0731] ##STR00320##

    [0732] Ethyl 2-[[3-methoxy-5-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]amino]acetate (70.00 mg, 0.191 mmol, 1.00 equiv) was added to a solution of HCl in water (2.00 mL, 12 N). The resulting mixture was stirred at 90? C. for 1 hour. The solvent was removed to afford [[3-methoxy-5-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]amino]acetic acid (65 mg) as a brown solid that was used directly without further purification. LCMS (ESI) m/z: [M+H].sup.+=340.

    Step 5: Preparation of N-(8-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]amino]octyl)-2-[[3-methoxy-5-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]amino]acetamide formic acid (Compound D8 Formic Acid)

    [0733] ##STR00321##

    [0734] To a solution of 2-[[3-methoxy-5-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]amino]acetic acid (65.00 mg, 0.192 mmol, 1.00 equiv), 4-[(8-aminooctyl)amino]-2-(2,6-dioxopiperidin-3-yl)-2,3-dihydro-1H-isoindole-1,3-dione (76.71 mg, 0.192 mmol, 1.00 equiv) and DIEA (49.51 mg, 0.383 mmol, 2.00 equiv) in DMF (1.00 mL, 12.922 mmol, 67.46 equiv) was added HATU (109.25 mg, 0.287 mmol, 1.50 equiv). The resulting mixture was stirred at room temperature for 16 hours. The crude product was purified by Prep-HPLC (conditions: XBridge Shield RP18 OBD Column 30*150 mm, 5 ?m; Mobile Phase A: Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 40 mL/minute; Gradient: 18% B to 18% B in 2 minutes; 254/220 nm; R.sub.t: 11.43 minutes) to afford N-(8-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]amino]octyl)-2-[[3-methoxy-5-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]amino]acetamide formic acid (36.8 mg) as a yellow solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.49 (d, J=0.8 Hz, 1H), 8.64 (d, J=5.9 Hz, 1H), 7.94 (t, J=6.0 Hz, 1H), 7.73-7.67 (m, 2H), 7.51 (dd, J=8.6, 7.1 Hz, 1H), 6.99 (s, 1H), 6.99 (dd, J=16.0, 7.8 Hz, 2H), 6.36 (t, J=1.8 Hz, 1H), 6.26 (d, J=1.8 Hz, 2H), 5.06 (dd, J=12.5, 5.4 Hz, 1H), 3.79 (d, J=7.7 Hz, 5H), 3.67 (s, 3H), 3.24 (dt, J=8.4, 6.5 Hz, 4H), 2.87 (ddd, J=17.7, 14.1, 5.0 Hz, 1H), 2.81-2.64 (m, 2H), 2.17-2.07 (m, 1H), 1.60 (p, J=7.0 Hz, 2H), 1.47 (d, J=13.8 Hz, 2H), 1.34 (d, J=7.2 Hz, 2H), 1.25 (s, 6H). LCMS (ESI) m/z: [M+H].sup.+=722.30.

    Example 61Preparation of 2-(2-((dimethylamino)methyl)-3-methoxy-5-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenoxy)-N-(8-((2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindolin-4-yl)amino)octyl)acetamide (Compound D9)

    [0735] ##STR00322##

    [0736] Compound D9 was prepared in a similar manner as described for compound D8. 2-(2-((dimethylamino)methyl)-3-methoxy-5-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenoxy)-N-(8-((2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindolin-4-yl)amino)octyl)acetamide (17.8 mg, 11.3%) was obtained as a yellow solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.52 (s, 1H), 8.67 (d, J=5.8 Hz, 1H), 8.56 (s, 0.83H, FA), 7.75 (s, 1H), 7.60-7.50 (m, 2H), 7.02 (dd, J=9.5, 7.8 Hz, 2H), 6.90 (d, J=1.3 Hz, 1H), 6.78 (d, J=1.3 Hz, 1H), 5.06 (dd, J=12.5, 5.4 Hz, 1H), 4.81 (s, 2H), 4.29 (s, 2H), 3.96 (s, 3H), 3.68 (s, 3H), 3.27 (dt, J=14.0, 6.9 Hz, 4H), 2.87-2.65 (m, 9H), 2.12 (dtd, J=13.0, 5.0, 2.3 Hz, 1H), 1.61 (p, J=6.9 Hz, 2H), 1.48 (t, J=6.9 Hz, 2H), 1.37 (t, J=7.6 Hz, 2H), 1.27 (d, J=3.8 Hz, 6H). LCMS (ESI) m/z: [M+H].sup.+=780.40.

    Example 62Preparation of 2-(2,3-dimethoxy-5-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenoxy)-N-(8-((2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindolin-4-yl)amino)octyl)acetamide (Compound D10)

    [0737] ##STR00323##

    [0738] Compound D10 was prepared in a similar manner as described for compound D8. 2-(2,3-dimethoxy-5-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenoxy)-N-(8-((2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindolin-4-yl)amino)octyl)acetamide (32.7 mg, 32.17%) was obtained as a yellow solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.51 (s, 1H), 8.67 (d, J=5.9 Hz, 1H), 7.73 (s, 1H), 7.63 (d, J=5.9 Hz, 1H), 7.53 (dd, J=8.6, 7.1 Hz, 1H), 7.00 (dd, J=12.0, 7.8 Hz, 2H), 6.85 (d, J=1.9 Hz, 1H), 6.77 (d, J=1.9 Hz, 1H), 5.06 (dd, J=12.5, 5.4 Hz, 1H), 4.62 (s, 2H), 3.92 (d, J=2.9 Hz, 6H), 3.68 (s, 3H), 3.28 (q, J=6.9 Hz, 4H), 2.92-2.65 (m, 3H), 2.16-2.03 (m, 1H), 1.62 (p, J=6.9 Hz, 2H), 1.53 (t, J=7.0 Hz, 2H), 1.38 (d, J=8.0 Hz, 2H), 1.31 (s, 8H). LCMS (ESI) m/z: [M+H]+=753.35.

    Example 63Preparation of N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]-4-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]oxy]-N-methylbutanamide (Compound D11)

    [0739] ##STR00324##

    [0740] To a solution of 4-[3,5-dimethoxy-4-[(methylamino)methyl]phenyl]-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (50 mg, 0.147 mmol, 1 equiv) and 4-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]oxy]butanoic acid (53.08 mg, 0.147 mmol, 1 equiv) in DMF (1 mL) was added DIEA (38.08 mg, 0.295 mmol, 2 equiv). The resulting mixture was stirred for 10 minutes at 25? C. Then HATU (84.02 mg, 0.221 mmol, 1.5 equiv) was added to the reaction mixture. The resulting solution was stirred for 2 hours at 25? C. The crude product was purified by Prep-HPLC (conditions: SunFire C18 OBD Prep Column, 19 mm?250 mm; mobile phase, Water (0.1% FA) and ACN (24% PhaseB up to 48% in 8 minutes); Detector, uv). This resulted in 27 mg (26.88%) of N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]-4-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]oxy]-N-methylbutanamide as a white solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.54 (s, 1H), 8.69 (d, J=6.0 Hz, 1H), 7.84-7.74 (m, 2H), 7.67 (s, 1H), 7.54-7.41 (m, 2H), 6.77 (s, 1H), 6.72 (s, 1H), 5.13-5.02 (m, 1H), 4.76 (dd, J=10.7, 2.5 Hz, 2H), 4.33 (dt, J=19.9, 5.9 Hz, 2H), 3.85 (d, J=17.8 Hz, 6H), 3.71 (d, J=12.1 Hz, 4H), 3.06-2.97 (m, 1H), 2.89 (s, 2H), 2.80 (s, 3H), 2.74-2.59 (m, 3H), 2.27-2.13 (m, 3H). LCMS (ESI) m/z: [M+H]+=682.25.

    Example 64Preparation of N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]-5-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]oxy]-N-methylpentanamide (Compound D12)

    [0741] ##STR00325##

    [0742] To a stirred solution of 4-[3,5-dimethoxy-4-[(methylamino)methyl]phenyl]-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (50 mg, 0.147 mmol, 1 equiv) and 5-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]oxy]pentanoic acid (55.15 mg, 0.147 mmol, 1 equiv) in DMF (2 mL) was added DIEA (57.12 mg, 0.442 mmol, 3 equiv) at 25? C. The resulting mixture was stirred for 10 minutes at 25? C. Then HATU (84.02 mg, 0.221 mmol, 1.5 equiv) was added to the reaction mixture. The resulting solution was stirred for 2 hours at 25? C. The crude product was purified by Prep-HPLC (conditions: SunFire C18 OBD Prep Column, 19 mm?250 mm; mobile phase, Water (0.1% FA) and ACN (24% PhaseB up to 53% in 8 minutes); Detector, uv). This resulted in 48.1 mg (46.9%) of N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]-5-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]oxy]-N-methylpentanamide as a white solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.55 (s, 1H), 8.71-8.64 (m, 1H), 7.85-7.71 (m, 3H), 7.45 (dd, J=9.6, 7.9 Hz, 2H), 6.76 (d, J=9.2 Hz, 2H), 5.05 (dd, J=12.6, 5.7 Hz, 1H), 4.74 (d, J=16.1 Hz, 2H), 4.30 (q, J=6.8, 6.2 Hz, 2H), 3.86 (s, 6H), 3.72 (dd, J=2.7, 1.1 Hz, 3H), 2.85 (s, 2H), 2.84 (d, J=40.1 Hz, 4H), 2.76-2.52 (m, 2H), 2.08-1.87 (m, 5H). LCMS (ESI) m/z: [M+H]+=696.4.

    Example 65Preparation of 2-((2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzyl)(methyl)amino)-N-(2-(2-(2-((2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindolin-4-yl)amino)ethoxy)ethoxy)ethyl)-N-methylacetamide (Compound D13)

    [0743] ##STR00326##

    Step 1: Preparation of tert-butyl (2-(2-(2-(2,2,2-trifluoroacetamido)ethoxy)ethoxy)ethyl)carbamate (i65-2)

    [0744] ##STR00327##

    [0745] To a solution of tert-butyl N-[2-[2-(2-aminoethoxy) ethoxy] ethyl] carbamate (1.15 g, 4.631 mmol, 1.00 equiv) and TEA (0.94 g, 9.262 mmol, 2.00 equiv) in THE (12.00 mL) at 0 degree was added trifluoroacetic anhydride (1.46 g, 6.947 mmol, 1.50 equiv). The resulting solution was stirred at 25 degree for 12 hours. The resulting mixture was concentrated. The residue was applied onto a silica gel column eluted with THE/PE (40/60). Fractions containing the desired compound were evaporated to dryness to afford tert-butyl N-(2-[2-[2-(2,2,2-trifluoroacetamido)ethoxy]ethoxy]ethyl) carbamate (1.347 g, 80.0%) as a colorless oil. LCMS (ESI) m/z: [M+H]+=345.

    Step 2: Preparation of tert-butyl (2-(2-(2-(2,2,2-trifluoro-N-methylacetamido)ethoxy)ethoxy)ethyl) carbamate (i65-3)

    [0746] ##STR00328##

    [0747] A solution of tert-butyl N-(2-[2-[2-(2,2,2-trifluoroacetamido)ethoxy]ethoxy]ethyl) carbamate (1.347 g, 3.912 mmol, 1.00 equiv) and K.sub.2CO.sub.3 (0.65 g, 4.694 mmol, 1.20 equiv) in acetone (15.00 mL) was stirred at 0 degree. Then dimethyl sulfate (0.74 g, 5.867 mmol, 1.51 equiv) was added to the mixture, and the resulting solution was stirred at 25 degree for 12 hours. The resulting solution was diluted with of EtOAc, and it was washed with water (3?50 mL). The organic layer was dried and evaporated to dryness to afford tert-butyl N-(2-[2-[2-(2,2,2-trifluoro-N-methylacetamido)ethoxy]ethoxy] ethyl)carbamate (1.75 g, 98.91%) as a colorless oil, which was used directly without further purification. LCMS (ESI) m/z: [M+H].sup.+=359.

    Step 3: Preparation of tert-butyl (2-(2-(2-(methylamino)ethoxy)ethoxy)ethyl)carbamate (i65-4)

    [0748] ##STR00329##

    [0749] A solution of tert-butyl N-(2-[2-[2-(2,2,2-trifluoro-N-methylacetamido)ethoxy]ethoxy]ethyl) carbamate (1.65 g) in DMF (16.00 mL) was stirred at 0 degree. Then ammonium hydroxide (16.00 mL) was added to the mixture, and the resulting solution was stirred at 25 degrees for 12 hours. The mixture was evaporated to dryness to afford crude tert-butyl N-(2-[2-[2-(methylamino) ethoxy]ethoxy] ethyl)carbamate as a colorless oil, which was used directly without further purification. LCMS (ESI) m/z: [M+H].sup.+=263.

    Step 4: Preparation of tert-butyl (1-(2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl)-2,5-dimethyl-4-oxo-8,11-dioxa-2,5-diazatridecan-13-yl)carbamate (i65-5)

    [0750] ##STR00330##

    [0751] To a solution of tert-butyl N-(2-[2-[2-(methylamino)ethoxy]ethoxy]ethyl)carbamate (600.00 mg, 2.287 mmol, 1.00 equiv) and ([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl](methyl) amino)acetic acid (1.09 g, 2.744 mmol, 1.2 equiv) in DCM (5.00 mL) was added HATU (1.30 g, 3.431 mmol, 1.5 equiv) and DIEA (886.75 mg, 6.861 mmol, 3 equiv). The resulting solution was stirred at 25 degree for 1 hour. The mixture was added H.sub.2O (100 mL) and extracted with DCM (100 mL?4). The organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated to give crude product that was purified by a silica gel column eluted with MeOH/DCM (5.4/94.6) to afford tert-butyl N-[2-(2-[2-[2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)-N-methylacetamido] ethoxy]ethoxy) ethyl]carbamate (536 mg, 36.52%) as an off-white solid. LCMS (ESI) m/z: [M+H].sup.+=642.

    Step 5: Preparation of N-(2-(2-(2-aminoethoxy)ethoxy)ethyl)-2-((2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzyl)(methyl)amino)-N-methylacetamide (i65-5)

    [0752] ##STR00331##

    [0753] A solution of tert-butyl N-[2-(2-[2-[2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)-N-methylacetamido]ethoxy]ethoxy)ethyl]carbamate (536.00 mg, 0.835 mmol, 1.00 equiv) and TFA (1.10 mL, 9.673 mmol, 17.78 equiv) in DCM (5.00 mL) was stirred at 25 degree for 1 hour.

    [0754] The resulting mixture were evaporated to dryness to afford N-[2-[2-(2-aminoethoxy)ethoxy]ethyl]-2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)-N-methylacetamide (670 mg, crude) as a yellow oil, which was used directly without further purification. LCMS (ESI) m/z: [M+H]+=542.

    Step 6: Preparation of 2-((2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzyl) (methyl)amino)-N-(2-(2-(2-((2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindolin-4-yl)amino)ethoxy)ethoxy)ethyl)-N-methylacetamide (Compound D13)

    [0755] ##STR00332##

    [0756] To a solution of N-[2-[2-(2-aminoethoxy)ethoxy]ethyl]-2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)-N-methylacetamide (169.42 mg, 0.313 mmol, 1.20 equiv) and 2-(2,6-dioxopiperidin-3-yl)-4-fluoro-2,3-dihydro-1H-isoindole-1,3-dione (72.00 mg, 0.261 mmol, 1.00 equiv) in NMP (2.00 mL) was added DIEA (168.44 mg, 1.303 mmol, 5.00 equiv). The resulting solution was stirred at 90 degree for 5 hours. Without any additional work-up, the mixture was purified by prep-HPLC (conditions: SunFire C18 OBD Prep Column, 100 ?, 5 ?m, 19 mm?250 mm; Mobile Phase A: Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/minute; Gradient: 16% B to 22% B in 10 minutes; 254 nm; R.sub.t: 9.3 minutes) to give 2-((2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzyl)(methyl)amino)-N-(2-(2-(2-((2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindolin-4-yl)amino)ethoxy) ethoxy)ethyl)-N-methylacetamide (7 mg, 3.37%) as a yellow solid. .sup.1H NMR (400 MHz, Acetonitrile-d3) ? 9.52 (d, J=3.2 Hz, 1H), 9.09 (s, 1H), 8.70 (d, J=5.7 Hz, 1H), 7.67-7.39 (m, 3H), 7.02 (dt, J=8.5, 5.1 Hz, 2H), 6.73 (d, J=1.7 Hz, 2H), 6.52-6.38 (m, 1H), 4.94 (dd, J=12.5, 5.4 Hz, 1H), 3.97 (d, J=9.0 Hz, 2H), 3.86 (s, 6H), 3.67 (q, J=3.8, 2.3 Hz, 2H), 3.65-3.60 (m, 4H), 3.60-3.52 (m, 6H), 3.52-3.46 (m, 2H), 3.46-3.37 (m, 2H), 2.99 (s, 1H), 2.91 (s, 2H), 2.84-2.57 (m, 3H), 2.48 (d, J=3.4 Hz, 3H), 2.15-2.03 (m, 1H). LCMS (ESI) m/z: [M+H]+=798.40.

    Example 66Preparation of N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]-3-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]oxy]-N-methylpropanamide (Compound D14)

    [0757] ##STR00333##

    Step 1: Preparation of methyl 3-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl]oxy]propanoate (i66-2)

    [0758] ##STR00334##

    [0759] To a stirred solution of 2-(2,6-dioxopiperidin-3-yl)-4-hydroxyisoindole-1,3-dione (500.00 mg, 1.823 mmol, 1.00 equiv) and methyl 3-bromopropanoate (395.84 mg, 2.370 mmol, 1.30 equiv) in DMF was added K.sub.2CO.sub.3 (755.96 mg, 5.470 mmol, 3.00 equiv). The resulting solution was stirred for 2 hours at 25? C. The solids were filtered out. The filtrate was concentrated. The residue was applied onto a silica gel column with dichloromethane/methanol (10:1). This resulted in 400 mg (60.89%) of methyl 3-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl]oxy]propanoate as a green solid. LCMS (ESI) m/z: [M?H].sup.+=361.

    Step 2: Preparation of 3-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl]oxy]propanoic (i66-3)

    [0760] ##STR00335##

    [0761] Into a 8-mL sealed tube was added methyl 3-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl]oxy]propanoate (100.00 mg, 0.278 mmol, 1.00 equiv) and TFA (3.00 mL, 3M in water). The resulting solution was stirred for 2 hours at 70? C. The resulting mixture was concentrated. This resulted in 70 mg (72.84%) of 3-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl]oxy]propanoic acid as a yellow solid, which was used directly without further purification. LCMS (ESI) m/z: [M+H].sup.+=347.

    Step 3: Preparation of N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]-3-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]oxy]-N-methylpropanamide (Compound D14)

    [0762] ##STR00336##

    [0763] To a solution of 3-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]oxy]propanoic acid (60.00 mg, 0.173 mmol, 1.00 equiv) and DIEA (44.79 mg, 0.347 mmol, 2.00 equiv) in DMF (2.00 mL) was added HATU (98.82 mg, 0.260 mmol, 1.50 equiv). The reaction mixture was stirred for 10 minutes at 25? C. Then 4-[3,5-dimethoxy-4-[(methylamino)methyl]phenyl]-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (58.80 mg, 0.173 mmol, 1.00 equiv) was added to the reaction mixture. The resulting solution was stirred for 2 hours at 25? C. The crude product was purified by Prep-HPLC (conditions: SunFire C18 OBD Prep Column, 19 mm?250 mm; mobile phase, Water (0.1% FA) and ACN (26% PhaseB up to 44% in 8 minutes); Detector, UV). This resulted in 28.1 mg (24.29%) of N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]-3-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]oxy]-N-methylpropanamide as a green solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.53 (s, 1H), 8.67 (d, J=5.9 Hz, 1H), 7.84 (s, 1H), 7.72 (d, J=6.0 Hz, 1H), 7.62 (dd, J=8.4, 7.2 Hz, 1H), 7.33 (d, J=7.1 Hz, 1H), 7.17 (d, J=8.3 Hz, 1H), 6.77 (s, 2H), 5.17 (dd, J=12.7, 5.5 Hz, 1H), 4.77-4.59 (m, 2H), 4.16-4.01 (m, 2H), 3.91 (s, 5H), 3.88 (s, 1H), 3.72 (s, 3H), 3.01-2.85 (m, 4H), 2.81 (s, 2H), 2.80-2.62 (m, 2H), 2.20-2.10 (m, 1H). LCMS (ESI) m/z: [M+H].sup.+=668.25.

    Example 67Preparation of 4-(((2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl) benzyl)(methyl)amino)methyl)-2-(2,6-dioxopiperidin-3-yl)isoindoline-1,3-dione formic acid (Compound D15 Formic Acid)

    [0764] ##STR00337##

    Step 1: Preparation of (E)-1-(furan-2-yl)-N-(piperidin-1-yl)methanimine (i67-2)

    [0765] ##STR00338##

    [0766] To a mixture of furan-2-carbaldehyde (1.00 g, 10.407 mmol, 1.00 equiv) and piperidin-1-amine (1.04 g, 10.407 mmol, 1.00 equiv) in DCM (25.00 mL) was added MgSO4 (2.51 g, 20.815 mmol, 2.00 equiv). The resulting mixture was stirred overnight at room temperature. The resulting mixture was concentrated under vacuum. The residue was purified by silica gel column chromatography, eluted with MeOH in DCM from 0% to 10% to afford the desired product (E)-1-(furan-2-yl)-N-(piperidin-1-yl)methanimine (1.70 g, 9.551 mmol, 82.48%) as a brown solid. LCMS (ESI) m/z: [M+H].sup.+=179.

    Step 2: Preparation of (E)-4-((piperidin-1-ylimino)methyl)isobenzofuran-1,3-dione (i67-3)

    [0767] ##STR00339##

    [0768] To a solution of furan-2,5-dione (1.12 g, 11.446 mmol, 1.20 equiv) and (E)-1-(furan-2-yl)-N-(piperidin-1-yl)methanimine (1.70 g, 9.538 mmol, 1.00 equiv) in EtOAc (30 mL) was added TFA (0.20 mL). The resulting mixture was stirred overnight under reflux. The resulting mixture was concentrated under vacuum to afford the crude product (E)-4-((piperidin-1-ylimino)methyl)isobenzofuran-1,3-dione (3.10 g, crude) as a brown solid. LCMS (ESI) m/z: [M+H].sup.+=259.

    Step 3: Preparation of (E)-2-(2,6-dioxopiperidin-3-yl)-4-((piperidin-1-ylimino)methyl)isoindoline-1,3-dione (i67-4)

    [0769] ##STR00340##

    [0770] To a mixture of 3-aminopiperidine-2,6-dione (1.54 g, 12.016 mmol, 1.00 equiv) in pyridine (15.00 mL) was added (E)-4-((piperidin-1-ylimino)methyl)isobenzofuran-1,3-dione (3.1 g, 12.016 mmol, 1.00 equiv). The resulting mixture was stirred for 3 hours under reflux. The resulting mixture was concentrated under vacuum. The residue was purified by silica gel column chromatography, eluted with EA in PE from 0% to 50% to afford (E)-2-(2,6-dioxopiperidin-3-yl)-4-((piperidin-1-ylimino)methyl)isoindoline-1,3-dione (1.00 g, 2.717 mmol, 22.62%) as a yellow solid. LCMS (ESI) m/z: [M+H].sup.+=369.

    Step 3: Preparation of 2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindoline-4-carbaldehyde (i67-5)

    [0771] ##STR00341##

    [0772] 2-oxoacetic acid (5.00 g, 0.068 mmol, 0.02 equiv) in H.sub.2O (5.00 mL) was added to a solution of 2-(2,6-dioxopiperidin-3-yl)-4-[(1E)-[(piperidin-1-yl)imino]methyl]-2,3-dihydro-1H-isoindole-1,3-dione (1.00 g, 2.714 mmol, 1.00 equiv) in ACN (2.00 mL). The resulting mixture was stirred overnight at room temperature. The resulting mixture was extracted with EtOAc (3?100 mL). The combined organic layer was washed with saturated sodium bicarbonate solution (2?100 mL) and brine (1?100 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under vacuum. The residue was purified by silica gel column chromatography, eluted with EtOAc in PE from 0% to 50% to afford 2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindole-4-carbaldehyde (460 mg, 1.608 mmol, 59.20%) as a brown solid. LCMS (ESI) m/z: [M+H].sup.+=287.

    Step 4: Preparation of 4-(((2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzyl)(methyl)amino)methyl)-2-(2,6-dioxopiperidin-3-yl)isoindoline-1,3-dione formic acid (Compound D4 Formic Acid)

    [0773] ##STR00342##

    [0774] To a solution of 2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindole-4-carbaldehyde (67.47 mg, 0.236 mmol, 1.00 equiv) in DMF (3.00 mL) was added 4-[3,5-dimethoxy-4-[(methylaminomethyl]phenyl]-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (80.00 mg, 0.236 mmol, 1.00 equiv). The mixture was stirred overnight at room temperature, and then NaBH.sub.3CN (99.91 mg, 0.472 mmol, 2.00 equiv) was added. The resulting mixture was stirred for one hour at room temperature. The mixture was filtered, and the filtrate was purified by prep-HPLC (conditions: SunFire C.sub.18 OBD Prep Column, 100 ?, 5 ?m, 19 mm?250 mm; Mobile Phase A: Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/minute; Gradient: 10% B to 16% B in 14 minutes; 254 nm; Rt: 12.7 minutes) to afford 4-(((2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzyl)(methyl)amino)methyl)-2-(2,6-dioxopiperidin-3-yl)isoindoline-1,3-dione; formate (30.9 mg, 0.0472 mmol, 19.67%) as a light yellow solid. .sup.1H NMR (300 MHz, Acetonitrile-d3) ? 9.53 (d, J=0.9 Hz, 1H), 9.03 (s, 1H), 8.70 (d, J=5.7 Hz, 1H), 8.18 (s, 0.3H, FA), 8.02 (dd, J=6.9, 1.9 Hz, 1H), 7.91-7.78 (m, 2H), 7.57-7.49 (m, 2H), 6.67 (s, 2H), 5.05 (dd, J=12.2, 5.3 Hz, 1H), 4.51 (d, J=4.5 Hz, 2H), 4.16 (s, 2H), 3.83 (s, 6H), 3.62 (s, 3H), 2.85-2.59 (m, 6H), 2.20-2.07 (m, 1H). LCMS (ESI) m/z: [M+H].sup.+=610.35.

    Example 68Preparation of 2-((2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)benzyl)(methyl)amino)-N-(2-(2-(2-((2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindolin-5-yl)amino)ethoxy)ethoxy)ethyl)-N-methylacetamide (Compound D16)

    [0775] ##STR00343##

    [0776] Compound D16 was prepared in a similar manner as described for compound D13. 2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)-N-[2-[2-(2-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-5-yl]amino]ethoxy)ethoxy]ethyl]-N-methylacetamide (10 mg, 3.39%) was obtained as a yellow solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 9.52 (s, 1H), 8.68 (dd, J=5.7, 2.3 Hz, 1H), 8.55 (s, 0.5H, FA), 7.74 (d, J=6.3 Hz, 1H), 7.62 (dd, J=5.9, 2.7 Hz, 1H), 7.48 (dd, J=10.8, 8.4 Hz, 1H), 6.97 (d, J=2.2 Hz, 1H), 6.85-6.71 (m, 3H), 5.01 (dt, J=12.7, 4.9 Hz, 1H), 4.61 (s, 2H), 4.29 (s, 2H), 4.11 (s, 1H), 3.92 (d, J=2.9 Hz, 6H), 3.71 (d, J=1.8 Hz, 3H), 3.66 (dd, J=7.1, 3.9 Hz, 7H), 3.62-3.52 (m, 2H), 3.42-3.34 (m, 2H), 3.03 (d, J=7.0 Hz, 3H), 2.91-2.73 (m, 2H), 2.73-2.62 (m, 4H), 2.12-2.00 (m, 1H). LCMS (ESI) m/z: [M+H]+=798.40.

    Example 69Preparation of 4-[2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl](methyl) amino)ethyl]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione (Compound D17)

    [0777] ##STR00344##

    Step 1: 2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl trifluoromethanesulfonate (i69-2)

    [0778] ##STR00345##

    [0779] To a stirred solution of 2-(2,6-dioxopiperidin-3-yl)-4-hydroxyisoindole-1,3-dione (0.50 g, 1.823 mmol, 1.00 equiv) in DCM (7.00 mL) was added Et.sub.3N (0.76 mL, 7.513 mmol, 3.00 equiv) and pyridine (0.76 mL, 9.611 mmol, 5.18 equiv) at 0? C. Tf.sub.2O (0.77 g, 2.735 mmol, 1.50 equiv) was then added dropwise at 0? C., and the mixture was stirred at this temperature for 30 minutes and then warmed to room temperature for 1 hour. The reaction was quenched by addition of sat. aq. NH.sub.4Cl (5 mL). The resulting mixture was extracted with DCM (2?10 mL). The combined organic layers were dried over anhydrous Na.sub.2SO.sub.4. After filtration, the filtrate was concentrated under reduced pressure. The residue was suspended in 5 mL of DCM and then filtered. The light brown residue was dissolved in 40 mL of MeCN and filtered. The filtrate was concentrated in vacuo to afford 2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl trifluoromethanesulfonate (610 mg, 82.35%) as a light brown solid. LCMS (ESI) m/z: [M+H]+=407.

    Step 2: tert-butyl N-[(E)-2-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl]ethenyl]carbamate (i69-3)

    [0780] ##STR00346##

    [0781] To a mixture of 2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl trifluoromethanesulfonate (580 mg, 1.428 mmol, 1.00 equiv), AcONa (257.6 mg, 3.141 mmol, 2.20 equiv), and Pd(OAc).sub.2 (32.1 mg, 0.143 mmol, 0.10 equiv) was added tert-butyl N-ethenylcarbamate (572.3 mg, 3.997 mmol, 2.80 equiv) and NMP (5 mL) at room temperature under nitrogen atmosphere. The resulting mixture was stirred for 5 hours at 130? C. under nitrogen atmosphere. It was then diluted with EtOAc (30 mL). The resulting mixture was washed with water (3?20 mL). The organic layer was dried over anhydrous Na.sub.2SO.sub.4. After filtration, the filtrate was concentrated under reduced pressure. The residue was purified by Prep-TLC (PE/EtOAc 1:1) to afford tert-butyl N-[(E)-2-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl]ethenyl]carbamate (140 mg, 25%) as a yellow solid. LCMS (ESI) m/z: [M+H]+=400.

    Step 3: tert-butyl N-[2-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl]ethyl]carbamate (i69-4)

    [0782] ##STR00347##

    [0783] A mixture of tert-butyl N-[(E)-2-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl]ethenyl]carbamate (135 mg, 0.338 mmol, 1.00 equiv) and 10% Pd/C (30 mg) in MeOH (5 mL) was stirred under an atmosphere of hydrogen at room temperature for 2 hours. The solution was filtered through a Celite pad and the pad was washed with methanol (20 mL). The filtrate was evaporated to dryness to give tert-butyl N-[2-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl]ethyl]carbamate (135 mg, quant.) as a light yellow oil. LCMS (ESI) m/z: [M+H]+=402.

    Step 4: 4-(2-aminoethyl)-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione; trifluoroacetic acid (i69-5)

    [0784] ##STR00348##

    [0785] To a stirred solution of tert-butyl N-[2-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl]ethyl]carbamate (125 mg, 0.311 mmol, 1.00 equiv) in DCM (3 mL) was added TFA (1 mL, 13.463 mmol, 43.23 equiv) at room temperature. The reaction solution was stirred for 30 minutes at room temperature and then concentrated in vacuo to give 4-(2-aminoethyl)-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione trifluoroacetic acid (129 mg, quant.) as a light brown oil. LCMS (ESI) m/z: [M+H]+=302.

    Step 5: 4-[2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]amino)ethyl]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione (i69-6)

    [0786] ##STR00349##

    [0787] A solution of 4-(2-aminoethyl)-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione trifluoroacetic acid (120 mg, 0.289 mmol, 1.00 equiv) and 2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)benzaldehyde (79.7 mg, 0.246 mmol, 0.85 equiv) in DMF (2 mL) was stirred for 45 minutes at room temperature. To the above mixture was added NaBH(OAc).sub.3 (122.47 mg, 0.578 mmol, 2.00 equiv) at room temperature. The resulting mixture was stirred for additional 1 hour at room temperature. Without any additional work-up, the mixture was purified by reverse phase flash (conditions: C18 column; mobile phase, MeCN in water (0.1% FA), 5% to 80% gradient in 30 min; detector, UV 254 nm) to afford 4-[2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]amino)ethyl]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione (60 mg, 34%) as a colorless oil. LCMS (ESI) m/z: [M+H]+=610.

    Step 6: 4-[2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)ethyl]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione (Compound D17)

    [0788] ##STR00350##

    [0789] To a stirred solution of 4-[2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]amino)ethyl]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione (50 mg, 0.082 mmol, 1.00 equiv) in MeOH (1.00 mL) was added HCHO (37% in water) (0.1 mL) at room temperature. The solution was stirred for 10 minutes at room temperature. Then to the above mixture was added NaBH.sub.3CN (15.0 mg, 0.238 mmol, 2.90 equiv), and the resulting mixture was stirred for additional 1 hour at room temperature. The crude solution was directly purified by Prep-HPLC (conditions: SunFire C18 OBD Prep Column, 100 ?, 5 ?m, 19 mm?250 mm; Mobile Phase A:Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 9% B to 19% B in 12 min; 254 nm) to afford three isomers 4-[2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)ethyl]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione formic acid (first peak, isomer A, 3.1 mg, 5.76%), 4-[2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)ethyl]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione formic acid (second peak, isomer B, 5.4 mg, 9.56%), and 4-[2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)ethyl]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione formic acid (third peak, isomer C, 6.7 mg, 11.94%) each as a white solid.

    [0790] Isomer A: .sup.1H NMR (300 MHz, Methanol-d4) ? 9.52 (d, J=0.9 Hz, 1H), 8.67 (d, J=5.8 Hz, 1H), 8.10 (t, J=4.9 Hz, 1H), 7.91 (d, J=4.6 Hz, 2H), 7.68 (s, 1H), 7.56 (dd, J=5.9, 0.9 Hz, 1H), 6.70 (s, 2H), 5.33 (br s, 1H), 5.21 (dd, J=12.5, 5.4 Hz, 1H), 4.19 (s, 2H), 3.86 (s, 6H), 3.70 (s, 3H), 2.94-2.65 (m, 6H), 2.25-2.12 (m, 1H), 1.74 (br s, 3H). LCMS (ESI) m/z: [M+H]+=624.30.

    [0791] Isomer B: .sup.1H NMR (300 MHz, Methanol-d4) ? 9.53 (d, J=0.9 Hz, 1H), 8.67 (d, J=5.8 Hz, 1H), 8.10 (dd, J=6.1, 2.9 Hz, 1H), 7.97 (d, J=6.1 Hz, 2H), 7.72 (s, 1H), 7.58 (dd, J=5.8, 0.9 Hz, 1H), 6.76 (s, 2H), 5.46 (br s, 1H), 5.22 (dd, J=12.5, 5.4 Hz, 1H), 4.41 (br s, 2H), 3.89 (s, 6H), 3.71 (s, 3H), 2.84 (s, 4H), 2.78-2.65 (m, 2H), 2.24-2.11 (s, 1H), 1.84 (d, J=6.9 Hz, 3H). LCMS (ESI) m/z: [M+H]+=624.35.

    [0792] Isomer C: .sup.1H NMR (300 MHz, Methanol-d4) ? 9.53 (d, J=0.9 Hz, 1H), 8.69 (d, J=5.8 Hz, 1H), 8.55 (s, 0.5H, FA), 7.87-7.70 (m, 4H), 7.64 (dd, J=5.8, 0.9 Hz, 1H), 6.82 (s, 2H), 5.15 (dd, J=12.2, 5.3 Hz, 1H), 4.26 (s, 2H), 3.94 (s, 6H), 3.72 (s, 3H), 3.61-3.49 (m, 2H), 3.27 (s, 2H), 2.96-2.67 (m, 6H), 2.21-2.09 (m, 1H). LCMS (ESI) m/z: [M+H]+=624.35.

    Example 70Preparation of (2S,4R)-1-[(2S)-2-[10-[2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)acetamido]decanamido]-3,3-dimethylbutanoyl]-4-hydroxy-N-[[4-(4-methyl-1,3-thiazol-5-yl)phenyl]methyl]pyrrolidine-2-carboxamide (compound D18)

    [0793] ##STR00351##

    [0794] To a stirred solution of ([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)acetic acid (39.70 mg, 0.100 mmol, 1.00 equiv), EDCl (76.60 mg, 0.400 mmol, 4 equiv), HOBT (53.99 mg, 0.400 mmol, 4 equiv) and DIEA (129.10 mg, 0.999 mmol, 10 equiv) in DMF (1.00 mL) was added (2S,4R)-1-[(2S)-2-(10-aminodecanamido)-3,3-dimethylbutanoyl]-4-hydroxy-N-[[4-(4-methyl-1,3-thiazol-5-yl)phenyl]methyl]pyrrolidine-2-carboxamide (59.92 mg, 0.100 mmol, 1 equiv). The mixture was stirred for 5 h at room temperature under air atmosphere. Then, without any additional work-up, the resulting solution was purified by Prep-TLC (Column: XBridge Prep OBD C18 Column, 19*250 mm, 5 um; Mobile Phase A:Water (10 MMOL/L NH.sub.4HCO.sub.3), Mobile Phase B:ACN; Flow rate:25 mL/min; Gradient:35 B to 55 B in 15 min; 254/220 nm; RT: 11.08 minutes) to afford (2S,4R)-1-[(2S)-2-[10-[2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl](methyl) amino)acetamido]decanamido]-3,3-dimethylbutanoyl]-4-hydroxy-N-[[4-(4-methyl-1,3-thiazol-5-yl)phenyl] methyl]pyrrolidine-2-carboxamide (43 mg, 43.21%) as a white solid. .sup.1H NMR (300 MHz, Methanol-d4) ? 9.54 (d, J=0.9 Hz, 1H), 8.88 (s, 1H), 8.69 (d, J=5.8 Hz, 1H), 7.75 (s, 1H), 7.63 (d, J=5.8, 1H), 7.53-7.39 (m, 4H), 6.76 (s, 2H), 4.68-4.48 (m, 4H), 4.37 (d, J=15.5 Hz, 1H), 3.93 (s, 1H), 3.90 (s, 6H), 3.81 (dd, J=11.0, 3.9 Hz, 1H), 3.76 (s, 2H), 3.71 (s, 3H), 3.21 (t, J=7.0 Hz, 2H), 3.09 (s, 2H), 2.48 (s, 3H), 2.35 (s, 3H), 2.31-2.18 (m, 3H), 2.15-2.04 (m, 1H), 1.65-1.44 (m, 4H), 1.41-1.25 (m, 10H), 1.04 (s, 9H). LCMS (ESI) m/z: [M+H]+=979.60.

    Example 71Preparation of (2S,4R)-1-[(2S)-2-[8-([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)octanamido]-3,3-dimethylbutanoyl]-4-hydroxy-N-[[4-(4-methyl-1,3-thiazol-5-yl)phenyl]methyl]pyrrolidine-2-carboxamide (compound D19)

    [0795] ##STR00352##

    [0796] To a stirred solution of (2S,4R)-1-[(2S)-2-[2-[2-(2-aminoethoxy)ethoxy]acetamido]-3,3-dimethylbutanoyl]-4-hydroxy-N-[[4-(4-methyl-1,3-thiazol-5-yl)phenyl]methyl]pyrrolidine-2-carboxamide (53.25 mg, 0.092 mmol, 1 equiv) in methanol was added 2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)benzaldehyde (30.00 mg, 0.092 mmol, 1.00 equiv) dropwise in portions at room temperature under nitrogen atmosphere. The resulting mixture was stirred for additional 2 h at room temperature. To the above mixture was added NaBH.sub.3CN (7.75 mg, 0.123 mmol, 2.00 equiv) at room temperature. The resulting mixture was stirred for additional 1 h at room temperature. To the above mixture was added NaBH.sub.3CN (7.75 mg, 0.123 mmol, 2.00 equiv) and CH.sub.2O at room temperature. The resulting mixture was stirred for additional 1 h at room temperature. The crude product (50.2 mg) was purified by Prep-HPLC (conditions: Xselect CSH F-Phenyl OBD column, 19*250, 5 ?m; Mobile Phase A: Water (0.05% TFA), Mobile Phase B:ACN; Flow rate:25 mL/min; Gradient:20 B to 30 B in 12 min; 254/220 nm; R.sub.T: 11.48 minutes) to afford (2S,4R)-1-[(2S)-2-[8-([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)octanamido]-3,3-dimethylbutanoyl]-4-hydroxy-N-[[4-(4-methyl-1,3-thiazol-5-yl)phenyl]methyl]pyrrolidine-2-carboxamide as a white solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 1.05 (9H, s), 1.44 (6H, s), 1.67 (2H, s), 1.87 (2H, s), 2.05-2.16 (1H, m), 2.19-2.40 (3H, m), 2.50 (3H, s), 2.86 (3H, s), 3.12-3.24 (1H, m), 3.24-3.32 (1H, m), 3.76 (3H, s), 3.79-3.87 (1H, m), 3.92 (1H, d), 3.98 (6H, s), 4.31-4.42 (2H, m), 4.48-4.64 (4H, m), 4.66 (1H, s), 6.91 (2H, s), 7.40-7.52 (4H, m), 7.94 (1H, d), 8.08 (1H, s), 8.72 (1H, d), 8.99 (1H, s), 9.62 (1H, s). LCMS (ESI) m/z: [M+H]+=894.55.

    Example 72Preparation of (2S,4R)-1-[(2S)-2-(2-[2-[2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)ethoxy]ethoxy]acetamido)-3,3-dimethylbutanoyl]-4-hydroxy-N-[[4-(4-methyl-1,3-thiazol-5-yl)phenyl]methyl]pyrrolidine-2-carboxamide (Compound D24)

    [0797] ##STR00353##

    [0798] To a stirred solution of (2S,4R)-1-[(2S)-2-[2-[2-(2-aminoethoxy)ethoxy]acetamido]-3,3-dimeth ylbutanoyl]-4-hydroxy-N-[[4-(4-methyl-1,3-thiazol-5-yl)phenyl]methyl]pyrrolidine-2-carboxamide (35.50 mg, 0.062 mmol, 1.00 equiv) in methanol was added 2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)benzaldehyde (20.00 mg, 0.062 mmol, 1.00 equiv) dropwise in portions at room temperature under nitrogen atmosphere. The resulting mixture was stirred for additional 2 hours at room temperature. To the above mixture was added NaBH.sub.3CN (7.75 mg, 0.123 mmol, 2.00 equiv) at room temperature. The resulting mixture was stirred for additional 1 h at room temperature. To the above mixture was added NaBH.sub.3CN (7.75 mg, 0.123 mmol, 2.00 equiv) and CH.sub.2O at room temperature. The resulting mixture was stirred for additional 1 h at room temperature. The crude product (30.5 mg) was purified by Prep-HPLC (conditions: Xselect CSH F-Phenyl OBD column, 19*250, 5 ?m; Mobile Phase A:Water (0.05% TFA), Mobile Phase B:ACN; Flow rate:25 mL/min; Gradient:18 B to 27 B in 12 min; 254/220 nm; RT: 10.97 minutes) to afford (2S,4R)-1-[(2S)-2-(2-[2-[2-([[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl](methyl)amino)ethoxy]ethoxy]acetamido)-3,3-dimethylbutanoyl]-4-hydroxy-N-[[4-(4-methyl-1,3-thiazol-5-yl)phenyl]methyl]pyrrolidine-2-carboxamide as a white solid. .sup.1H NMR (400 MHz, Methanol-d4) ? 1.04-1.08 (9H, m), 2.05-2.14 (1H, m), 2.25 (1H, s), 2.49 (3H, t), 2.94 (3H, d), 3.70-3.92 (9H, m), 3.96 (8H, d), 4.02-4.17 (2H, m), 4.31-4.67 (6H, m), 4.74-4.82 (1H, m), 6.90 (2H, d), 7.39-7.49 (4H, m), 7.85-7.95 (1H, m), 8.01-8.07 (1H, m), 8.71 (1H, d), 8.92-8.99 (1H, m), 9.61 (1H, s) LCMS (ESI) m/z: [M+H].sup.+=898.50.

    Example 73BRD9 Bromodomain TR-FRET Competition Binding Assay

    [0799] This example demonstrates the ability of the compounds of the disclosure to biochemically inhibit BRD9 bromodomain in a competition binding assay.

    [0800] Procedure: His-Flag-BRD9 (P133-K239; Swiss Prot Q9H8M2; SEQ ID NO:2 mgsshhhhhhenlyfq/gdykddddkgslevlfqg/PAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKH PMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSK) was cloned, expressed, purified, and then treated with TEV protease. Cleaved His tag was removed by purification. The binding of a biotinylated small molecule ligand of BRD9 was assessed via the LANCE? TR-FRET platform (PerkinElmer), and the compounds were assayed for inhibitory activity against this interaction.

    [0801] Results: A mixture of biotinylated-ligand and SureLight? Allophycocyanin-Streptavidin (APC-SA, PerkinElmer AD0201) in 50 mM HEPES (pH 7.4), 50 mM NaCl, 1 mM TCEP (pH 7), 0.01% (v/v) Tween-20, 0.01% (w/v) bovine serum albumin was added to a white 384-well PerkinElmer Proxiplate Plus plate. DMSO or 3-fold serially diluted compounds were then added to the Proxiplate followed by addition of Flag-BRD9. After a 10 minute incubation at room temperature, Eu-W1024 anti-FLAG (PerkinElmer, AD0273) was added. The final reaction mixture that contained 3.75 nM biotinylated ligand, 3 nM Flag-BRD9, 7.5 nM SureLight? Allophycocyanin-Streptavidin, and 0.2 nM Eu-W1024 anti-FLAG was incubated at room temperature for 90 minutes.

    [0802] The plates were then read on a PerkinElmer Envision plate reader to determine the ratio of emission at 665 nm over 615 nm. Data was normalized to a DMSO control (100%) and a no protein control (0%) and then fit to a four parameter, non-linear curve fit to calculate an IC.sub.50 (?M) as shown in Table 5. As shown by the results in Table 5, a number of compounds of the present disclosure exhibit an IC.sub.50 value of <1 ?M for BRD9 binding, indicating their affinity for targeting BRD9.

    TABLE-US-00005 TABLE 5 Bromodomain TR-FRET Binding Compound No. Bromodomain TR-FRET BRD9 IC.sub.50 (nM) B1 NT B2 +++ B3 + B4 + B5 + B6 + B7 + B8 + B9 + B10 + B11 + B12 + B13 + B14 +++ B15 +++ B16 ++ B17 ++ B18 +++ B19 ++ B20 ++++ B21 +++ B22 +++ B23 +++ B24 ++ B25 ++ B26 + B27 ++ B28 +++ B29 ++ B30 ++ B31 + B32 +++ B33 ++ B34 ++++ B35 ++++ B36 +++ B37 ++ B38 ++++ B39 ++++ B40 ++++ B41 +++ B42 + B43 ++++ B44 ++++ B45 +++ B46 +++ B47 +++ B48 ++ B49 +++ B50 +++ B51 NT B52 +++ B53 +++ B54 ++++ B55 NT B56 +++ B57 + B58 + B59 +++ B60 +++ B61 NT B62 +++ B63 +++ B64 +++ B65 +++ B66 ++ B67 +++ B68 + Compound 1 +++ D1 +++ D2 +++ D3 +++ D4 ++++ D5 ++++ D6 +++ D7 +++ D8 +++ D9 +++ D10 +++ D11 ++++ D12 ++++ D13 +++ D14 ++++ D15 +++ D16 +++ D17 NT D18 ++++ D19 +++ D20 +++ + indicates inhibitory effect of >1000 nM; ++ indicates inhibitory effect of 100-1000 nM; +++ indicates inhibitory effect of 10-100 nM; ++++ indicates inhibitory effect of <10 nM; NT indicates not tested

    Example 74SYO1 BRD9 NanoLuc Degradation Assay

    [0803] This example demonstrates the ability of the compounds of the disclosure to degrade a Nanoluciferase-BRD9 fusion protein in a cell-based degradation assay.

    [0804] Procedure: A stable SYO-1 cell line expressing 3?FLAG-NLuc-BRD9 was generated. On day 0 cells were seeded in 30 ?L media into each well of 384-well cell culture plates. The seeding density was 8000 cells/well. On day 1, cells were treated with 30 nL DMSO or 30 nL of 3-fold serially DMSO-diluted compounds (10 points in duplicates with 1 ?M as final top dose). Subsequently plates were incubated for 6 hours in a standard tissue culture incubator and equilibrated at room temperature for 15 minutes. Nanoluciferase activity was measured by adding 15 ?L of freshly prepared Nano-Glo Luciferase Assay Reagent (Promega N.sub.1130), shaking the plates for 10 minutes and reading the bioluminescence using an EnVision reader.

    [0805] Results: The Inhibition % was calculated using the following formula: % Inhibition=100?(Lum.sub.HC?Lum.sub.Sample)/(Lum.sub.HC?Lum.sub.LC). DMSO treated cells are employed as High Control (HC) and 1 ?M of a known BRD9 degrader standard treated cells are employed as Low Control (LC). The data was fit to a four parameter, non-linear curve fit to calculate IC.sub.50 (?M) values as shown in Table 6. As shown by the results in Table 6, a number of compounds of the present disclosure exhibit an IC.sub.50 value of <1 ?M for the degradation of BRD9, indicating their use as compounds for reducing the levels and/or activity of BRD9 and their potential for treating BRD9-related disorders.

    TABLE-US-00006 TABLE 6 SYO1 BRD9-NanoLuc Degradation Compound No. SYO1 BRD9-NanoLuc degradation IC50 (nM) Compound 1 ++++ D1 ++ D2 ++++ D3 +++ D4 ++++ D5 ++++ D6 ++++ D7 +++ D8 ++++ D9 ++++ D10 ++++ D11 ++++ D12 ++++ D13 +++ D14 + D15 + D16 +++ D17 + D18 ++++ D19 + D20 + + indicates inhibitory effect of >1000 nM; ++ indicates inhibitory effect of 100-1000 nM; +++ indicates inhibitory effect of 10-100 nM; ++++ indicates inhibitory effect of <10 nM; NT indicates not tested

    Other Embodiments

    [0806] All publications, patents, and patent applications mentioned in this specification are incorporated herein by reference in their entirety to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference in its entirety. Where a term in the present application is found to be defined differently in a document incorporated herein by reference, the definition provided herein is to serve as the definition for the term.

    [0807] While the invention has been described in connection with specific embodiments thereof, it will be understood that invention is capable of further modifications and this application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the present disclosure that come within known or customary practice within the art to which the invention pertains and may be applied to the essential features hereinbefore set forth, and follows in the scope of the claims.

    [0808] Other embodiments are in the claims.