Bispecific Antibodies with Alternatively Matched Interchain Cysteines and Uses Thereof
20220411497 · 2022-12-29
Inventors
- Jack Chongyang Li (San Diego, CA, US)
- Minghan Wang (San Diego, CA, US)
- Hui Zou (Hinsdale, IL, US)
- Haiqun Jia (San Diego, CA, US)
Cpc classification
C07K16/28
CHEMISTRY; METALLURGY
C12N15/63
CHEMISTRY; METALLURGY
C07K16/00
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
Abstract
Engineered bispecific antibodies with shifted interchain disulfide bond on one arm while maintaining the native interchain disulfide bond on the second arm are described. Also described are anti-CD47/FRα bispecific antibodies and antigen-binding fragments thereof. Also described are nucleic acids encoding the antibodies, compositions comprising the antibodies, and methods of producing the antibodies and using the antibodies for treating or preventing diseases, such as cancer and/or associated complications.
Claims
1. An isolated bispecific antibody or antigen-binding fragment thereof comprising: a. a first heavy chain, H1; b. a second heavy chain, H2; c. a first light chain, L1; and d. a second light chain, L2; wherein H1 and L1 form a first arm comprising a first antigen-binding domain that specifically binds a first antigen, preferably a first antigen of human origin, and wherein H2 and L2 form a second arm comprising a second antigen-binding domain that specifically binds a second antigen, preferably a second antigen of human origin, wherein (a) H1 comprises a CH1 region of human IgG1, IgG2, IgG3, or IgG4; and (b) L1 comprises a CL region of a human kappa light chain or a human lambda light chain; wherein the CH1 and CL regions comprise amino acid substitutions or a native amino acid at an amino acid residue corresponding to the amino acid position of SEQ ID NO:15, 21, 22, or 23 for CH1 and SEQ ID NO:19 or 24 for CL; wherein the amino acid substitutions or the native amino acid in the CH1 and CL regions are selected from: (1) K133C and C220X in CH1, and F209C and C214X in CL; (2) S131C and C220X in CH1, and P119C and C214X in CL; (3) K133C and C220X in CH1, and K207C and C214X in CL; (4) F170C and C220X in CH1, and S176C and C214X in CL; (5) P171C and C220X in CH1, and S162C and C214X in CL; (6) V173C and C220X in CH1, and Q160C and C214X in CL; (7) F170C and C131X in CH1, and S176C and C214X in CL; (8) P171C and C131X in CH1, and S162C and C214X in CL; (9) V173C and C131X in CH1, and Q160C and C214X in CL; (10) A129C and C220X in CH1, and S121C and C214X in CL; (11) K133C and C220X in CH1, and 1117C and C214X in CL; (12) C131 in CH1, and P119C and C214X in CL; (13) A129C and C131X in CH1, and S121C and C214X in CL; (14) R133C and C131X in CH1, and K207C and C214X in CL; (15) R133C and C131X in CH1, and I117C and C214X in CL; (16) R133C and C131X in CH1, and L117C and C214X in CL; (17) K133C and C220X in CH1, and L117C and C214X in CL; (18) R133C and C131X in CH1, and F209C and C214X in CL; (19) R133C and C131X in CH1, and V209C and C214X in CL; or (20) K133C and C220X in CH1, and V209C and C214X in CL; wherein X is selected from S, A or G.
2. An isolated bispecific antibody or antigen-binding fragment thereof comprising: a. a first heavy chain, H1; b. a second heavy chain, H2; c. a first light chain, L1; and d. a second light chain, L2; wherein H1 and L1 form a first arm comprising a first antigen-binding domain that specifically binds a first antigen, preferably a first antigen of human origin, and wherein H2 and L2 form a second arm comprising a second antigen-binding domain that specifically binds a second antigen, preferably a second antigen of human origin, wherein (a) H1 comprises a CH1 region of human IgG1, IgG2, IgG3, or IgG4 and a heavy chain variable region (VH region); and (b) L1 comprises a CL region of a human kappa light chain or a human lambda light chain and a light chain variable region (VL region); wherein the CH1 region, the VH region, the CL region, and the VL region comprise amino acid substitutions at an amino acid residue corresponding to the amino acid position of SEQ ID NO: 15, 21, 22, or 23 for CH1; SEQ ID NO: 13 for VH; SEQ ID NO: 19 or 24 for CL; and SEQ ID NO: 17 for VL; wherein the amino acid substitutions in the CH1 region, the VH region, the CL region, and the VL region are selected from: (1) C220X in CH1, G44C in VH, C214X in CL, and G101C in VL; or (2) C131X in CH1, G44C in VH, C214X in CL, and G101C in VL; wherein X is selected from S, A or G.
3. The isolated bispecific antibody or antigen-binding fragment thereof of claim 1, wherein the first antigen-binding domain is a CD47 binding domain.
4. The isolated bispecific antibody or antigen-binding fragment thereof of claim 3, wherein the VH region comprises an amino acid sequence of SEQ ID NO: 1, the CH1 region comprises an amino acid sequence of SEQ ID NO: 2, the VL region comprises an amino acid sequence of SEQ ID NO: 3, and the CL region comprises an amino acid sequence of SEQ ID NO: 4.
5. The isolated bispecific antibody or antigen-binding fragment thereof of claim 1, wherein (a) the second arm comprising H2 and L2 does not comprise the amino acid substitutions of the first arm comprising H1 and L1; (b) the two heavy chains H1 and H2 each comprise a VH region, a CH1 region, and a Fc region (containing CH2 and CH3 regions), wherein the VH regions have different amino acid sequences; (c) the two heavy chains H1 and H2 each comprise a VH region, a CH1 region, and a Fc region (containing CH2 and CH3 regions), wherein the CH1 regions have different amino acid sequences; (d) the two heavy chains H1 and H2 each comprise a VH region, a CH1 region, and a Fc region (containing CH2 and CH3 regions), wherein the Fc regions have different amino acid sequences; (e) the two light chains L1 and L2 each comprise a VL region and a CL region, wherein the VL regions have different amino acid sequences; and/or (f) the two light chains L1 and L2 each comprise a VL region and a CL region, wherein the CL regions have different amino acid sequences.
6. The isolated bispecific antibody or antigen-binding fragment thereof of claim 5, wherein H1 and H2 form a heterodimer.
7. The isolated bispecific antibody or antigen-binding fragment thereof of claim 1, wherein (a) the VH region of H1 and the VL region of L1 have a Q39E and a Q38K substitution mutation, respectively, and the VH region of H2 and the VL region of L2 have a Q39K and a Q38E substitution mutation, respectively; or (b) the VH region of H1 and the VL region of L1 have a Q39K and a Q38E substitution mutation, respectively, and the VH region of H2 and the VL region of L2 have a Q39E and a Q38K substitution mutation, respectively.
8. The isolated bispecific antibody or antigen-binding fragment thereof of claim 1, wherein the isolated bispecific antibody or antigen-binding fragment is an anti-CD47/anti-FRα bispecific antibody or antigen-binding fragment thereof, wherein the first antigen-binding domain specifically binds CD47, preferably human CD47, and the second antigen-binding domain specifically binds folate receptor a (FRα), preferably human FRα.
9. The isolated bispecific antibody or antigen-binding fragment thereof of claim 1, wherein (a) the first antigen-binding domain has the VH sequence of SEQ ID: 13 and VL sequence of SEQ ID: 17, and the second antigen-binding domain has the VH sequence of SEQ ID: 33 and VL sequence of SEQ ID: 35; or (b) the first antigen-binding domain has the VH sequence of SEQ ID: 13 and VL sequence of SEQ ID: 17, and the second antigen-binding domain has the VH sequence of SEQ ID: 14 and VL sequence of SEQ ID: 18.
10. The isolated bispecific antibody or antigen-binding fragment thereof of claim 8, wherein the anti-CD47/anti-FRα bispecific antibody or antigen-binding fragment thereof is capable of blocking binding of signal regulatory protein alpha (SIRPα) to CD47 on cancer cells that express both FRα and CD47, inducing macrophage-mediated phagocytosis of cancer cells that express both FRα and CD47, and/or binding cancer cells that express both FRα and CD47 with minimal to undetectable binding to human red blood cells (RBCs).
11. An isolated nucleic acid encoding the bispecific antibody or antigen-binding fragment of claim 1.
12. A vector comprising the isolated nucleic acid of claim 11.
13. A host cell comprising the vector of claim 12.
14. A pharmaceutical composition, comprising the isolated bispecific antibody or antigen-binding fragment thereof of any one of claim 1 and a pharmaceutically acceptable carrier.
15. A method of targeting FRα and CD47 that are both expressed on a cancer cell surface in a subject in need thereof, blocking the binding of SIRPα to CD47 on cancer cells that express both FRα and CD47 in a subject in need thereof, inducing macrophage-mediated phagocytosis of cancer cells that express both FRα and CD47 in a subject in need thereof, binding cancer cells that express both FRα and CD47 with minimal to undetectable binding to human red blood cells (RBCs) in a subject in need thereof, and/or treating cancer in a subject in need thereof, comprising administering to the subject a pharmaceutical composition comprising the isolated anti-CD47/anti-FRα bispecific antibody or antigen-binding fragment thereof of claim 8 and a pharmaceutically acceptable carrier, optionally the cancer is selected from the group consisting of a lung cancer, a gastric cancer, an esophageal cancer, a bile duct cancer, a cholangiocarcinoma, a colon cancer, a hepatocellular carcinoma, a renal cell carcinoma, a bladder urothelial carcinoma, a metastatic melanoma, a breast cancer, an ovarian cancer, a cervical cancer, a head and neck cancer, a pancreatic cancer, a glioma, a glioblastoma, and other solid tumors, and a non-Hodgkin's lymphoma (NHL), an acute lymphocytic leukemia (ALL), a chronic lymphocytic leukemia (CLL), a chronic myelogenous leukemia (CML), a multiple myeloma (MM), an acute myeloid leukemia (AML), and other liquid tumors.
16. A method of producing the bispecific antibody or antigen-binding fragment thereof of claim 1, comprising culturing a cell comprising a nucleic acid encoding the bispecific antibody or antigen-binding fragment thereof under conditions to produce the bispecific antibody or antigen-binding fragment thereof, and recovering the bispecific antibody or antigen-binding fragment thereof from the cell or culture.
17. A method of producing a pharmaceutical composition comprising the bispecific antibody or antigen-binding fragment thereof of claim 1, comprising combining the bispecific antibody or antigen-binding fragment thereof with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0064] The foregoing summary, as well as the following detailed description of preferred embodiments of the present application, will be better understood when read in conjunction with the appended drawings. It should be understood, however, that the application is not limited to the precise embodiments shown in the drawings.
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
DETAILED DESCRIPTION OF THE INVENTION
[0085] Various publications, articles and patents are cited or described in the background and throughout the specification; each of these references is herein incorporated by reference in its entirety. Discussion of documents, acts, materials, devices, articles or the like which has been included in the present specification is for the purpose of providing context for the invention. Such discussion is not an admission that any or all of these matters form part of the prior art with respect to any inventions disclosed or claimed.
[0086] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art to which this invention pertains. Otherwise, certain terms used herein have the meanings as set forth in the specification.
[0087] It must be noted that as used herein and in the appended claims, the singular forms “a,” “an,” and “the” include plural reference unless the context clearly dictates otherwise.
[0088] Unless otherwise stated, any numerical values, such as a concentration or a concentration range described herein, are to be understood as being modified in all instances by the term “about.” Thus, a numerical value typically includes ±10% of the recited value. For example, a concentration of 1 mg/mL includes 0.9 mg/mL to 1.1 mg/mL. Likewise, a concentration range of 1% to 10% (w/v) includes 0.9% (w/v) to 11% (w/v). As used herein, the use of a numerical range expressly includes all possible subranges, all individual numerical values within that range, including integers within such ranges and fractions of the values unless the context clearly indicates otherwise.
[0089] Unless otherwise indicated, the term “at least” preceding a series of elements is to be understood to refer to every element in the series. Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the invention.
[0090] As used herein, the terms “comprises,” “comprising,” “includes,” “including,” “has,” “having,” “contains” or “containing,” or any other variation thereof, will be understood to imply the inclusion of a stated integer or group of integers but not the exclusion of any other integer or group of integers and are intended to be non-exclusive or open-ended. For example, a composition, a mixture, a process, a method, an article, or an apparatus that comprises a list of elements is not necessarily limited to only those elements but can include other elements not expressly listed or inherent to such composition, mixture, process, method, article, or apparatus. Further, unless expressly stated to the contrary, “or” refers to an inclusive or and not to an exclusive or. For example, a condition A or B is satisfied by any one of the following: A is true (or present) and B is false (or not present), A is false (or not present) and B is true (or present), and both A and B are true (or present).
[0091] As used herein, the conjunctive term “and/or” between multiple recited elements is understood as encompassing both individual and combined options. For instance, where two elements are conjoined by “and/or,” a first option refers to the applicability of the first element without the second. A second option refers to the applicability of the second element without the first. A third option refers to the applicability of the first and second elements together. Any one of these options is understood to fall within the meaning, and therefore satisfy the requirement of the term “and/or” as used herein. Concurrent applicability of more than one of the options is also understood to fall within the meaning, and therefore satisfy the requirement of the term “and/or.”
[0092] As used herein, the term “consists of,” or variations such as “consist of” or “consisting of,” as used throughout the specification and claims, indicate the inclusion of any recited integer or group of integers, but that no additional integer or group of integers can be added to the specified method, structure, or composition.
[0093] As used herein, the term “consists essentially of,” or variations such as “consist essentially of” or “consisting essentially of,” as used throughout the specification and claims, indicate the inclusion of any recited integer or group of integers, and the optional inclusion of any recited integer or group of integers that do not materially change the basic or novel properties of the specified method, structure or composition. See M.P.E.P. § 2111.03.
[0094] As used herein, “subject” means any animal, preferably a mammal, most preferably a human. The term “mammal” as used herein, encompasses any mammal. Examples of mammals include, but are not limited to, cows, horses, sheep, pigs, cats, dogs, mice, rats, rabbits, guinea pigs, monkeys, humans, etc., more preferably a human.
[0095] The words “right,” “left,” “lower,” and “upper” designate directions in the drawings to which reference is made.
[0096] It should also be understood that the terms “about,” “approximately,” “generally,” “substantially” and like terms, used herein when referring to a dimension or characteristic of a component of the preferred invention, indicate that the described dimension/characteristic is not a strict boundary or parameter and does not exclude minor variations therefrom that are functionally the same or similar, as would be understood by one having ordinary skill in the art. At a minimum, such references that include a numerical parameter would include variations that, using mathematical and industrial principles accepted in the art (e.g., rounding, measurement or other systematic errors, manufacturing tolerances, etc.), would not vary the least significant digit.
[0097] As used herein, the terms “different heavy chains” or “different light chains” as used throughout the specification and claims, indicate that the heavy chains or the light chains have sequences that are not identical to each other.
[0098] The terms “identical” or percent “identity,” in the context of two or more nucleic acids or polypeptide sequences (e.g., bispecific antibodies, anti-FRα antibodies, anti-CD47 antibodies, anti-CD47/anti-FRα bispecific antibodies, FRα polypeptides and polynucleotides that encode them, and CD47 polypeptides and polynucleotides that encode them), refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection.
[0099] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
[0100] Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by visual inspection (see generally, Current Protocols in Molecular Biology, F. M. Ausubel et al., eds., Current Protocols, a joint venture between Greene Publishing Associates, Inc. and John Wiley & Sons, Inc., (1995 Supplement) (Ausubel)).
[0101] Examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1990) J. Mol. Biol. 215: 403-410 and Altschul et al. (1997) Nucleic Acids Res. 25: 3389-3402, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al, supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased.
[0102] Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always>0) and N (penalty score for mismatching residues; always<0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) of 10, M=5, N=−4, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)).
[0103] In addition to calculating percent sequence identity, the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat'l. Acad. Sci. USA 90:5873-5787 (1993)). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001.
[0104] A further indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the polypeptide encoded by the second nucleic acid, as described below. Thus, a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions. Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions.
[0105] As used herein, the term “polynucleotide,” synonymously referred to as “nucleic acid molecule,” “nucleotides” or “nucleic acids,” refers to any polyribonucleotide or polydeoxyribonucleotide, which can be unmodified RNA or DNA or modified RNA or DNA. “Polynucleotides” include, without limitation single- and double-stranded DNA, DNA that is a mixture of single- and double-stranded regions, single- and double-stranded RNA, and RNA that is mixture of single- and double-stranded regions, hybrid molecules comprising DNA and RNA that can be single-stranded or, more typically, double-stranded or a mixture of single- and double-stranded regions. In addition, “polynucleotide” refers to triple-stranded regions comprising RNA or DNA or both RNA and DNA. The term polynucleotide also includes DNAs or RNAs containing one or more modified bases and DNAs or RNAs with backbones modified for stability or for other reasons. “Modified” bases include, for example, tritylated bases and unusual bases such as inosine. A variety of modifications can be made to DNA and RNA; thus, “polynucleotide” embraces chemically, enzymatically or metabolically modified forms of polynucleotides as typically found in nature, as well as the chemical forms of DNA and RNA characteristic of viruses and cells. “Polynucleotide” also embraces relatively short nucleic acid chains, often referred to as oligonucleotides.
[0106] As used herein, the term “vector” is a replicon in which another nucleic acid segment can be operably inserted so as to bring about the replication or expression of the segment.
[0107] As used herein, the term “host cell” refers to a cell comprising a nucleic acid molecule of the invention. The “host cell” can be any type of cell, e.g., a primary cell, a cell in culture, or a cell from a cell line. In one embodiment, a “host cell” is a cell transfected with a nucleic acid molecule of the invention. In another embodiment, a “host cell” is a progeny or potential progeny of such a transfected cell. A progeny of a cell may or may not be identical to the parent cell, e.g., due to mutations or environmental influences that can occur in succeeding generations or integration of the nucleic acid molecule into the host cell genome.
[0108] The term “expression” as used herein, refers to the biosynthesis of a gene product. The term encompasses the transcription of a gene into RNA. The term also encompasses translation of RNA into one or more polypeptides, and further encompasses all naturally occurring post-transcriptional and post-translational modifications. The expressed bispecific antibody can be within the cytoplasm of a host cell, into the extracellular milieu such as the growth medium of a cell culture or anchored to the cell membrane.
[0109] As used herein, the terms “peptide,” “polypeptide,” or “protein” can refer to a molecule comprised of amino acids and can be recognized as a protein by those of skill in the art. The conventional one-letter or three-letter code for amino acid residues is used herein. The terms “peptide,” “polypeptide,” and “protein” can be used interchangeably herein to refer to polymers of amino acids of any length. The polymer can be linear or branched, it can comprise modified amino acids, and it can be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component. Also included within the definition are, for example, polypeptides containing one or more analogs of an amino acid (including, for example, unnatural amino acids, etc.), as well as other modifications known in the art.
[0110] The peptide sequences described herein are written according to the usual convention whereby the N-terminal region of the peptide is on the left and the C-terminal region is on the right. Although isomeric forms of the amino acids are known, it is the L-form of the amino acid that is represented unless otherwise expressly indicated.
Bispecific Antibodies
[0111] The invention generally relates to isolated bispecific antibodies in which the native cysteine residues for the interchain disulfide bond between the CH1 region of the heavy chain and the CL region of the light chain of one arm are eliminated by converting the native cysteine residues to non-cysteine residues (e.g., native cysteine residues to serine residues); concurrently or subsequently, two native non-cysteine residues in the CH1 and CL regions or in the VH and VL regions of the same arm are converted to cysteines so that a new interchain disulfide bond is formed between the heavy chain and the light chain. The two native non-cysteine residues, with one each on the CH1 region and the CL region or one each on the VH region and the VL region are identified by structural modeling for their proximity and the potential to form an interchain disulfide bond once converted to cysteines. The amino acid substitutions result in the least perturbation to the overall structure of the antigen binding domain. The overall effect of the invention is that the native interchain disulfide bond between the CH1 and CL regions in one arm of the bispecific antibody is shifted to a different site with the recombinantly introduced cysteines and the native interchain disulfide bond in the second arm is unchanged.
[0112] The invention generally also relates to isolated bispecific antibodies in which one arm has a shifted interchain disulfide bond as described above and the other arm has the native interchain disulfide bond creating a heterodimer, with one arm comprising a shifted interchain disulfide bond and the second arm comprising the native interchain disulfide bond. The bispecific antibody is capable of binding to two antigens. Bispecific antibodies formed with two different heavy chains (HCs) and light chains (LCs) are difficult to produce due to the propensity of incorrect pairing of the two heavy chains and the two light chains, which results in the production of unwanted products that are difficult to eliminate in the manufacturing process; even when the unwanted products from mispairing can be eliminated during purification, the mispairing reduces the production efficiency for the intended bispecific antibody product. Different strategies to reduce or eliminate mispairing of HCs and LCs have been attempted, but many of them involve protein engineering including domain swap and mutagenesis, leading to increased risk of aggregation and immunogenicity. By introducing a “shifted interchain disulfide bond” in one arm while maintaining the native interchain disulfide bond in the second arm, and concurrently introducing knob in the hole and disulfide bond-forming cysteine mutations in the Fc regions, the heterodimeric bispecific antibody can be produced with improved efficiency. Production of such bispecific antibodies, including, but not limited to anti-CD47/anti-FRα bispecific antibodies, can be carried out by co-expressing the two heavy chains and the two light chains.
Antibodies
[0113] The invention generally relates to isolated bispecific antibodies with a shifted interchain disulfide bond on one arm while maintaining the native interchain disulfide bond on the second arm. In particular, the invention generally relates to anti-CD47/anti-FRα bispecific antibodies, nucleic acids and expression vectors encoding the antibodies, recombinant cells containing the vectors, and compositions comprising the antibodies. Methods of making the antibodies, and methods of using the antibodies to treat diseases, including cancer, are also provided. The antibodies of the invention possess one or more desirable functional properties, including but not limited to high-affinity binding to FRα and CD47, high specificity to FRα and CD47, the ability to induce effector-mediated tumor cell lysis, the ability to stimulate complement-dependent cytotoxicity (CDC), antibody-dependent phagocytosis (ADPC), and/or antibody-dependent cellular-mediated cytotoxicity (ADCC) against cells expressing FRα and/or CD47, the ability to mediate the recruitment of conjugated drugs, and the ability to inhibit tumor growth in subjects and animal models when administered alone or in combination with other anti-cancer therapies.
[0114] As used herein, the term “antibody” is used in a broad sense and includes immunoglobulin or antibody molecules including human, humanized, composite and chimeric antibodies and antibody fragments that are monoclonal or polyclonal. In general, antibodies are proteins or peptide chains that exhibit binding specificity to a specific antigen. Antibody structures are well known. Immunoglobulins can be assigned to five major classes (i.e., IgA, IgD, IgE, IgG and IgM), depending on the heavy chain constant domain amino acid sequence. IgA and IgG are further sub-classified as the isotypes IgA1, IgA2, IgG1, IgG2, IgG3 and IgG4. Accordingly, the antibodies of the invention can be of any of the five major classes or corresponding sub-classes. Preferably, the antibodies of the invention are IgG1, IgG2, IgG3 or IgG4. Antibody light chains of vertebrate species can be assigned to one of two clearly distinct types, namely kappa and lambda, based on the amino acid sequences of their constant domains. Accordingly, the antibodies of the invention can contain a kappa or lambda light chain constant domain. According to particular embodiments, the antibodies of the invention include heavy and/or light chain constant regions from rat or human antibodies. In addition to the heavy and light constant domains, antibodies contain an antigen-binding region that is made up of a light chain variable region and a heavy chain variable region, each of which contains three domains (i.e., complementarity determining regions 1-3; CDR1, CDR2, and CDR3). The light chain variable region domains are alternatively referred to as LCDR1, LCDR2, and LCDR3, and the heavy chain variable region domains are alternatively referred to as HCDR1, HCDR2, and HCDR3.
[0115] Several systems are used for the numbering of amino acid residues in antibodies. The Kabat numbering method is a scheme based on variable regions of antibodies (Elvin A. Kabat et al., Sequences of Proteins of Immunological Interest 5th ed. (1991). The EU numbering system is widely used for the constant domains (including portions of the CH1, hinge, and the Fc) (Elvin A. Kabat et al., Sequences of Proteins of Immunological Interest 5th ed. (1991).
[0116] As used herein, the term an “isolated antibody” refers to an antibody which is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds to FRα is substantially free of antibodies that do not bind to FRα, an isolated antibody that specifically binds to CD47 is substantially free of antibodies that do not bind to CD47, a bispecific antibody that specifically binds to CD47 and FRα is substantially free of antibodies that do not bind to CD47 and FRα). In addition, an isolated antibody is substantially free of other cellular material and/or chemicals.
[0117] As used herein, the term “monoclonal antibody” refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. The monoclonal antibodies of the invention can be made by the hybridoma method, phage display technology, single lymphocyte gene cloning technology, or by recombinant DNA methods. For example, the monoclonal antibodies can be produced by a hybridoma which includes a B cell obtained from a transgenic nonhuman animal, such as a transgenic mouse or rat, having a genome comprising a human heavy chain transgene and a light chain transgene.
[0118] As used herein, the term “antigen-binding fragment” refers to an antibody fragment such as, for example, a diabody, a Fab, a Fab′, a F(ab′)2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv).sub.2, a bispecific dsFv (dsFv-dsFv′), a disulfide stabilized diabody (ds diabody), a single-chain antibody molecule (scFv), a single domain antibody (sdab), an scFv dimer (bivalent diabody), a multispecific antibody formed from a portion of an antibody comprising one or more CDRs, a camelized single domain antibody, a nanobody, a domain antibody, a bivalent domain antibody, or any other antibody fragment that binds to an antigen but does not comprise a complete antibody structure. An antigen-binding fragment is capable of binding to the same antigen to which the parent antibody or a parent antibody fragment binds. According to particular embodiments, the antigen-binding fragment comprises a light chain variable region, a light chain constant region, and an Fd segment of the heavy chain. According to other particular embodiments, the antigen-binding fragment comprises Fab and F(ab′).
[0119] As used herein, the term “single-chain antibody” refers to a conventional single-chain antibody in the field, which comprises a heavy chain variable region and a light chain variable region connected by a short peptide of about 15 to about 20 amino acids. As used herein, the term “single domain antibody” refers to a conventional single domain antibody in the field, which comprises a heavy chain variable region and a heavy chain constant region or which comprises only a heavy chain variable region.
[0120] As used herein, the term “human antibody” refers to an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human made using any technique known in the art. This definition of a human antibody includes intact or full-length antibodies, fragments thereof, and/or antibodies comprising at least one human heavy and/or light chain polypeptide.
[0121] As used herein, the term “humanized antibody” refers to a non-human antibody that is modified to increase the sequence homology to that of a human antibody, such that the antigen-binding properties of the antibody are retained, but its antigenicity in the human body is reduced.
[0122] As used herein, the term “chimeric antibody” refers to an antibody wherein the amino acid sequence of the immunoglobulin molecule is derived from two or more species. The variable region of both the light and heavy chains often corresponds to the variable region of an antibody derived from one species of mammal (e.g., mouse, rat, rabbit, etc.) having the desired specificity, affinity, and capability, while the constant regions correspond to the sequences of an antibody derived from another species of mammal (e.g., human) to avoid eliciting an immune response in that species.
[0123] As used herein, the term “multispecific antibody” refers to an antibody that comprises a plurality of immunoglobulin variable domain sequences, wherein a first immunoglobulin variable domain sequence of the plurality has binding specificity for a first epitope and a second immunoglobulin variable domain sequence of the plurality has binding specificity for a second epitope. In an embodiment, the first and second epitopes are on the same antigen, e.g., the same protein (or subunit of a multimeric protein). In an embodiment, the first and second epitopes overlap or substantially overlap. In an embodiment, the first and second epitopes do not overlap or do not substantially overlap. In an embodiment, the first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein). In an embodiment, a multispecific antibody comprises a third, fourth, or fifth immunoglobulin variable domain. In an embodiment, a multispecific antibody is a bispecific antibody molecule, a trispecific antibody molecule, or a tetraspecific antibody molecule.
[0124] As used herein, the term “bispecifc antibody” refers to a multispecific antibody that binds no more than two epitopes or two antigens. A bispecific antibody is characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first epitope and a second immunoglobulin variable domain sequence that has binding specificity for a second epitope. In an embodiment, the first and second epitopes are on the same antigen, e.g., the same protein (or subunit of a multimeric protein). In an embodiment, the first and second epitopes overlap or substantially overlap. In an embodiment, the first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein). In an embodiment, a bispecific antibody comprises a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a first epitope and a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a second epitope. In an embodiment, a bispecific antibody comprises a half antibody, or fragment thereof, having binding specificity for a first epitope and a half antibody, or fragment thereof, having binding specificity for a second epitope. In an embodiment, a bispecific antibody comprises a scFv, or fragment thereof, having binding specificity for a first epitope, and a scFv, or fragment thereof, having binding specificity for a second epitope.
[0125] As used herein, the term “FRα” refers to folate receptor a, also known as folate receptor 1 (FOLR1) or folate binding protein (FBP), which is a glycosyl-phosphatidylinositol (GPI)-anchored membrane protein on a cell surface that has high affinity for and transports the active form of folate, 5-methyltetrahydrofolate (5-MTF), and its derivatives into cells (Salazar and Ratnam, Cancer Metastasis Rev 2007; 26:141-52). FRα has become an oncology target because it is overexpressed in certain solid tumors such as ovarian, lung and breast cancers (Toffoli et al., Int J Cancer 1997; 74:193-198 and Boogerd et al., Oncotarget 2016; 7:17442-17454), but its expression is at low levels in limited normal human tissues (Weitman, et al., Cancer Res 1992; 52:3396-3401). Consistent with this observation, phase 1 clinical trials conducted so far with FRα-targeted small and large molecules revealed good drug tolerability (Cheung et al., Oncotarget 2016; 7:52553-52574). Therefore, FRα is a tumor-associated/tumor-specific antigen and anti-FRα monoclonal antibodies (mAbs) and bispecific antibodies can be potential anti-cancer therapies. Further, FRα can be used to specifically target therapeutic molecules to cancer cells. An exemplary amino acid sequence of a human FRα is represented by GenBank Accession No. NP_057937.1.
[0126] As used herein, the term “CD47” refers to a multi-spanning transmembrane receptor belonging to the immunoglobulin superfamily, which has been indicated to be involved in multiple cellular process, including cell migration, adhesion, and T cell function. CD47, also known as integrin-associated protein (IAP), ovarian cancer antigen (OA3), Rh-related antigen, and MER6, was originally identified as a tumor antigen on human ovarian cancer and was subsequently shown to be expressed on multiple human tumor types, including both hematologic and solid tumors. The interaction between CD47 and signal regulatory protein alpha (SIRPα), an inhibitory protein expressed on macrophages, prevents phagocytosis of CD47-expressing cells. CD47 is additionally expressed at low levels on virtually all non-malignant cells. The term “human CD47” refers to a CD47 originated from a human. An exemplary amino acid sequence of a human CD47 is represented in GenBank Accession No. NP_001768.1.
[0127] As used herein, an antibody that “specifically binds to CD47 and/or FRα” refers to an antibody that binds to CD47 and/or FRα, preferably human CD47 and/or human FRα, with a KD of 1×10.sup.−7 M or less, preferably 1×10.sup.−8 M or less, more preferably 5×10.sup.−9 M or less, 1×10.sup.−9 M or less, 5×10.sup.−10 M or less, or 1×10.sup.−10 M or less. The term “KD” refers to the dissociation constant, which is obtained from the ratio of Kd to Ka (i.e., Kd/Ka) and is expressed as a molar concentration (M). KD values for antibodies can be determined using methods in the art in view of the present disclosure. For example, the KD of an antibody can be determined by using surface plasmon resonance, such as by using a biosensor system, e.g., a Biacore® system, or by using bio-layer interferometry technology, such as an Octet RED96 system.
[0128] The smaller the value of the KD of an antibody, the higher affinity that the antibody binds to a target antigen.
[0129] According to another particular aspect, the invention relates to isolated bispecific antibodies or antigen-binding fragments thereof comprising: [0130] a. a first heavy chain, H1 ; [0131] b. a second heavy chain, H2; [0132] c. a first light chain, L1 ; and [0133] d. a second light chain, L2;
wherein H1 and L1 form a first arm comprising a first antigen-binding domain that specifically binds a first antigen, preferably a first antigen of human origin, and
wherein H2 and L2 form a second arm comprising a second antigen-binding domain that specifically binds a second antigen, preferably a second antigen of human origin, wherein [0134] (a) H1 comprises a CH1 region of human IgG1, IgG2, IgG3, or IgG4; and [0135] (b) L1 comprises a CL region of a human kappa light chain or a human lambda light chain;
wherein the CH1 and CL regions comprise amino acid substitutions or a native amino acid at an amino acid residue corresponding to the amino acid position of SEQ ID NO:15, 21, 22, or 23 for CH1 and SEQ ID NO:19 or 24 for CL;
wherein the amino acid substitutions or the native amino acid in the CH1 and CL regions are selected from:
[0136] (1) K133C and C220X in CH1, and F209C and C214X in CL;
[0137] (2) S131C and C220X in CH1, and P119C and C214X in CL;
[0138] (3) K133C and C220X in CH1, and K207C and C214X in CL;
[0139] (4) F170C and C220X in CH1, and S176C and C214X in CL;
[0140] (5) P171C and C220X in CH1, and S162C and C214X in CL;
[0141] (6) V173C and C220X in CH1, and Q160C and C214X in CL;
[0142] (7) F170C and C131X in CH1, and S176C and C214X in CL;
[0143] (8) P171C and C131X in CH1, and S162C and C214X in CL;
[0144] (9) V173C and C131X in CH1, and Q160C and C214X in CL;
[0145] (10)A129C and C220X in CH1, and S121C and C214X in CL;
[0146] (11)K133C and C220X in CH1, and I117C and C214X in CL;
[0147] (12)C131 in CH1, and P119C and C214X in CL;
[0148] (13) A129C and C131X in CH1, and S121C and C214X in CL;
[0149] (14) R133C and C131X in CH1, and K207C and C214X in CL;
[0150] (15) R133C and C131X in CH1, and I117C and C214X in CL;
[0151] (16) R133C and C131X in CH1, and L117C and C214X in CL;
[0152] (17) K133C and C220X in CH1, and L117C and C214X in CL;
[0153] (18) R133C and C131X in CH1, and F209C and C214X in CL;
[0154] (19) R133C and C131X in CH1, and V209C and C214X in CL; or
[0155] (20) K133C and C220X in CH1, and V209C and C214X in CL; [0156] wherein X is selected from S, A or G.
[0157] According to another particular aspect, the invention relates to isolated bispecific antibodies or antigen-binding fragment thereof comprising: [0158] a. a first heavy chain, H1; [0159] b. a second heavy chain, H2; [0160] c. a first light chain, L1; and [0161] d. a second light chain, L2;
wherein H1 and L1 form a first arm comprising a first antigen-binding domain that specifically binds a first antigen, preferably a first antigen of human origin, and
wherein H2 and L2 form a second arm comprising a second antigen-binding domain that specifically binds a second antigen, preferably a second antigen of human origin, wherein [0162] (a) H1 comprises a CH1 region of human IgG1, IgG2, IgG3, or IgG4 and a heavy chain variable region (VH region); and [0163] (b) L1 comprises a CL region of a human kappa light chain or a human lambda light chain and a light chain variable region (VL region);
wherein the CH1 region, the VH region, the CL region, and the VL region comprise amino acid substitutions at an amino acid residue corresponding to the amino acid position of SEQ ID NO: 15, 21, 22, or 23 for CH1; SEQ ID NO: 13 for VH; SEQ ID NO: 19 or 24 for CL; and SEQ ID NO: 17 for VL;
wherein the amino acid substitutions in the CH1 region, the VH region, the CL region, and the VL region are selected from:
[0164] (1) C220X in CH1, G44C in VH, C214X in CL, and G101C in VL; or
[0165] (2) C131X in CH1, G44C in VH, C214X in CL, and G101C in VL; [0166] wherein X is selected from S, A or G.
[0167] According to another particular aspect, the first antigen-binding domain is a CD47 binding domain. In certain embodiments, the VH region comprises an amino acid sequence of SEQ ID NO: 1, the CH1 region comprises an amino acid sequence of SEQ ID NO: 2, the VL region comprises an amino acid sequence of SEQ ID NO: 3, and the CL region comprises an amino acid sequence of SEQ ID NO: 4.
[0168] According to another particular aspect, (a) the second arm comprising H2 and L2 does not comprise the amino acid substitutions of the first arm comprising H1 and L1; (b) the two heavy chains H1 and H2 each comprise a VH region, a CH1 region, and a Fc region (containing CH2 and CH3 regions), wherein the VH regions have different amino acid sequences; (c) the two heavy chains H1 and H2 each comprise a VH region, a CH1 region, and a Fc region (containing CH2 and CH3 regions), wherein the CH1 regions have different amino acid sequences; (d) the two heavy chains H1 and H2 each comprise a VH region, a CH1 region, and a Fc region (containing CH2 and CH3 regions), wherein the Fc regions have different amino acid sequences; (e) the two light chains L1 and L2 each comprise a VL region and a CL region, wherein the VL regions have different amino acid sequences; and/or (f) the two light chains L1 and L2 each comprise a VL region and a CL region, wherein the CL regions have different amino acid sequences.
[0169] In another particular aspect, H1 and H2 form a heterodimer.
[0170] In another particular aspect, (a) the VH region of H1 and the VL region of L1 have a Q39E and a Q38K substitution mutation, respectively, and the VH region of H2 and the VL region of L2 have a Q39K and a Q38E substitution mutation, respectively; or the VH region of H1 and the VL region of L1 have a Q39K and a Q38E substitution mutation, respectively, and the VH region of H2 and the VL region of L2 have a Q39E and a Q38K substitution mutation, respectively.
[0171] In another particular aspect, the isolated bispecific antibody or antigen-binding fragment thereof is an anti-CD47/anti-FRα bispecific antibody or antigen-binding fragment thereof. In certain embodiments, the anti-CD47/anti-FRα bispecific antibody or antigen-binding fragment thereof is capable of blocking binding of signal regulatory protein alpha (SIRPα) to CD47 on cancer cells that express both FRα and CD47. In certain embodiments, the isolated humanized anti-CD47/anti-FRα bispecific antibody or antigen-binding fragment thereof is capable of inducing macrophage-mediated phagocytosis of cancer cells that express both FRα and CD47. In certain embodiments, the isolated humanized anti-CD47/anti-FRα bispecific antibody or antigen-binding fragment thereof is capable of binding cancer cells that express both FRα and CD47 with minimal to undetectable binding to human red blood cells (RBCs).
[0172] In another particular aspect, the first antigen-binding domain has the VH sequence of SEQ ID: 13 and VL sequence of SEQ ID: 17, and the second antigen-binding domain has the VH sequence of SEQ ID: 33 and VL sequence of SEQ ID: 35; or the first antigen-binding domain has the VH sequence of SEQ ID: 13 and VL sequence of SEQ ID: 17, and the second antigen-binding domain has the VH sequence of SEQ ID: 14 and VL sequence of SEQ ID: 18.
[0173] Full length bispecific antibodies of the invention can be generated for example using Fab arm exchange (or half molecule exchange) between two mono specific bivalent antibodies by introducing substitutions at the heavy chain CH3 interface in each half molecule to favor heterodimer formation of two antibody half molecules having distinct specificity either in vitro in cell-free environment or using co-expression. The Fab arm exchange reaction is the result of a disulfide-bond isomerization reaction and dissociation-association of CH3 domains. The heavy-chain disulfide bonds in the hinge regions of the parent mono specific antibodies are reduced. The resulting free cysteines of one of the parent monospecific antibodies form an inter heavy-chain disulfide bond with cysteine residues of a second parent monospecific antibody molecule and simultaneously CH3 domains of the parent antibodies release and reform by dissociation-association. The CH3 domains of the Fab arms can be engineered to favor heterodimerization over homodimerization. The resulting product is a bispecific antibody having two Fab arms or half molecules which each bind a distinct epitope, i.e., an epitope on CD47 and an epitope on FRα.
[0174] “Homodimerization” as used herein refers to an interaction of two heavy chains having identical CH3 amino acid sequences. “Homodimer” as used herein refers to an antibody having two heavy chains with identical CH3 amino acid sequences.
[0175] “Heterodimerization” as used herein refers to an interaction of two heavy chains having non-identical CH3 amino acid sequences. “Heterodimer” as used herein refers to an antibody having two heavy chains with non-identical CH3 amino acid sequences.
[0176] The “knob-in-hole” strategy (see, e.g., PCT Publ. No. WO2006/028936) can be used to generate full length bispecific antibodies. Briefly, selected amino acids forming the interface of the CH3 domains in human IgG can be mutated at positions affecting CH3 domain interactions to promote heterodimer formation. An amino acid with a small side chain (hole) is introduced into a heavy chain of an antibody specifically binding a first antigen and an amino acid with a large side chain (knob) is introduced into a heavy chain of an antibody specifically binding a second antigen. After co-expression of the two antibodies, a heterodimer is formed as a result of the preferential interaction of the heavy chain with a “hole” with the heavy chain with a “knob.” Exemplary CH3 substitution pairs forming a knob and a hole are (expressed as modified positions in the first CH3 domain of the first heavy chain/modified position in the second CH3 domain of the second heavy chain): T366Y/F405A, T366W/F405W, F405W/Y407A, T394W/Y407T, T394S/Y407A, T366W/T394S, F405W/T394S and T366W/T366S_L368A_Y407V.
[0177] Other strategies such as promoting heavy chain heterodimerization using electrostatic interactions by substituting positively charged residues at one CH3 surface and negatively charged residues at a second CH3 surface can be used, as described in U.S. Pat. Publ. No. 2010/0015133; U.S. Pat. Publ. No. 2009/0182127; U.S. Pat. Publ. No. 2010/028637; or U.S. Pat. Publ. No. 2011/0123532. In other strategies, heterodimerization can be promoted by the following substitutions (expressed as modified position in the first CH3 domain of the first heavy chain/modified position in the second CH3 domain of the second heavy chain): L351Y_F405AY407V/T394W, T366I_K392M_T394W/F405A_Y407V, T366L_K392M_T394W/F405A_Y407V, L351Y_Y407A/T366A_K409F, L351Y_Y407A/T366V K409F Y407A/T366A_K409F, or T350V_L351Y_F405A Y407V/T350V_T366L_K392L_T394W as described in U.S. Pat. Publ. No. 2012/0149876 or U.S. Pat. Publ. No. 2013/0195849.
[0178] In addition to methods described above, bispecific antibodies of the invention can be generated in vitro in a cell-free environment by introducing asymmetrical mutations in the CH3 regions of two mono specific homodimeric antibodies and forming the bispecific heterodimeric antibody from two parent monospecific homodimeric antibodies in reducing conditions to allow disulfide bond isomerization according to methods described in PCT Pat. Publ. No. WO2011/131746. In the methods, the first monospecific bivalent antibody and the second monospecific bivalent antibody are engineered to have certain substitutions at the CH3 domain that promotes heterodimer stability; the antibodies are incubated together under reducing conditions sufficient to allow the cysteines in the hinge region to undergo disulfide bond isomerization; thereby generating the bispecific antibody by Fab arm exchange. The incubation conditions can optionally be restored to non-reducing conditions. Exemplary reducing agents that can be used are 2-mercaptoethylamine (2-MEA), dithiothreitol (DTT), dithioerythritol (DTE), glutathione, tris (2-carboxyethyl) phosphine (TCEP), L-cysteine and beta-mercaptoethanol, preferably a reducing agent selected from the group consisting of: 2-mercaptoethylamine, dithiothreitol and tris (2-carboxyethyl) phosphine. For example, incubation for at least 90 minutes at a temperature of at least 20° C. in the presence of at least 25 mM 2-MEA or in the presence of at least 0.5 mM dithiothreitol at a pH from 5-8, for example at pH of 7.0 or at pH of 7.4 can be used.
[0179] In another general aspect, the invention relates to an isolated nucleic acid encoding a bispecific antibody or antigen-binding fragment thereof of the invention. It will be appreciated by those skilled in the art that the coding sequence of a protein can be changed (e.g., replaced, deleted, inserted, etc.) without changing the amino acid sequence of the protein. Accordingly, it will be understood by those skilled in the art that nucleic acid sequences encoding antibodies or antigen-binding fragments thereof of the invention can be altered without changing the amino acid sequences of the proteins.
[0180] In another general aspect, the invention relates to a vector comprising an isolated nucleic acid encoding a bispecific antibody or antigen-binding fragment thereof of the invention. Any vector known to those skilled in the art in view of the present disclosure can be used, such as a plasmid, a cosmid, a phage vector or a viral vector. In some embodiments, the vector is a recombinant expression vector such as a plasmid. The vector can include any element to establish a conventional function of an expression vector, for example, a promoter, ribosome binding element, terminator, enhancer, selection marker, and origin of replication. The promoter can be a constitutive, inducible or repressible promoter. A number of expression vectors capable of delivering nucleic acids to a cell are known in the art and can be used herein for production of an antibody or antigen-binding fragment thereof in the cell. Conventional cloning techniques or artificial gene synthesis can be used to generate a recombinant expression vector according to embodiments of the invention. Such techniques are well known to those skilled in the art in view of the present disclosure.
[0181] In another general aspect, the invention relates to a host cell comprising a vector comprising an isolated nucleic acid encoding a bispecific antibody or antigen-binding fragment thereof of the invention. Any host cell known to those skilled in the art in view of the present disclosure can be used for recombinant expression of antibodies or antigen-binding fragments thereof of the invention. In some embodiments, the host cells are E. coli TG1 or BL21 cells (for expression of, e.g., an scFv or Fab antibody), CHO-DG44 or CHO-K1 cells or HEK293 cells (for expression of, e.g., a full-length IgG antibody). According to particular embodiments, the recombinant expression vector is transformed into host cells by conventional methods such as chemical transfection, heat shock, or electroporation, where it is stably integrated into the host cell genome such that the recombinant nucleic acid is effectively expressed.
[0182] In another general aspect, the invention relates to a method of producing a bispecific antibody or antigen-binding fragment thereof of the invention, comprising culturing a cell comprising a nucleic acid encoding the bispecific antibody or antigen-binding fragment thereof under conditions to produce a bispecific antibody or antigen-binding fragment thereof of the invention, and recovering the bispecific antibody or antigen-binding fragment thereof from the cell or cell culture (e.g., from the supernatant). Expressed antibodies or antigen-binding fragments thereof can be harvested from the cells and purified according to conventional techniques known in the art and as described herein.
Pharmaceutical Compositions
[0183] In another general aspect, the invention relates to a pharmaceutical composition, comprising an isolated bispecific antibody or antigen-binding fragment thereof of the invention and a pharmaceutically acceptable carrier. The term “pharmaceutical composition” as used herein means a product comprising an antibody of the invention together with a pharmaceutically acceptable carrier. Antibodies of the invention and compositions comprising them are also useful in the manufacture of a medicament for therapeutic applications mentioned herein.
[0184] As used herein, the term “carrier” refers to any excipient, diluent, filler, salt, buffer, stabilizer, solubilizer, oil, lipid, lipid containing vesicle, microsphere, liposomal encapsulation, or other material well known in the art for use in pharmaceutical formulations. It will be understood that the characteristics of the carrier, excipient or diluent will depend on the route of administration for a particular application. As used herein, the term “pharmaceutically acceptable carrier” refers to a non-toxic material that does not interfere with the effectiveness of a composition according to the invention or the biological activity of a composition according to the invention. According to particular embodiments, in view of the present disclosure, any pharmaceutically acceptable carrier suitable for use in an antibody pharmaceutical composition can be used in the invention.
[0185] The formulation of pharmaceutically active ingredients with pharmaceutically acceptable carriers is known in the art, e.g., Remington: The Science and Practice of Pharmacy (e.g., 21.sup.st edition (2005), and any later editions). Non-limiting examples of additional ingredients include buffers, diluents, solvents, tonicity regulating agents, preservatives, stabilizers, and chelating agents. One or more pharmaceutically acceptable carriers can be used in formulating the pharmaceutical compositions of the invention.
[0186] In one embodiment of the invention, the pharmaceutical composition is a liquid formulation. A preferred example of a liquid formulation is an aqueous formulation, i.e., a formulation comprising water. The liquid formulation can comprise a solution, a suspension, an emulsion, a microemulsion, a gel, and the like. An aqueous formulation typically comprises at least 50% w/w water, or at least 60%, 70%, 75%, 80%, 85%, 90%, or at least 95% w/w of water.
[0187] In one embodiment, the pharmaceutical composition can be formulated as an injectable which can be injected, for example, via an injection device (e.g., a syringe or an infusion pump). The injection can be delivered subcutaneously, intramuscularly, intraperitoneally, intravitreally, or intravenously, for example.
[0188] In another embodiment, the pharmaceutical composition is a solid formulation, e.g., a freeze-dried or spray-dried composition, which can be used as is, or whereto the physician or the patient adds solvents, and/or diluents prior to use. Solid dosage forms can include tablets, such as compressed tablets, and/or coated tablets, and capsules (e.g., hard or soft gelatin capsules). The pharmaceutical composition can also be in the form of sachets, dragees, powders, granules, lozenges, or powders for reconstitution, for example.
[0189] The dosage forms can be immediate release, in which case they can comprise a water-soluble or dispersible carrier, or they can be delayed release, sustained release, or modified release, in which case they can comprise water-insoluble polymers that regulate the rate of dissolution of the dosage form in the gastrointestinal tract or under the skin.
[0190] In other embodiments, the pharmaceutical composition can be delivered intranasally, intrabuccally, or sublingually.
[0191] The pH in an aqueous formulation can be between pH 3 and pH 10. In one embodiment of the invention, the pH of the formulation is from about 7.0 to about 9.5. In another embodiment of the invention, the pH of the formulation is from about 3.0 to about 7.0.
[0192] In another embodiment of the invention, the pharmaceutical composition comprises a buffer. Non-limiting examples of buffers include: arginine, aspartic acid, bicine, citrate, disodium hydrogen phosphate, fumaric acid, glycine, glycylglycine, histidine, lysine, maleic acid, malic acid, sodium acetate, sodium carbonate, sodium dihydrogen phosphate, sodium phosphate, succinate, tartaric acid, tricine, and tris(hydroxymethyl)-aminomethane, and mixtures thereof. The buffer can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific buffers constitute alternative embodiments of the invention.
[0193] In another embodiment of the invention, the pharmaceutical composition comprises a preservative. Non-limiting examples of preservatives include: benzethonium chloride, benzoic acid, benzyl alcohol, bronopol, butyl 4-hydroxybenzoate, chlorobutanol, chlorocresol, chlorohexidine, chlorphenesin, o-cresol, m-cresol, p-cresol, ethyl 4-hydroxybenzoate, imidurea, methyl 4-hydroxybenzoate, phenol, 2-phenoxyethanol, 2-phenylethanol, propyl 4-hydroxybenzoate, sodium dehydroacetate, thiomerosal, and mixtures thereof. The preservative can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific preservatives constitute alternative embodiments of the invention.
[0194] In another embodiment of the invention, the pharmaceutical composition comprises an isotonic agent. Non-limiting examples of the isotonic agents include a salt (such as sodium chloride), an amino acid (such as glycine, histidine, arginine, lysine, isoleucine, aspartic acid, tryptophan, and threonine), an alditol (such as glycerol, 1,2-propanediol propyleneglycol), 1,3-propanediol, and 1,3-butanediol), polyethylene glycol (e.g. PEG400), and mixtures thereof. Another example of an isotonic agent includes a sugar. Non-limiting examples of sugars may be mono-, di-, or polysaccharides, or water-soluble glucans, including for example fructose, glucose, mannose, sorbose, xylose, maltose, lactose, sucrose, trehalose, dextran, pullulan, dextrin, cyclodextrin, alpha and beta-HPCD, soluble starch, hydroxyethyl starch, and sodium carboxymethylcellulose. Another example of an isotonic agent is a sugar alcohol, wherein the term “sugar alcohol” is defined as a C(4-8) hydrocarbon having at least one —OH group. Non-limiting examples of sugar alcohols include mannitol, sorbitol, inositol, galactitol, dulcitol, xylitol, and arabitol. Pharmaceutical compositions comprising each isotonic agent listed in this paragraph constitute alternative embodiments of the invention. The isotonic agent can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific isotonic agents constitute alternative embodiments of the invention.
[0195] In another embodiment of the invention, the pharmaceutical composition comprises a chelating agent. Non-limiting examples of chelating agents include citric acid, aspartic acid, salts of ethylenediaminetetraacetic acid (EDTA), and mixtures thereof. The chelating agent can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific chelating agents constitute alternative embodiments of the invention.
[0196] In another embodiment of the invention, the pharmaceutical composition comprises a stabilizer. Non-limiting examples of stabilizers include one or more aggregation inhibitors, one or more oxidation inhibitors, one or more surfactants, and/or one or more protease inhibitors.
[0197] In another embodiment of the invention, the pharmaceutical composition comprises a stabilizer, wherein said stabilizer is carboxy-/hydroxycellulose and derivates thereof (such as HPC, HPC-SL, HPC-L and HPMC), cyclodextrins, 2-methylthioethanol, polyethylene glycol (such as PEG 3350), polyvinyl alcohol (PVA), polyvinyl pyrrolidone, salts (such as sodium chloride), sulphur-containing substances such as monothioglycerol), or thioglycolic acid. The stabilizer can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific stabilizers constitute alternative embodiments of the invention.
[0198] In further embodiments of the invention, the pharmaceutical composition comprises one or more surfactants, preferably a surfactant, at least one surfactant, or two different surfactants. The term “surfactant” refers to any molecules or ions that are comprised of a water-soluble (hydrophilic) part, and a fat-soluble (lipophilic) part. The surfactant can, for example, be selected from the group consisting of anionic surfactants, cationic surfactants, nonionic surfactants, and/or zwitterionic surfactants. The surfactant can be present individually or in the aggregate, in a concentration from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific surfactants constitute alternative embodiments of the invention.
[0199] In a further embodiment of the invention, the pharmaceutical composition comprises one or more protease inhibitors, such as, e.g., EDTA, and/or benzamidine hydrochloric acid (HCl). The protease inhibitor can be present individually or in the aggregate, in a concentration from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific protease inhibitors constitute alternative embodiments of the invention.
[0200] In another general aspect, the invention relates to a method of producing a pharmaceutical composition comprising a bispecific antibody or antigen-binding fragment thereof of the invention, comprising combining a bispecific antibody or antigen-binding fragment thereof with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.
Methods of Use
[0201] In another general aspect, the invention relates to a method of targeting FRα and CD47 that are both expressed on a cancer cell surface in a subject in need thereof, the method comprises administering to the subject in need thereof an anti-CD47/anti-FRα bispecific antibody or antigen-binding fragment thereof or a pharmaceutical composition of the invention. Binding of the bispecific antibody or antigen-binding fragment thereof to FRα and/or CD47 can mediate complement-dependent cytotoxicity (CDC), antibody-dependent phagocytosis (ADPC), and/or antibody-dependent cellular cytotoxicity (ADCC) or other effects that result in the death of the targeted cancer cell. The bispecific antibody or antigen-binding fragment thereof can, for example, serve to recruit conjugated drugs to mediate the death of the targeted cancer cell.
[0202] In another general aspect, the invention relates to a method of blocking binding of SIRPα to CD47 on cancer cells that express both FRα and CD47 in a subject in need thereof, the method comprises administering to the subject in need thereof an anti-CD47/anti-FRα bispecific antibody or antigen-binding fragment thereof or a pharmaceutical composition of the invention.
[0203] In another general aspect, the invention relates to a method of inducing macrophage-mediated phagocytosis of cancer cells that express both FRα and CD47 in a subject in need thereof, the method comprises administering to the subject in need thereof an anti-CD47/anti-FRα bispecific antibody or antigen-binding fragment thereof or a pharmaceutical composition of the invention.
[0204] In another general aspect, the invention relates to a method of binding cancer cells that express both FRα and CD47 by a humanized anti-CD47/anti-FRα bispecific antibody or antigen-binding fragment thereof with minimal to undetectable binding to human red blood cells (RBCs) in a subject in need thereof, the method comprises administering to the subject in need thereof an isolated humanized anti-CD47/anti-FRα bispecific antibody or antigen-binding fragment thereof, or a pharmaceutical composition of the invention. The humanized anti-CD47/anti-FRα bispecific antibody or antigen-binding fragment thereof of the invention has high selectivity for cancer cells with minimal to undetectable binding to human red blood cells (RBCs).
[0205] The functional activity of bispecific antibodies and antigen-binding fragments thereof that bind both FRα and CD47 can be characterized by methods known in the art and as described herein. Methods for characterizing bispecific antibodies and antigen-binding fragments thereof that bind both FRα and CD47 include, but are not limited to, affinity and specificity assays including Biacore, ELISA, FACS and OctetRed analysis. According to particular embodiments, the methods for characterizing bispecific antibodies and antigen-binding fragments thereof that bind both FRα and CD47 include those described below.
[0206] In another general aspect, the invention relates to a method of treating a cancer in a subject in need thereof, comprising administering to the subject in need thereof an isolated humanized anti-CD47/anti-FRα bispecific antibody or antigen-binding fragment thereof or a pharmaceutical composition of the invention. The cancer can be any liquid or solid cancer, for example, it can be selected from, but not limited to, a lung cancer, a gastric cancer, an esophageal cancer, a bile duct cancer, a cholangiocarcinoma, a colon cancer, a hepatocellular carcinoma, a renal cell carcinoma, a bladder urothelial carcinoma, a metastatic melanoma, a breast cancer, an ovarian cancer, a cervical cancer, a head and neck cancer, a pancreatic cancer, a glioma, a glioblastoma, and other solid tumors, and a non-Hodgkin's lymphoma (NHL), an acute lymphocytic leukemia (ALL), a chronic lymphocytic leukemia (CLL), a chronic myelogenous leukemia (CML), a multiple myeloma (MM), an acute myeloid leukemia (AML), and other liquid tumors.
[0207] According to embodiments of the invention, the pharmaceutical composition comprises a therapeutically effective amount of an anti-CD47/anti-FRα bispecific antibody or antigen-binding fragment thereof of the invention. As used herein, the term “therapeutically effective amount” refers to an amount of an active ingredient or component that elicits the desired biological or medicinal response in a subject. A therapeutically effective amount can be determined empirically and in a routine manner, in relation to the stated purpose.
[0208] As used herein with reference to anti-CD47/anti-FRα bispecific antibodies or antigen-binding fragments thereof, a therapeutically effective amount means an amount of the anti-CD47/anti-FRα bispecific antibody or antigen-binding fragment thereof that modulates an immune response in a subject in need thereof. Also as used herein with reference to anti-CD47/anti-FRα bispecific antibodies or antigen-binding fragments thereof, a therapeutically effective amount means an amount of the anti-CD47/anti-FRα bispecific antibody or antigen-binding fragment thereof that results in treatment of a disease, disorder, or condition; prevents or slows the progression of the disease, disorder, or condition; or reduces or completely alleviates symptoms associated with the disease, disorder, or condition.
[0209] According to particular embodiments, the disease, disorder or condition to be treated is cancer, preferably a cancer selected from the group consisting of a lung cancer, a gastric cancer, an esophageal cancer, a bile duct cancer, a cholangiocarcinoma, a colon cancer, a hepatocellular carcinoma, a renal cell carcinoma, a bladder urothelial carcinoma, a metastatic melanoma, a breast cancer, an ovarian cancer, a cervical cancer, a head and neck cancer, a pancreatic cancer, a glioma, a glioblastoma, and other solid tumors, and a non-Hodgkin's lymphoma (NHL), an acute lymphocytic leukemia (ALL), a chronic lymphocytic leukemia (CLL), a chronic myelogenous leukemia (CML), a multiple myeloma (MM), an acute myeloid leukemia (AML), and other liquid tumors. According to other particular embodiments, the disease, disorder or condition to be treated is an inflammatory disease, a metabolic disease, or any other disease where a bispecific antibody can be used as a therapy.
[0210] According to particular embodiments, a therapeutically effective amount refers to the amount of therapy which is sufficient to achieve one, two, three, four, or more of the following effects: (i) reduce or ameliorate the severity of the disease, disorder or condition to be treated or a symptom associated therewith; (ii) reduce the duration of the disease, disorder or condition to be treated, or a symptom associated therewith; (iii) prevent the progression of the disease, disorder or condition to be treated, or a symptom associated therewith; (iv) cause regression of the disease, disorder or condition to be treated, or a symptom associated therewith; (v) prevent the development or onset of the disease, disorder or condition to be treated, or a symptom associated therewith; (vi) prevent the recurrence of the disease, disorder or condition to be treated, or a symptom associated therewith; (vii) reduce hospitalization of a subject having the disease, disorder or condition to be treated, or a symptom associated therewith; (viii) reduce hospitalization length of a subject having the disease, disorder or condition to be treated, or a symptom associated therewith; (ix) increase the survival of a subject with the disease, disorder or condition to be treated, or a symptom associated therewith; (xi) inhibit or reduce the disease, disorder or condition to be treated, or a symptom associated therewith in a subject; and/or (xii) enhance or improve the prophylactic or therapeutic effect(s) of another therapy.
[0211] The therapeutically effective amount or dosage can vary according to various factors, such as the disease, disorder or condition to be treated, the means of administration, the target site, the physiological state of the subject (including, e.g., age, body weight, health), whether the subject is a human or an animal, other medications administered, and whether the treatment is prophylactic or therapeutic. Treatment dosages are optimally titrated to optimize safety and efficacy.
[0212] According to particular embodiments, the compositions described herein are formulated to be suitable for the intended route of administration to a subject. For example, the compositions described herein can be formulated to be suitable for intravenous, subcutaneous, or intramuscular administration.
[0213] As used herein, the terms “treat,” “treating,” and “treatment” are all intended to refer to an amelioration or reversal of at least one measurable physical parameter related to a cancer, which is not necessarily discernible in the subject, but can be discernible in the subject. The terms “treat,” “treating,” and “treatment,” can also refer to causing regression, preventing the progression, or at least slowing down the progression of the disease, disorder, or condition. In a particular embodiment, “treat,” “treating,” and “treatment” refer to an alleviation, prevention of the development or onset, or reduction in the duration of one or more symptoms associated with the disease, disorder, or condition, such as a tumor or more preferably a cancer. In a particular embodiment, “treat,” “treating,” and “treatment” refer to prevention of the recurrence of the disease, disorder, or condition. In a particular embodiment, “treat,” “treating,” and “treatment” refer to an increase in the survival of a subject having the disease, disorder, or condition. In a particular embodiment, “treat,” “treating,” and “treatment” refer to elimination of the disease, disorder, or condition in the subject.
[0214] According to particular embodiments, provided is a composition used in the treatment of a cancer. For cancer therapy, the composition can be used in combination with another treatment including, but not limited to, a chemotherapy, an anti-TIM-3 mAb, an anti-LAG-3 mAb, an anti-CD73 mAb, an anti-apelin mAb, an anti-CTLA-4 antibody, an anti-EGFR mAb, an anti-HER-2 mAb, an anti-CD19 mAb, an anti-CD20 mAb, an anti-CD33 mAb, an anti-TIP-1 mAb, an anti-DLL3 mAb, an anti-CLDN18.2 mAb, an anti-PD-L1 antibody, an anti-PD-1 antibody, a PD-1/PD-L1 therapy, other immuno-oncology drugs, an antiangiogenic agent, a radiation therapy, an antibody-drug conjugate (ADC), a targeted therapy, or other anticancer drugs.
[0215] As used herein, the term “in combination,” in the context of the administration of two or more therapies to a subject, refers to the use of more than one therapy. The use of the term “in combination” does not restrict the order in which therapies are administered to a subject. For example, a first therapy (e.g., a composition described herein) can be administered prior to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 16 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks before), concomitantly with, or subsequent to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 16 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after) the administration of a second therapy to a subject.
EMBODIMENTS
[0216] The invention provides also the following non-limiting embodiments.
[0217] Embodiment 1 is an isolated bispecific antibody or antigen-binding fragment thereof comprising: [0218] a. a first heavy chain, H1; [0219] b. a second heavy chain, H2; [0220] c. a first light chain, L1; and [0221] d. a second light chain, L2;
wherein H1 and L1 form a first arm comprising a first antigen-binding domain that specifically binds a first antigen, preferably a first antigen of human origin, and
wherein H2 and L2 form a second arm comprising a second antigen-binding domain that specifically binds a second antigen, preferably a second antigen of human origin, wherein [0222] (a) H1 comprises a CH1 region of human IgG1, IgG2, IgG3, or IgG4; and [0223] (b) L1 comprises a CL region of a human kappa light chain or a human lambda light chain;
wherein the CH1 and CL regions comprise amino acid substitutions or a native amino acid at an amino acid residue corresponding to the amino acid position of SEQ ID NO:15, 21, 22, or 23 for CH1 and SEQ ID NO:19 or 24 for CL;
wherein the amino acid substitutions or the native amino acid in the CH1 and CL regions are selected from:
[0224] (1) K133C and C220X in CH1, and F209C and C214X in CL;
[0225] (2) S131C and C220X in CH1, and P119C and C214X in CL;
[0226] (3) K133C and C220X in CH1, and K207C and C214X in CL;
[0227] (4) F170C and C220X in CH1, and S176C and C214X in CL;
[0228] (5) P171C and C220X in CH1, and S162C and C214X in CL;
[0229] (6) V173C and C220X in CH1, and Q160C and C214X in CL;
[0230] (7) F170C and C131X in CH1, and S176C and C214X in CL;
[0231] (8) P171C and C131X in CH1, and S162C and C214X in CL;
[0232] (9) V173C and C131X in CH1, and Q160C and C214X in CL;
[0233] (10) A129C and C220X in CH1, and S121C and C214X in CL;
[0234] (11) K133C and C220X in CH1, and 1117C and C214X in CL;
[0235] (12) C131 in CH1, and P119C and C214X in CL;
[0236] (13) A129C and C131X in CH1, and S121C and C214X in CL;
[0237] (14) R133C and C131X in CH1, and K207C and C214X in CL;
[0238] (15) R133C and C131X in CH1, and 1117C and C214X in CL;
[0239] (16) R133C and C131X in CH1, and L117C and C214X in CL;
[0240] (17) K133C and C220X in CH1, and L117C and C214X in CL;
[0241] (18) R133C and C131X in CH1, and F209C and C214X in CL;
[0242] (19) R133C and C131X in CH1, and V209C and C214X in CL; or
[0243] (20) K133C and C220X in CH1, and V209C and C214X in CL; [0244] wherein X is selected from S, A, or G.
[0245] Embodiment 2 is an isolated bispecific antibody or antigen-binding fragment thereof comprising: [0246] a. a first heavy chain, H1 ; [0247] b. a second heavy chain, H2; [0248] c. a first light chain, L1; and [0249] d. a second light chain, L2;
wherein H1 and L1 form a first arm comprising a first antigen-binding domain that specifically binds a first antigen, preferably a first antigen of human origin, and
wherein H2 and L2 form a second arm comprising a second antigen-binding domain that specifically binds a second antigen, preferably a second antigen of human origin, wherein [0250] (a) H1 comprises a CH1 region of human IgG1, IgG2, IgG3, or IgG4 and a heavy chain variable region (VH region); and [0251] (b) L1 comprises a CL region of a human kappa light chain or a human lambda light chain and a light chain variable region (VL region);
wherein the CH1 region, the VH region, the CL region, and the VL region comprise amino acid substitutions at an amino acid residue corresponding to the amino acid position of SEQ ID NO: 15, 21, 22, or 23 for CH1; SEQ ID NO: 13 for VH; SEQ ID NO: 19 or 24 for CL; and SEQ ID NO: 17 for VL;
wherein the amino acid substitutions in the CH1 region, the VH region, the CL region, and the VL region are selected from:
[0252] (1) C220X in CH1, G44C in VH, C214X in CL, and G101C in VL; or
[0253] (2) C131X in CH1, G44C in VH, C214X in CL, and G101C in VL; [0254] wherein X is selected from S, A, or G.
[0255] Embodiment 3 is the isolated bispecific antibody or antigen-binding fragment thereof of embodiments 1 or 2, wherein the first antigen-binding domain is a CD47 binding domain.
[0256] Embodiment 4 is the isolated bispecific antibody or antigen-binding fragment thereof of embodiment 3, wherein the VH region comprises an amino acid sequence of SEQ ID NO: 1, the CH1 region comprises an amino acid sequence of SEQ ID NO: 2, the VL region comprises an amino acid sequence of SEQ ID NO: 3, and the CL region comprises an amino acid sequence of SEQ ID NO: 4.
[0257] Embodiment 5 is the isolated bispecific antibody or antigen-binding fragment thereof of any one of embodiments 1 to 4, wherein [0258] (a) the second arm comprising H2 and L2 does not comprise the amino acid substitutions of the first arm comprising H1 and L1; [0259] (b) the two heavy chains H1 and H2 each comprise a VH region, a CH1 region, and a Fc region (containing CH2 and CH3 regions), wherein the VH regions have different amino acid sequences; [0260] (c) the two heavy chains H1 and H2 each comprise a VH region, a CH1 region, and a Fc region (containing CH2 and CH3 regions), wherein the CH1 regions have different amino acid sequences; [0261] (d) the two heavy chains H1 and H2 each comprise a VH region, a CH1 region, and a Fc region (containing CH2 and CH3 regions), wherein the Fc regions have different amino acid sequences; [0262] (e) the two light chains L1 and L2 each comprise a VL region and a CL region, wherein the VL regions have different amino acid sequences; and/or [0263] (f) the two light chains L1 and L2 each comprise a VL region and a CL region, wherein the CL regions have different amino acid sequences.
[0264] Embodiment 6 is the isolated bispecific antibody or antigen-binding fragment thereof of embodiment 5, wherein H1 and H2 form a heterodimer.
[0265] Embodiment 7 is the isolated bispecific antibody or antigen-binding fragment thereof of any one of claims 1 to 6, wherein [0266] (a) the VH region of H1 and the VL region of L1 have a Q39E and a Q38K substitution mutation, respectively, and the VH region of H2 and the VL region of L2 have a Q39K and a Q38E substitution mutation, respectively; or [0267] (b) the VH region of H1 and the VL region of L1 have a Q39K and a Q38E substitution mutation, respectively, and the VH region of H2 and the VL region of L2 have a Q39E and a Q38K substitution mutation, respectively.
[0268] Embodiment 8 is the isolated bispecific antibody or antigen-binding fragment thereof of any one of embodiments 1 to 7, wherein the isolated bispecific antibody or antigen-binding fragment is an anti-CD47/anti-FRα bispecific antibody or antigen-binding fragment thereof, wherein the first antigen-binding domain specifically binds CD47, preferably human CD47, and the second antigen-binding domain specifically binds folate receptor a (FRα), preferably human FRα.
[0269] Embodiment 9 is the isolated bispecific antibody or antigen-binding fragment thereof of any one of claims 1 to 8, wherein [0270] (a) the first antigen-binding domain has the VH sequence of SEQ ID: 13 and VL sequence of SEQ ID: 17, and the second antigen-binding domain has the VH sequence of SEQ ID: 33 and VL sequence of SEQ ID: 35; or [0271] (b) the first antigen-binding domain has the VH sequence of SEQ ID: 13 and VL sequence of SEQ ID: 17, and the second antigen-binding domain has the VH sequence of SEQ ID: 14 and VL sequence of SEQ ID: 18.
[0272] Embodiment 10 is the isolated bispecific antibody or antigen-binding fragment thereof of embodiments 8 or 9, wherein the anti-CD47/anti-FRα bispecific antibody or antigen-binding fragment thereof is capable of blocking binding of signal regulatory protein alpha (SIRPα) to CD47 on cancer cells that express both FRα and CD47, inducing macrophage-mediated phagocytosis of cancer cells that express both FRα and CD47, and/or binding cancer cells that express both FRα and CD47 with minimal to undetectable binding to human red blood cells (RBCs) .
[0273] Embodiment 11 is an isolated nucleic acid encoding the bispecific antibody or antigen-binding fragment of any one of embodiments 1 to 10.
[0274] Embodiment 12 is a vector comprising the isolated nucleic acid of embodiment 11.
[0275] Embodiment 13 is a host cell comprising the vector of embodiment 12.
[0276] Embodiment 14 is a pharmaceutical composition, comprising the isolated bispecific antibody or antigen-binding fragment thereof of any one of embodiments 1 to 10 and a pharmaceutically acceptable carrier.
[0277] Embodiment 15 is a method of targeting FRα and CD47 that are both expressed on a cancer cell surface in a subject in need thereof, blocking the binding of SIRPα to CD47 on cancer cells that express both FRα and CD47 in a subject in need thereof, inducing macrophage-mediated phagocytosis of cancer cells that express both FRα and CD47 in a subject in need thereof, binding cancer cells that express both FRα and CD47 with minimal to undetectable binding to human red blood cells (RBCs) in a subject in need thereof, and/or treating cancer in a subject in need thereof, comprising administering to the subject a pharmaceutical composition comprising the isolated anti-CD47/anti-FRα bispecific antibody or antigen-binding fragment thereof of any one of embodiments 8 to 10 and a pharmaceutically acceptable carrier, optionally, the cancer is selected from the group consisting of a lung cancer, a gastric cancer, an esophageal cancer, a bile duct cancer, a cholangiocarcinoma, a colon cancer, a hepatocellular carcinoma, a renal cell carcinoma, a bladder urothelial carcinoma, a metastatic melanoma, a breast cancer, an ovarian cancer, a cervical cancer, a head and neck cancer, a pancreatic cancer, a glioma, a glioblastoma, and other solid tumors, and a non-Hodgkin's lymphoma (NHL), an acute lymphocytic leukemia (ALL), a chronic lymphocytic leukemia (CLL), a chronic myelogenous leukemia (CML), a multiple myeloma (MM), an acute myeloid leukemia (AML), and other liquid tumors.
[0278] Embodiment 16 is a method of producing the bispecific antibody or antigen-binding fragment thereof of any one of embodiments 1 to 10, comprising culturing a cell comprising a nucleic acid encoding the bispecific antibody or antigen-binding fragment thereof under conditions to produce the bispecific antibody or antigen-binding fragment thereof, and recovering the bispecific antibody or antigen-binding fragment thereof from the cell or culture.
[0279] Embodiment 17 is a method of producing a pharmaceutical composition comprising the bispecific antibody or antigen-binding fragment thereof of any one of embodiments 1 to 10, comprising combining the bispecific antibody or antigen-binding fragment thereof with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.
EXAMPLES
Example 1: Construction of Bispecific Antibodies with Altered Cysteine Sites
[0280]
[0281] A humanized anti-CD47 mAb (described in International Pat. Pub. No. WO2019/217145; referred to as mAb 1 here) and two humanized anti-FRα mAbs (described in International Pat. Pub. No. WO2019/177854; referred to as mAb 2 and mAb 2b, respectively, here) were used to construct anti-CD47/anti-FRα bispecific antibodies.
[0282] The VH, CH1, VL, and CL sequences of mAb 1 and mAb 2, and the IgG2 CH1, IgG3 CH1, IgG4 CH1 and lambda CL sequences are listed in
[0283] To assess the impact of the various pairs of shifted interchain disulfide bonds listed in Table 2 on the stability of a mAb, some of the groups of mutations (or namely designs) in Table 2 were introduced into mAb 1 on both arms. M1, M2, Z1 and Z2 which represent mutant designs from the patent literature (U.S. Pat. Nos. 9,527,927 B2 and 10,344,099 B2) were also introduced into mAb 1 on both arms for comparison. The mutant mAbs were expressed and purified using Protein A chromatography and hydrophobic interaction chromatography (HIC). Protein A chromatography was carried out using conventional methods. For HIC, protein A purified samples were buffer exchanged into PBS, and (NH.sub.4).sub.2SO.sub.4 was added to a final concentration of 800 mM. Samples were loaded onto a prepacked Source 15 PHE column (GE) pre-equilibrated with 50 mM MES pH6.0 and 1 M (NH.sub.4).sub.2SO.sub.4 buffer. Samples were eluted using a linear or stepwise gradient (Buffer A: 50 mM MES pH6.0, 1M (NH.sub.4).sub.2SO.sub.4; Buffer B: 50 mM MES pH6.0, 10% glycerol) with the main fraction eluting at 60% buffer B. Eluted fractions were analyzed by SDS-PAGE, and fractions containing primarily a 145 kDa band without lower molecular weight impurities were pooled as purified protein.
[0284] The purified mutant mAbs were analyzed for their thermostability. The mutant mAbs were buffer exchanged into DPBS (Corning, Cat: 21-031-CM) at 1 mg/mL and incubated at 55° C., 60° C., 65° C., 70° C. or 75° C. for 5 minutes on Thermo Cycler (Simpliamp, Thermo Fisher). After incubation, the mAbs were analyzed by SEC (size-exclusion chromatography). Each peak was quantified to determine the percentage of the antibody (medium molecular weight species). The results are shown in
[0285] The mutant mAbs were also tested for their pH stability or recovery from low pH incubation. The mAbs at 10 mg/mL were buffer exchanged into a buffer (pH3.0) containing 0.1 M citric acid and 0.1 M sodium chloride using Zeba™ Spin Desalting Columns (Thermo Fisher, Cat: 89882). The mAbs were diluted in the same buffer into 2 mg/mL and incubated for 1 hour, 3 hours, 5 hours, or 7 hours at room temperature, and then neutralized by adding 1.0 M Tris-HCl (pH9.0) to adjust the samples to a final pH of 6.0-7.0. After neutralization, the mAbs were diluted into DPBS to 1 mg/mL for SEC analysis. The results are shown in
TABLE-US-00001 TABLE 1 Sequences of various regions in mAb 1; mAb 2; human IgG2, IgG3 and IgG4 heavy chain (HC); and human lambda CL Name Sequence SEQ ID NO: VH for mAb 1 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWMHWVRQAPGQG 13 LEWIGNIDPSDSETHYAQKFQGRVTLTVDKSTSTVYMELSSLRSEDT AVYYCAGTDLAYWGQGTLVTVSS VH for mAb 2 EVQLVETGGGLIQPGGSLRLSCAASGFTFSDFGMHWIRQAPGKGLE 14 WVAYMSYTPGTFHYADTVKDRFTISRDNSKNTLYLQMNSLRAEDT AVYYCARVHVGTVDYWGQGTLVTVSS CH1 for mAb 1 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALT 15 SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKV DKKVEPKSC CH1 for mAb 2 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALT 16 SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKV DKKVEPKSC VL for mAb 1 EIVLTQSPGTLSLSPGERATLSCHASQNINVWLSWYQQKPGQAPRLLI 17 YKASNLHTGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQGQSYPF TFGQGTKVEIK VL for mAb 2 EVVLTQSPATLSLSPGERATLSCRASQNINNNLHWFQQKPGQAPRLL 18 IKYASQSISGIPARFSGSGSGTDFTLTISSLEPEDFAVYFCQQSNSWPA LTFGQGTKVEIK CL for mAb 1 RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNA 19 LQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQ GLSSPVTKSFNRGEC CL for mAb 2 RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNA 20 LQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQ GLSSPVTKSFNRGEC IgG2 CH1 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTS 21 GVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVD KTVERKCC IgG3 CH1 ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALT 22 SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKV DKRVELKTPLG IgG4 CH1 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTS 23 GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVD KRVESKYG lambda CL QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSP 24 VKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGS TVEKTVAPTEC VH for mAb 2b EVQLVQSGAEVKKPGSSVKVSCKASGYAFSSSWMNWVRQAPGQGL 33 EWIGRIYPGDGYTHYNGMFKGRASLTADKSTSTGYMELSSLRSEDT AVFFCTRHGDFPYWYFDVWGRGTLVTVSS CH1 for mAb ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALT 34 2b SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKV DKKVEPKSC VL for mAb 2b DIQMTQSPSTLSASVGDRVTITCRASENIDSYLAWYQQKPGRAPKLL 35 VYAATNLAVGVPSRFSGSGSGTEYTLTISSLQPDDFATYYCQHHYST PPTFGQGTKLEIK CL for mAb 2b RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNA 36 LQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQ GLSSPVTKSFNRGEC
TABLE-US-00002 TABLE 2 Amino acid substitutions on the mAb 1 arm of the mAb 1/mAb 2 bispecific antibody (bsAb) for shifted interchain disulfide bond VH CH1 VL CL bsAb 1 G44C C220S G101C C214S bsAb 2 H58C C220S Y94C C214S bsAb 3 A60C C220S P95C C214S bsAb 4 W103C C220S P44C C214S bsAb 5 S131C; C220S P119C; C214S bsAb 6 F170C; C220S S176C; C214S bsAb 7 P171C; C220S S162C; C214S bsAb 8 V173C; C220S Q160C; C214S bsAb 9 A129C; C220S S121C; C214S bsAb 10 K133C; C220S K207C; C214S bsAb 11 K133C; C220S I117C; C214S bsAb 12 K133C; C220S F209C; C214S M1 F126C; C220S S121C; C214S M2 A141C; C220S F116C; C214S Z1 F126C; C220S Q124C; C214S Z2 F170C; C220S S162C; C214S Note: Kabat numbering is used for the VH and VL regions; EU numbering is used for the CH1 and CL regions.
[0286] The bispecific antibodies in the examples are on the IgG1 HC and kappa LC framework (Kabat numbering for the VH and VL regions; EU numbering for the CH1 and CL regions). Some bispecific antibodies were constructed using mAb 1 and mAb 2, including bsAb 1, bsAb 2, bsAb 3, bsAb 4, bsAb 5, bsAb 6, bs Ab 7, and bsAb 8 (bsAb 1 refers to the bispecific antibody with the mAb 1 arm containing the corresponding mutations in Table 2 that is expected to result in the relocation (or “shifting”) of the HC/LC interchain disulfide bond, and with mAb 2 as the second arm; the other bispecific antibodies in this group follow the same naming rule). No mutation on the VH, CH1, VL or CL region of the mAb 2 arm was introduced. Mutation G44C refers to the conversion of the native glycine at residue 44 (G44) to cysteine; all the other mutations adopt the same naming rule. Other bispecific antibodies were constructed using mAb 1 and mAb 2b, including bsAb 5b, bsAb 10, and bsAb 12 (bsAb 5b refers to the bispecific antibody with the mAb 1 arm containing the corresponding bsAb 5 mutations in Table 2 and with mAb 2b as the second arm; bsAb 10 refers to the bispecific antibody with the mAb 1 arm containing the corresponding bsAb 10 mutations in Table 2 and with mAb 2b as the second arm; bsAb 12 refers to the bispecific antibody with the mAb 1 arm containing the corresponding bsAb 12 mutations in Table 2 and with mAb 2b as the second arm). Sequences of the CH1, CL, VH and VL regions of the mAb 1 arm of the bispecific antibodies are listed in Table 3. In addition, charged amino acid pairs were introduced at Q39 (Kabat numbering) on HC and Q38 (Kabat numbering) on LC of each arm of a given bispecific antibody. These bispecific antibodies were named as follows: bsAb 5b (E/K) refers to the bispecific antibody with Q39E (Q is changed to E; the same naming rule applies to the other mutations below) on the HC and Q38K on the LC of the mAb 1 arm and Q39K on the HC and Q38E on the LC of the mAb 2b arm of bsAb 5b; bsAb 10 (E/K) and bsAb 12 (E/K) follow the same naming rule. Further, bsAb 5b (K/E) refers to the bispecific antibody with Q39K on the HC and Q38E on the LC of the mAb 1 arm and Q39E on the HC and Q38K on the LC of the mAb 2b arm of bsAb 5b; bsAb 10 (K/E) and bsAb 12 (K/E) follow the same naming rule. The mAb 1 HC has the T366W (EU numbering) mutation to form a “knob” and the mAb 2 or mAb 2b HC has the mutations T366S, L368A, and Y407V to form a “hole.” In addition, a S354C cysteine mutation was introduced on mAb 1 HC and a Y349C cysteine mutation was introduced on mAb 2 or mAb 2b HC to stabilize the heterodimeric pairing.
TABLE-US-00003 TABLE 3 Sequences of the CH1, CL, VH and VL regions of the mAb 1 arm of the bispecific antibodies Clone name Sequence SEQ ID NO: bsAb 1 VH QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWMHWVRQAPGQCL 1 EWIGNIDPSDSETHYAQKFQGRVTLTVDKSTSTVYMELSSLRSEDTAV YYCAGTDLAYWGQGTLVTVSS bsAb 1 CH1 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS 2 GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSS bsAb 1 VL EIVLTQSPGTLSLSPGERATLSCHASQNINVWLSWYQQKPGQAPRLLI 3 YKASNLHTGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQGQSYPFT FGQCTKVEIK bsAb 1 CL RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL 4 QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL SSPVTKSFNRGES bsAb 5 or 5b ASTKGPSVFPLAPCSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS 5 CH1 GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSS bsAb 5 or 5b CL RTVAAPSVFIFCPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL 6 QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL SSPVTKSFNRGES bsAb 6 CH1 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS 7 GVHTCPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSS bsAb 6 CL RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL 8 QSGNSQESVTEQDSKDSTYSLCSTLTLSKADYEKHKVYACEVTHQGL SSPVTKSFNRGES bsAb 7 CH1 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS 9 GVHTFCAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSS bsAb 7 CL RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL 10 QSGNSQECVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL SSPVTKSFNRGES bsAb 8 CH1 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS 11 GVHTFPACLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSS bsAb 8 CL RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL 12 QSGNSCESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL SSPVTKSFNRGES bsAb 9 CH1 ASTKGPSVFPLCPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS 25 GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSS bsAb 9 CL RTVAAPSVFIFPPCDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL 26 QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL SSPVTKSFNRGES bsAb 10 CH1 ASTKGPSVFPLAPSSCSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS 27 GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSS bsAb 10 CL RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL 28 QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL SSPVTCSFNRGES bsAb 11 CH1 ASTKGPSVFPLAPSSCSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS 29 GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSS bsAb 11 CL RTVAAPSVFCFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL 30 QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL SSPVTKSFNRGES bsAb 12 CH1 ASTKGPSVFPLAPSSCSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS 31 GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSS bsAb 12 CL RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL 32 QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL SSPVTKSCNRGES Note: The residues resulting from amino acid substitutions are in bold and underlined form.
Example 2: Characterization of Bispecific Antibodies
[0287] The simultaneous expression of the two heavy chains and the two light chains in the same cell led to the expression and assembly of a desired bispecific antibody, which contains the anti-CD47 arm and the anti-FRα arm. The bispecific antibodies were purified using protein A chromatography. Some samples were further purified using hydrophobic interaction chromatography (HIC).
[0288] The Protein A purified bispecific antibodies were analyzed with SDS-PAGE. Protein samples were diluted to a concentration of 1 mg/mL. For non-reducing lanes, 3 μL protein was added to 4.5 μL water and 2.5 μL 4×LDS sample buffer (Thermo NP0007; Waltham, Mass.) and loaded onto the gel directly. For reducing lanes, 3 μL protein was added to 3.5 μL water, 2.5 μL 4×LDS sample buffer, and 1 μL 1 μL 1M DTT and heated at 95° C. for 3 min and loaded onto the gel. Bolt 4-12% bis-tris gels were used for all samples (Thermo NP0323BOX). Samples were electrophoresed for 30 min at 180 V and visualized with Coomassie G-250.
[0289] To assess the binding activities of the bispecific samples in a bridging ELISA assay, recombinant folate receptor 1 (Novoprotein C784; Summit, N.J.) was diluted to a concentration of 0.25 μg/ml in PBS and used to coat a 96-well plate (Genesee Scientific 91-415F; San Diego, Calif.). 50 μL of antigen were added per well and coated overnight at 4° C. Plates were blocked with 5% BSA in TBST and washed with TBST. 50 μL of antibody in 5% BSA in TBST were added at the indicated concentrations, incubated at room temperature, and washed with TBST. Secondary recombinant biotinylated CD47 antigen (AcroBio CD47-H82E9-258g; Newark, Del.) diluted to a concentration of 0.05 μg/mL in 5% BSA in TBST was added to each well, incubated at room temperature, and washed with TBST. Streptavidin HRP (JIR 016-030-084) diluted to a concentration of 0.2 or 0.5 μg/mL in 5% BSA in TBST was added to each well, incubated at room temperature, and washed. Plates were developed with TMB substrate (Thermo 34028) and quenched with stop solution (Thermo SS04), and wells were quantified by absorbance at 450 nm.
[0290] To determine the purity of the samples purified by Protein A chromatography or Protein A chromatography followed by HIC, size exclusion chromatography (SEC) was used. Protein samples were diluted to a concentration of 1 mg/mL and submicron filtered. 5 μL of protein was injected onto an AdvanceBio SEC column (300 mm, 2.7 um, 300 A, Agilent PL1580-5301). DPBS was used as the mobile phase and was flowed at 0.35 mL/min. Bio-rad gel filtration standards were used as the standard (Bio-rad 1511901; Hercules, Calif.). Samples were quantified by measuring absorbance at 280 nm.
[0291] The purity of the HIC purified bispecific antibody samples were further analyzed using reversed-phase high-performance liquid chromatography (RP-HPLC) under non-reducing condition.
[0292] The same HIC purified bispecific antibody samples were analyzed for their ability to bind both antigens using bridging ELISA. Consistent with the analytical data above, all the bispecific antibodies were shown to be able to bind to both CD47 and FRα simultaneously, suggesting that each arm of the bispecific antibodies was properly formed with the right HC and LC (
[0293] The HIC purified bispecific antibody samples were subjected to papain digestion under non-reducing condition to determine if the expected Fab fragments were generated from the bispecific antibodies. Samples were concentrated to a final concentration of 5-10 mg/mL and buffer exchanged into papain digestion buffer (20 mM cysteine, 20 mM sodium phosphate, 10 mM EDTA, pH 7.0). Agarose immobilized papain (Thermo 20341) was pre-equilibrated in papain digestion buffer and resuspended as a 50% slurry. Protein samples were added to the slurry at a 2:1 volume ratio and shaken overnight at room temperature. Supernatant was extracted and analyzed by mass spectrometry directly. The calculated molecular weight (mw) of each Fab fragment was shown along with its observed mw (
[0294] The HIC purified bispecific antibody samples were also subjected to trypsin digestion under non-reducing condition to determine if calculated tryptic digest peptide fragments from the mAb 1 arms of the intended bispecific antibodies were generated. Samples were diluted to a final concentration of 1 mg/mL in 200 mM guanidine HCl and heated at 95° C. for 1 minute. 2×trypsin digestion buffer was added at a 1:1 volume ratio (NEB P8101S) and 2 μg total trypsin ultra (NEB P8101S) was added. The resulting reaction was shaken at 37° C. for 4 hours and used directly for analysis by mass spectrometry. The amino acid sequences and the sites for disulfide linkage of a disulfide crosslinked peptide fragment that was expected to be produced from the tryptic digestion of the mAb 1 arm (the anti-CD47 arm) of bsAb 6 are shown in
[0295] The HIC purified bispecific antibody samples were also subjected to IdeZ protease digestion under non-reducing condition to determine if the calculated (Fab′)2 parts from the intended bispecific antibodies were generated. Samples were diluted to a final concentration of 0.5 mg/mL in 1×glycobuffer 2 (NEB). IdeZ protease was added at a ratio of 80 U protease per 12.5 μg antibody. The resulting mixture was incubated at 37° C. for 4 hours and used directly for analysis by mass spectrometry.
[0296] To demonstrate the contribution of both arms of the bispecific antibodies in binding to SK-OV-3 cells, which are known to express both antigens, the inhibition of antibody binding to the cells by F(ab′)2 generated from the anti-CD47 or the anti-FRα parental mAb was assessed in a FACS assay. Ab (antibody) concentrations used in the assay are indicated below each graph in
[0297] The Protein A purified bispecific antibodies were digested with papain and the Fab fragments generated from the digestion were identified on MS (
TABLE-US-00004 TABLE 4 Optimization of the purification process for bsAb 12 Steps Procedure 1 Expression in CHO cells: Two 250 mL transiently transfected ExpiCHO cultures. Cultured for 10 days with one feed. 2 Protein A purification: 20 mL MabSelect PrismA in HiScale 16/40. Bind at 15 mL/min, wash at 15 mL/min with 200 mL PBS and elute at 5 mL/min with 50 mM NaCl in 50 mM citrate (pH 3.7). 3 Viral inactivation: Hold in the elution buffer for 1 hour. 4 Neutralization: Add 1M trisodium citrate (pH 6.5) slowly until pH 6.0. 5 AEX flowthrough: Poros GoPure XQ 5 mL, Flowthrough at 1.5 mL/min. Wash with 25 mM citrate (pH 6.0). Collect all flowthrough and wash fractions. 6 HIC bind and elute: 50 mL HP butyl resin (Cytiva 17543202) in HiScale 16/40. Buffer A: 1M (NH.sub.4).sub.2SO.sub.4, 50 mM Tris (pH 7.5). Buffer B: 50 mM Tris (pH 7.5). Step wash at 3 mL/min with 450 mL 36% buffer B. Elute with a linear gradient of 43%-50% buffer B over 100 mL. Collect all eluted fractions. The final yield was 77 mg. The purity was 98% by both HIC and SEC-HPLC.
TABLE-US-00005 TABLE 5 Amino acid residues in the CH1 and CL regions for the formation of charged pairs Name CH1 CL bsAb 5 CP S131 P119 bsAb 9 CP A129 S121 bsAb 10 CP K133 K207 bsAb 11 CP K133 I117 bsAb 12 CP K133 F209 CP9 G166 S114 CP10 T187 D170 Note: EU numbering is used for the CH1 and CL regions. CP, charged pair.
[0298] To further facilitate the HC and LC pairing on each arm of a given bispecific antibody and/or enhance the feasibility of purification using the conventional manufacturing process, amino acid mutations are introduced at a pair of residues on the CH1 and CL regions, respectively, to form a charged pair. Each charged pair or any combination of more than one charged pair can be used to construct bispecific antibodies because they increase correct pairing of HC and LC and/or facilitate purification by introducing differential physical properties when compared with impurities (i.e., mismatched molecular species). Any charged pair or any combination of the charged pairs in Table 5 can be combined with other charged pairs (either known in the literature or newly designed) to achieve and/or enhance correct HC/LC pairing and/or facilitate purification by introducing differential physical properties when compared with impurities (i.e., mismatched molecular species). One of the two residues for the formation of charged pairs can be substituted with glutamate (E) and the other can be substituted with lysine (K), or vice versa. For example, on a given bispecific antibody consisting H1L1 and H2L2, if “E” is introduced on H1 and “K” is introduced on L1, then “K” is introduced on H2 and “E” is introduced on L2. The two residues for the formation of charged pairs can be replaced with acidic and basic amino acids, respectively, other than “E” and “K”. For example, the residue where “E” is introduced can also be substituted with aspartate (D) if “E” is not used. Whenever the native amino acid at a given residue happens to be the intended substitution amino acid (i.e., E, D, or K), no mutation is needed. The amino acid residues in CH1 and CL regions for the formation of charged pairs are listed in Table 5. Each pair of these residues is selected through 3-D modeling based on a variety of factors including proximity.
[0299] It will be appreciated by those skilled in the art that changes could be made to the embodiments described above without departing from the broad inventive concept thereof. It is understood, therefore, that this invention is not limited to the particular embodiments disclosed, but it is intended to cover modifications within the spirit and scope of the present invention as defined by the present description.