Lassa vaccine
11976305 ยท 2024-05-07
Assignee
Inventors
Cpc classification
C12N2760/18452
CHEMISTRY; METALLURGY
C12N2760/10034
CHEMISTRY; METALLURGY
C12N7/00
CHEMISTRY; METALLURGY
C12N2760/18443
CHEMISTRY; METALLURGY
C12N2760/10052
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
C12N2760/10043
CHEMISTRY; METALLURGY
C12N2760/18434
CHEMISTRY; METALLURGY
International classification
A61K39/00
HUMAN NECESSITIES
C12N15/86
CHEMISTRY; METALLURGY
C12N7/00
CHEMISTRY; METALLURGY
Abstract
The invention relates to recombinant measles virus expressing Lassa virus polypeptides, and concerns in particular immunogenic LASV particles expressed by a measles virus and/or virus like particles (VLPs) that contain proteins of a Lassa virus. These particles are recombinant infectious particles able to replicate in a host after an administration. The invention provides means, in particular nucleic acid constructs, vectors, cells and rescue systems to produce these recombinant infectious particles. The invention also relates to the use of these recombinant infectious particles, in particular under the form of a composition, more particularly in a vaccine formulation, for the treatment or prevention of an infection by Lassa virus.
Claims
1. A nucleic acid construct which comprises: a cDNA molecule encoding a full length antigenomic (+) RNA strand of a measles virus (MeV); and a first heterologous polynucleotide comprising at least one of SEQ ID NO: 2, SEQ ID NO: 4, and SEQ ID NO: 6, wherein the first heterologous polynucleotide is operatively cloned within an additional transcription unit (ATU) inserted within the cDNA of the antigenomic (+) RNA.
2. The nucleic acid construct according to claim 1, further comprising a second heterologous polynucleotide encoding at least one polypeptide, or an antigenic fragment thereof, of Lassa virus (LASV), said at least one polypeptide being selected from the group consisting of GPC protein, NP protein, and mNP protein, the second heterologous polynucleotide being operatively cloned within another ATU at a location distinct from the location of the first heterologous polynucleotide.
3. The nucleic acid construct according to claim 1, wherein the first heterologous polynucleotide comprises SEQ ID NO: 2.
4. The nucleic acid construct according to claim 2, wherein the first and/or second heterologous polynucleotide(s) encode(s) the mNP protein, or an antigenic fragment thereof, wherein the mNP protein has a mutated exonuclease domain, wherein the amino acid sequence of the encoded mNP protein is mutated on amino acid residue 389 and/or 392, by substitution on amino acid residues 389 and 392, of SEQ ID NO: 3.
5. The nucleic acid construct according to claim 2, wherein the first and second heterologous polynucleotides are cloned into an ATU selected from additional transcription unit 2 (ATU2) and additional transcription unit 3 (ATU3).
6. The nucleic acid construct according to claim 1, wherein the first heterologous polynucleotide comprises SEQ ID NO: 4.
7. The nucleic acid construct according to claim 1, comprising from 5 to 3 end the following polynucleotides: (a) a polynucleotide encoding the N protein of the MeV; (b) a polynucleotide encoding the P protein of the MeV; (c) the first heterologous polynucleotide comprising at least one of SEQ ID NO: 2, SEQ ID NO: 4, and SEQ ID NO: 6 wherein the first polynucleotide is operatively cloned within ATU2; (d) a polynucleotide encoding the M protein of the MeV; (e) a polynucleotide encoding the F protein of the MeV; (f) a polynucleotide encoding the H protein of the MeV; (g) a polynucleotide encoding the L protein of the MeV; and wherein said polynucleotides are operatively linked within the nucleic acid construct and under the control of a viral replication and transcriptional regulatory elements.
8. The nucleic acid construct according to claim 1, comprising from 5 to 3 end the following polynucleotides: (a) a second heterologous polynucleotide encoding at least one polypeptide selected from the group consisting of GPC protein, NP protein, and mNP protein of LASV, or an antigenic fragment thereof, wherein the second polynucleotide is operatively cloned within an ATU localized upstream the N gene of the MeV, in additional transcription unit 1 (ATU1); (b) a polynucleotide encoding the N protein of the MeV; (c) a polynucleotide encoding the P protein of the MeV; (d) the first heterologous polynucleotide comprising at least one of SEQ ID NO: 2, SEQ ID NO: 4, and SEQ ID NO: 6, wherein the first polynucleotide is operatively cloned within ATU2; (e) a polynucleotide encoding the M protein of the MeV; (f) a polynucleotide encoding the F protein of the MeV; (g) a polynucleotide encoding the H protein of the MeV; (h) a polynucleotide encoding the L protein of the MeV, and wherein said polynucleotides are operatively linked within the nucleic acid construct and under the control of a viral replication and transcriptional regulatory elements.
9. The nucleic acid construct according to claim 1, wherein the first heterologous polynucleotide comprises from 5 to 3 end: (a) a nucleic acid comprising SEQ ID NO: 4 or SEQ ID NO: 6; and a nucleic acid comprising SEQ ID NO: 2; wherein the first heterologous polynucleotide is operatively cloned between the P gene and the M gene of the MeV, in ATU2.
10. The nucleic acid construct according to claim 1, wherein the first heterologous polynucleotide comprises from 5 to 3 end: (a) the nucleic acid of SEQ ID NO:6; and (b) the nucleic acid of SEQ ID NO: 2; and wherein the first heterologous polynucleotide sequence is operatively cloned between the gene P and the gene M of the MeV, in ATU2.
11. The nucleic acid construct according to claim 2, wherein the second heterologous polynucleotide encodes Z protein of LASV, or an antigenic fragment thereof, and wherein the first heterologous polynucleotide encodes the GPC protein of LASV, or an antigenic fragment thereof, wherein the sequence of the second heterologous polynucleotide comprises the sequence of SEQ ID NO: 8 and the sequence of the first heterologous polynucleotide comprises the sequence of SEQ ID NO: 2.
12. The nucleic acid construct according to claim 11, wherein the first heterologous polynucleotide is operatively cloned within ATU2 and the second heterologous polynucleotide is operatively cloned within ATU1.
13. The nucleic acid construct according to claim 1, wherein the measles virus is an attenuated virus strain selected from the group consisting of the Schwarz strain, the Zagreb strain, the AIK-C strain, the Moraten strain, the Philips strain, the Beckenham 4A strain, the Beckenham 16 strain, the Edmonston seed A strain, the Edmonston seed B strain, the CAM-70 strain, the TD 97 strain, the Leningrad-16 strain, the Shanghai 191 strain and the Belgrade strain.
14. The nucleic acid construct according to claim 1, wherein the first heterologous polynucleotide comprises SEQ ID NO: 6.
15. The nucleic acid construct according to claim 1, whose recombinant cDNA sequence is selected from the group consisting of: SEQ ID NO: 9 (construct MeV-GPC); SEQ ID NO: 10 (construct MeV-NP-GPC); and SEQ ID NO: 11 (construct MeV-mNP-GPC).
16. A transfer plasm id vector comprising the nucleic acid construct according to claim 1 comprising a sequence selected from the group consisting of: SEQ ID NO: 9 (Plasm MeV-GPC); SEQ ID NO: 10 (Plasm MeV-NP-GPC); and SEQ ID NO: 11 (Plasm MeV-mNP-GPC).
17. A recombinant measles virus, said virus comprising in its genome a nucleic acid construct according to claim 1.
18. A recombinant measles virus, wherein the virus comprises in its genome a nucleic acid construct according to claim 2.
19. The recombinant measles virus according to claim 17 expressing GPC protein and mNP protein of LASV, or antigenic fragments thereof.
20. The recombinant measles virus according to claim 18 expressing GPC protein and Z protein of LASV, or antigenic fragments thereof.
21. The recombinant measles virus according to claim 17, which elicits a cellular and/or humoral and cellular response after a single immunization, against antigenic fragment(s) of the GPC protein, the NP protein, and/or the mNP protein of LASV.
22. An isolated host cell transfected with the nucleic acid construct according to claim 1 selected from a mammalian cell, a VERO NK cells, CEF cells, human embryonic kidney cell line 293 or MRC5 cells.
23. Recombinant virus like particles (VLPs) comprising a Z protein and optionally a GPC protein and/or a NP protein and/or a mNP protein, or an antigenic fragment thereof, of Lassa virus (LASV), wherein the protein(s) or antigenic fragments thereof is(are) encoded by the first and/or second heterologous polynucleotide(s) of the nucleic acid construct according to claim 2.
24. An immunogenic composition comprising the recombinant VLPs according to claim 23.
25. A process for rescuing recombinant Lassa virus (LASV) like particles (VLPs) and/or recombinant measles virus expressing at least one of polypeptide selected from the group consisting of GPC protein, NP protein, mNP protein and Z protein of LASV, or an antigenic fragment thereof, comprising: (a) transfecting cells, stably expressing T7 RNA polymerase and measles virus N and P proteins with the nucleic acid construct according to claim 1; (b) maintaining the transfected cells in conditions suitable for the production of recombinant measles virus and/or LASV VLPs; (c) infecting cells enabling propagation of the recombinant measles virus and/or the LASV VLPs by co-cultivating them with the transfected cells of step (b); (d) harvesting the recombinant measles virus expressing at least one of the GPC protein, the NP protein, the mNP protein and/or the Z protein of LASV.
26. A method for preventing a Lassa virus related disease, said method comprising the immunization of a human by injection of recombinant Lassa virus VLPs according to claim 24.
27. A method for treating a Lassa virus related disease, said method comprising the immunization of a human by the injection of recombinant Lassa virus VLPs according to claim 24.
28. The nucleic acid construct of claim 2, wherein the first heterologous polynucleotide is operatively cloned within ATU2 located between the P gene and the M gene of the MeV and the second heterologous polynucleotide is operatively cloned within ATU3 located between the genes H and L of MeV.
29. The nucleic acid construct of claim 2, wherein the first heterologous polynucleotide encodes glycoprotein precursor (GPC) of LASV operatively cloned within ATU2 located between the P gene and the M gene of the MeV and the second heterologous polynucleotide encodes a mutated nucleoprotein (mNP) of LASV operatively cloned within ATU3 located between the genes H and L of MeV.
30. The nucleic acid construct of claim 2, wherein the first heterologous polynucleotide encodes nucleoprotein (NP) of LASV operatively cloned within ATU2 located between the P gene and the M gene of the MeV and the second heterologous polynucleotide encodes glycoprotein precursor (GPC) of LASV operatively cloned within ATU3 located between the genes H and L of MeV.
31. The nucleic acid construct of claim 2, wherein the first heterologous polynucleotide encodes the mutated nucleoprotein (mNP) of LASV operatively cloned within ATU2 located between the P gene and the M gene of the MeV and the second heterologous polynucleotide encodes glycoprotein precursor (GPC) of LASV operatively cloned within ATU3 located between the genes H and L of MeV.
32. The nucleic acid construct of claim 2, wherein the first heterologous polynucleotide encodes the glycoprotein precursor (GPC) and nucleoprotein (NP) of LASV operatively cloned within ATU2 located between the P gene and the M gene of the MeV.
33. The nucleic acid construct of claim 2, wherein the first heterologous polynucleotide encodes glycoprotein precursor (GPC) and mutated nucleoprotein (mNP) of LASV operatively cloned within ATU2 located between the P gene and the M gene of the MeV.
Description
DESCRIPTION OF THE FIGURES
(1) Some of the figures, to which the present application refers, are in color. The application as filed contains the color print-out of the figures, which can therefore be accessed by inspection of the file of the application at the patent office.
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
(37)
EXAMPLES
(38) Materials and Methods
(39) Cells and Viruses
(40) 293T7/N/P cells expressing stably the T7 polymerase and the measles N and P proteins were used to rescue recombinant measles viruses and were maintained as described before {Combredet, 2003 #76}. Vero NK cells were grown in Glutamax Dulbecco Modified Eagle's Medium (DMEM, Life Technologies) supplemented with 5% FCS, and 0.5% Penicillin-Streptomycin. Blood samples were obtained from the Etablissement Frangais du Sang (EFS, Lyon, France). Mononuclear cells were purified by Ficoll density gradient centrifugation (GE Healthcare). Monocytes were first separated from peripheral blood mononuclear cells by centrifugation on a cushion of 50% Percoll (GE Healthcare, Velizy, France) in PBS and then purified using the Monocyte isolation kit II according to the manufacturer's instructions (Miltenyi Biotec, Paris, France). Macrophages were obtained by incubating monocytes for 6 days in RPMI, 10% SVF, 10% autologous serum supplemented with 50 ng/mL of M-CSF. M-CSF was added every 2 days and 40% of the culture medium was replaced.
(41) Plasmid Constructs
(42) Codon-optimized ORF of LASV GPC, NP and Z (LASV strain Josiah) were cloned in the pTM1-MVSchwarz vector in additional transcriptional units (ATU) placed upstream of Nucleoprotein (N) (ATU1 for Z) or between the phosphoprotein (P) and the matrix (M) genes of the Schwarz MV genome (ATU2, GPC alone or NP+GPC) like previously described (Combredet, C., et al., A molecularly cloned Schwarz strain of measles virus vaccine induces strong immune responses in macaques and transgenic mice. J Virol, 2003. 77(21): p. 11546-54). All plasmid constructs were verified by sequencing.
(43) Western Blot and Antibodies
(44) Vero NK cells infected with recombinant MeV-GFP, MeV-GPC.sub.LASV, MeV-NP+GPC.sub.LASV, MeV-NP.sub.ExoN+GPC.sub.LASV or MeV-Z+GPC.sub.LASV were lysed in Co-IP buffer and cleared by centrifugation. Lysates and culture supernatants were then separated on 4-12% precast gels (Biorad) under denaturing conditions and transferred to PVDF membrane. Membranes were stained with primary antibodies to GP1 (in house mouse monoclonal production), NP (mouse anti-LASV serum), Z (in house rabbit polyclonal production) or F (rabbit polyclonal Fcyt, a kind gift of R. Cattaneo). Cell lysates were also stained with an anti-actin antibody coupled to the horseradish peroxidase (HRP). After staining with secondary antibodies coupled to HRP, membranes were revealed using West Dura substrate (Pierce) and photographed using a LAS4000 imager (GE Healthcare).
(45) Virus Rescue and Titration
(46) Recombinant measles viruses expressing LASV antigens were rescued as previously described (Combredet, 2003; Radecke, F., et al., Rescue of measles viruses from cloned DNA. Embo J, 1995. 14(23): p. 5773-84; WO2008/078198). Briefly, 293T7/N/P cells were transfected with plasmids encoding the measles L polymerase and the antigenomic segment of the desired MeV vector. Clonal syncytia were picked and used to infect Vero NK cells in 6-well plates. When syncytia has reached about 50% of the well superficy, cells were detached and overlaid on Vero NK cells in 10 cm dishes to produce passage 1 (P1) stocks. To prepare higher passage virus stocks, Vero NK cells were infected at a multiplicity of infection (MOI) of 0.01 and then incubated at 32? C. for 2 to 3 days. To harvest virus, cells were scraped into Opti-MEM I reduced-serum medium and freeze-thawed twice. Titers were determined by 50% tissue culture infective dose (TCID50) titration on Vero NK cells.
(47) Quantitative RNA Analysis
(48) For RT-qPCR experiments, total RNA was isolated from mock or infected cells using the Rneasy Mini Kit (Qiagen, Courtaboeuf, France), according to the manufacturer's instructions, and a supplementary DNase step added using the Turbo DNA free kit Ambion (Thermo Fisher Scientific). Synthesis of cDNA was performed using SuperScript III and amplification was performed using the Gene Expression Master Mix kit (Applied Biosystems, Thermo Fisher Scientific). For type I IFN, the primer/probe mix was developed in house. Runs of qPCR assays were performed in a LightCycler 480 (Roche Diagnostics, Meylan, France). The expression of all genes was standardized to that of the GAPDH gene, and expressed as fold induction relative to GAPDH. For viral RNA quantification, an RNA probe of the 771-934 pb region of the NP ORF was cloned into the pGEM vector (Promega) to generate T7 polymerase driven transcripts. The RNA probe was DNAse treated, purified, and quantified (Dropsense96, Trinean, Gent, Belgium). Quantitative PCR for viral RNA was performed with the EuroBioGreen qPCR Mix Lo-ROX (Eurobio, Les Ulis, France), using LASV specific primers.
(49) Flow Cytometry for MP Activation, T Cell Activation and Proliferation
(50) Mock and MOI 1-infected MP were detached 48 h after infection, saturated with human IgG and surface stained with antibodies to CD40, CD83, CD80, and CD86 (BD Biosciences, Le-Pont-de-Claix, France) before final fixation in PBS/1% PFA. LASV antigen-specific T cells were analysed from fresh whole blood. Cells were incubated with a pool of GPC, NP or Z overlapping peptides in the presence of CD28 and CD49d antibodies (2 ?g/ml) and Brefeldin A (10 ?g/ml) for 6 h at 37? C. SEA (1 ?g/ml) or PBS were respectively used as positive or negative control of activation. Peptides are 15-mer amino acids long (1 ?g/ml each) with an overlap of 11 residues and spanned the complete GPC, NP or Z ORF of LASV strain Josiah. PBS-EDTA 20 mM was added to samples before cell-surface staining for CD3, CD4 and CD8 (BD Biosciences). Red blood cells were then lysed using PharmLyse (BD Biosciences). Cells were then fixed and permeabilized for intracellular staining with antibodies to IFN? (Biolegend). For proliferation and activation, wells were stained using antibodies to Ki67 or Granzyme B. Cells were analysed by flow cytometry using an LSR Fortessa cytometer (BD Biosciences) or a 10-color Gallios cytometer (Beckman Coulter). Data were analysed using Kaluza software (Beckman Coulter).
(51) Cynomolgus Monkey Challenge with LASV
(52) Groups of 4 male cynomolgus monkeys (Macaca Fascicularis, 32-39 month-old, 3-4 kg) were immunized in A2 facilities (SILABE, France) by subcutaneous injection of 2.106 TCID50 of MeV-NP.sub.ExoN+GPC.sub.LASV or MeV-Z+GPC.sub.LASV, respectively. Another control group of 3 monkeys was immunized with the MeV vaccine strain Schwarz. Blood draws, oral and nasal swabs and urine sampling were performed every 2-3 days during the first two weeks then once a week up to day 37 in order to assess vaccine replication and shedding, IgM and IgG responses and T cell responses against LASV GPC, NP or Z. After 37 days, monkeys were transported to BSL-4 facilities (Laboratoire P4-Inserm Jean Merieux) where they were challenged subcutaneously using 1,500 FFU of LASV strain Josiah. Animals were followed for clinical signs of the disease and were euthanized according to scoring made based on body temperature, body weight, feeding, hydrating, behaviour and clinical signs. Experimentation endpoint was placed at day 28 post challenge and all animals that had survived to this point were euthanized according to validated experimental procedures. Blood draws, oral and nasal swabs and urine sampling were performed every 2-3 days during the first two weeks then once a week up to day 28 in order to assess LASV virus replication and shedding, IgM and IgG responses and T cell responses against LASV GPC, NP or Z. This study has been approved by the Comite Regional d'Ethique en Matiere d'Experimentation Animale de Strasbourg (APAFIS #6543-20160826144775) and by the Comite Regional d'Ethique pour l'Experimentation Animale Rhone Alpes (CECCAPP 20161110143954).
(53) Determination of the Exonuclease Activity of Native and Mutated NP Protein (
(54) 293T cells were cotransfected using calcium phosphate with 100 ng of a vector that expresses the firefly luciferase (Fluc) reporter gene from a known functional promoter sequence of the IFN-beta gene (pIFNbeta-LUC), variable amounts of either native (wild type) or mutant LASV NP vectors, and 50 ng of a 1-gal-expressing plasmid for transfection normalization. At 24 h post-transfection, cells were infected with Sendai virus (at moi=1) in order to induce IFN-? expression. At 24 hpi, cell lysates were prepared for luciferase and 1-gal assays. Fluc activities were normalized by the 1-gal values. To determine whether NP has an exonuclease activity or not, its effect on the suppression of the immunostimulatory RNAs-induced IFN production is analysed, HEK293 cells were transfected with pIFNbeta-LUC, variable amounts of either native (WT) or mutant LASV NP vectors, and a beta-gal-expressing plasmid for transfection normalization. 18 h later, cells were transfected with either 1 ?g of Poly(I:C) or 250 ng of Pichinde virion RNAs by lipofectamine 2000. Luciferase activity was determined at 18 h after the immunostimulatory RNA transfection and normalized by the beta-gal activity. A mutated NP protein with its exonuclease activity knocked down does not suppress the immunostimulatory RNAs-induced IFN production.
Example 1Generation of Recombinant MeV Viruses Expressing LASV Antigens
(55) In order to determine what is the best combination of LASV antigens to introduce in the MeV vector to get the best immunogenicity, we have generated several MeV/LASV vaccine candidates using the Schwarz MeV vaccine platform (
(56) The Z gene was cloned upstream of the N gene in the ATU1 (
Example 2Immunogenicity of MeV Viruses Expressing LASV Antigens in Human Primary Antigen Presenting Cells
(57) To characterize the immunogenic properties of the different MeV vectors in human immune cells, we infected monocyte derived macrophages and dendritic cells. MeV enters and replicate in these cells, as shown by the expression of GFP on
(58) We analysed the immune responses of macrophages and dendritic cells to the different recombinant viruses by combining flow cytometry analyses of activation markers and qPCR analyses of the type 1 IFN response. We analysed the type I IFN responses induced by the different vectors by qPCR at 24 hrs post infection (
(59) Similar experiments were performed on dendritic cells (
(60) The vaccine strains of MeV-LASV induce a type I IFN response and cell surface expression of co-activation molecules; the presence of wild type NP strongly reduces the ability of the vaccine to induce these effects, but mutation within the ExoN domain restore the ability of the vaccine to induce these effects.
Example 3Safety, Immunogenicity and Efficacy of Two Vaccines in Cynomolgus Monkeys
(61) Based on the results obtained in human macrophages, we decided to test two vaccine candidates in cynomolgus monkeys, the gold standard model to study LASV pathogenesis. Three control animals were immunized subcutaneously with 2.106 TCID50 of a recombinant MeV strain Schwarz vaccine and two groups of 4 animals were immunized subcutaneously with 2.106 TCID50 of MeV-NP.sub.ExoN+GPC.sub.LASV and MeV-Z+GPC.sub.LASV, respectively. The health of the animals was then followed for 37 days post immunization (body temperature, body weight, respiratory rate) and no adverse effects were noted. Notably, the body temperature of the animals, continuously monitored thanks to intraperitoneal devices, was not altered by the immunization (
(62) We also assessed the viremia in immunized animals every 2-3 days during the two weeks following immunization then once a week and could not detect any trace of viral RNA, neither in plasma nor among PBMC. Similarly, we could not detect any viral RNA in the nasal and oral secretions or in the urine of vaccinated animals. Thus, it appears that the vaccine candidates are safe in monkeys and are not shed at any moment post immunization.
(63) In order to assess the immunogenicity of the vectors, we performed ELISA to detect LASV-specific IgM and IgG. We could not detect specific IgM and IgG in MeV-Z+GPC.sub.LASV immunized animals and we only detected low levels of LASV-specific IgG in 3 out of 4 MeV-NP.sub.ExoN+GPC.sub.LASV vaccinated animals at day 37 post immunization. In addition, one MeV-NP.sub.ExoN+GPC.sub.LASV vaccinated animal had neutralizing antibodies as demonstrated by plaque reduction neutralization assay (1:100 titer). We also assessed the LASV-specific T cell responses by flow cytometry after stimulation of whole blood by overlapping peptides specific to GPC, NP or Z. In MeV-NP.sub.ExoN+GPC.sub.LASV vaccinated animals, we detected both CD4 and CD8 T cell responses against GP starting at day 7 and decreasing by day 14 post immunization (
Example 4Efficacy of the Vaccines
(64) In order to test the efficacy of the vaccine candidates, immunized animals were challenged 37 days post immunization with a lethal dose (1,500 ffu, subcutaneous) of LASV strain Josiah. Animals were then monitored for up to 30 days and were attributed clinical scores based on their body temperature, body weight, capacity to feed and hydrate normally, behaviour, clinical signs, with a score of 15 being the endpoint for killing. The three control animals had scores increasing from day 3 and had to be euthanized respectively at day 12, 14 and 15 post challenge (
(65) On the contrary, all vaccinated animals survived the LASV infection but the clinical outcomes were different depending on the vaccine. Indeed, MeV-NP.sub.ExoN+GPC.sub.LASV vaccinated animals had a small increase in clinical score by day 5 (max score of 3,
(66) We also followed several biological parameters in plasma over the course of the infection, such as liver enzymes levels (ALT and AST), lactate deshydrogenase (LDH), C-reactive protein (CRP) and albumin, among other parameters. In control animals, the levels of liver enzymes were increasing continuously starting at day 6 and until the death of the animals (
(67) The plasma levels of LDH are a marker of tissue damages. In control animals, LDH levels started to increase at day 6 post challenge and thus till the end of the animals (
(68) The viremia in challenged animals was also monitored after challenge by both qRT-PCR and titration. As shown on
(69) In addition to viremia, we assessed the presence of viral RNA in nasal and oral swabs of challenged animals. As shown on
(70) The amount of LASV RNA (
Example 5Immune Response to LASV
(71) In order to determine the immune response to infection, we first measured the levels of LASV-specific immunoglobulins produced after the challenge with LASV. The IgM response started at day 9 in all animals, and peaked at day 12 (
(72) TABLE-US-00001 TABLE 1 Seroneutralisation titers measured in the plasma of challenged monkeys MeV-NP.sub.ExoN-GPC.sub.LASV MeV-Z + GPC.sub.LASV CDE031 CDE041 CDF053 CDI009 CDK026 CDK086 CDK106 CDG058 J0 No No 1/100 No 1/100 No No No J6 No No 1/100 No No No No 1/100 J15 1/100 1/100 1/500 1/100 1/500 1/500 1/500 1/500 J28 1/500 1/500 1/100 1/100 J30 1/100 1/100 1/100 1/100 MeV CDH011 CDH028 CDG058 J0 No No No J6 No No No J15 No No No J28 J30
(73) The induction of CD8+ and CD4+ T cells specific for LASV antigens was also monitored by quantifying the percentage of T cells producing IFNg, TNFa and/or IL-2 in response to overlapping peptides covering the whole LASV GP, NP and Z proteins (
(74) Similarly, we followed the T cell response to LASV GPC, NP or Z after challenge in T cell activation assay using overlapping peptides. The CD8 and CD4 response against GPC and NP were early and robust in MeV-NP.sub.ExoN+GPC.sub.LASV vaccinated animals, peaking at day 9 then decreasing slowly (
(75) The intensity of the CD8 responses was correlated with the proliferation of these cells as assessed by a Ki67 staining (
(76) The induction of LASV GP- and NP-specific T cells in animals challenged with LASV has been monitored. No production of cytokines was observed after stimulation of PBMC with LASV Z peptides after the challenge (data not shown). The data regarding the CD8+ and CD4+ T cells producing cytokines in challenged animals are illustrated on
(77) In response to the LASV NP peptide, trace amounts of cytokine-producing T cells from animals immunized with MeV were only detected 15 days post-challenge. Responding T cells from animals immunized with MeV-Z+GPC.sub.LASV were detected as soon as day 6 post-challenge, with a peak response at day 12. The phenotype of T cells was various after 6 days, while at day 9, mainly TNFa-secreting T cells were present. At day 12, IFNg-producing T cells dominated whereas Pf-T proportion increased until day 30.
(78) The total cellular RNA content of PBMC of immunized monkeys with MeV-NP.sub.ExoN+GPC.sub.LASV and MeV-Z+GPC.sub.LASV has also been extracted at different times post-immunization to perform RNAseq and for analysing the differential expression of genes in PBMC at different time points. An enrichment analysis on differentially expressed genes has been performed using ClusterProfiler (KEGG analysis) in order to identify the pathway associated with those genes. The pathways differentially modulated through time after immunization with MeV-NP.sub.ExoN+GPC.sub.LASV and MeV-Z+GPC.sub.LASV are illustrated on
(79) The release of soluble mediators in plasma of animals after immunization and after LASV challenge has been observed. Among the 29 analytes quantified using Luminex assay, no difference in the levels of soluble mediator was found between animals after immunisation (data not shown). In challenged animals (
Example 6: Immune Response to MeV
(80) The levels of MeV-specific immunoglobulins produced against MeV-specific immunoglobulins was also assessed post-challenge by ELISA (
Example 7: Tropism of the Vaccine Strains of MeV-LASV
(81) The tropism of MeV-LASV has been analysed. Lassa virus uses ?-dystroglycan (?-DG) as a receptor. The vaccine strains of MeV use CD46, SLAM and nectin-4 as receptors. A Mopeia virus has been used as a control to analyse if the introduction of Lassa antigens into the MeV vector has an impact on the tropism of the vaccine strains of MeV. Mopeia virus is an arenavirus closely related to the Lassa virus, and uses the same receptor. A Mopeia virus pseudotyped with the Lassa virus GPC replicates in CHO-K1 cells which express ?-DG and in CHO-hCD46 cells which express ?-DG and the human CD46, as illustrated on
CONCLUSION
(82) To conclude, both MeV-NP.sub.ExoN+GPC.sub.LASV and MeV-Z+GPC.sub.LASV vaccines were safe, immunogenic and efficacious in non-human primates. Both protected cynomolgus macaques against a lethal challenge with LASV strain Josiah after a single immunization. However, MeV-NP.sub.ExoN+GPC.sub.LASV conferred the best protection with a robust T cell response and a nearly-sterilizing immunity in all vaccinated monkeys. Thus, this vector is a candidate of choice for advance to clinical trials in humans. The immunogenicity of this vector prior challenge could certainly be improved by a prime/boost strategy. Nonetheless, we here bring the proof of principle that a single immunization could protect 100% of challenge animals. In addition, these vectors should protect monkeys against measles and could thus be used, in addition to emergency vaccine, as a bivalent vaccine in endemic countries where both LASV and MeV are major public health issues.
(83) SEQ ID NO: 1
(84) SEQ ID No: 1 corresponds to a recombinant GPC protein of the Lassa Virus strain Josiah encoded by the codon-optimised sequence of SEQ ID No: 2.
(85) TABLE-US-00002 MGQIVTFFQEVPHVIEEVMNIVLIALSVLAVLKGLYNFATCGLVGLV TFLLLCGRSCTTSLYKGVYELQTLELNMETLNMTMPLSCTKNNSHHY IMVGNETGLELTLTNTSIINHKFCNLSDAHKKNLYDHALMSIISTFH LSIPNFNQYEAMSCDFNGGKISVQYNLSHSYAGDAANHCGTVANGVL QTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWEDHCQFSR PSPIGYLGLLSQRTRDIYISRRLLGTFTWTLSDSEGKDTPGGYCLTR WMLIEAELKCFGNTAVAKCNEKHDEEFCDMLRLFDFNKQAIQRLKAE AQMSIQLINKAVNALINDQLIMKNHLRDIMGIPYCNYSKYWYLNHTT TGRTSLPKCWLVSNGSYLNETHFSDDIEQQADNMITEMLQKEYMERQ GKTPLGLVDLFVFSTSFYLISIFLHLVKIPTHRHIVGKSCPKPHRLN HMGICSCGLYKQPGVPVKWKR*
(86) SEQ ID NO: 2
(87) SEQ ID No: 2 corresponds to a codon-optimized nucleotide sequence encoding the GPC protein of SEQ ID No. 1.
(88) TABLE-US-00003 1ATGGGCCAGATTGTCACATTCTTTCAGGAAGTGCCACACGTCATTGAGGAGGTCATGAAC 61ATCGTGCTGATTGCTCTGTCAGTGCTGGCAGTGCTGAAAGGACTGTACAACTTCGCTACC 121TGTGGACTGGTGGGACTGGTCACATTCCTGCTGCTGTGCGGCAGAAGTTGCACTACCTCA 181CTGTACAAAGGAGTGTACGAGCTGCAGACTCTGGAACTGAACATGGAGACACTGAATATG 241ACAATGCCTCTGAGCTGCACCAAGAATAATAGCCACCACTATATCATGGTCGGGAACGAA 301ACCGGCCTGGAACTGACCCTGACAAACACCAGCATCATTAACCACAAGTTCTGCAATCTG 361AGCGACGCTCACAAGAAGAACCTGTATGACCACGCTCTGATGTCCATCATCAGTACCTTT 421CACCTGTCCATCCCCAATTTCAACCAGTACGAGGCAATGTCATGCGACTTCAACGGGGGC 481AAGATCAGTGTCCAGTACAACCTGAGCCACTCCTACGCCGGCGACGCAGCCAACCACTGC 541GGAACTGTCGCCAATGGCGTGCTGCAGACATTCATGAGGATGGCATGGGGGGGATCTTAC 601ATCGCACTGGATAGCGGCAGGGGCAATTGGGATTGCATCATGACTTCCTATCAGTATCTG 661ATTATCCAGAATACTACATGGGAGGATCATTGCCAGTTCAGTCGGCCCAGCCCTATTGGA 721TATCTGGGGCTGCTGTCACAGAGAACACGGGATATCTATATTTCAAGACGCCTGCTGGGC 781ACATTCACTTGGACACTGTCAGACAGTGAGGGCAAGGATACTCCAGGGGGCTACTGCCTG 841ACACGATGGATGCTGATCGAAGCAGAGCTGAAATGCTTCGGCAATACCGCAGTGGCCAAG 901TGCAACGAGAAACACGACGAGGAGTTCTGCGACATGCTGAGGCTGTTCGACTTCAACAAA 961CAGGCTATCCAGAGACTGAAGGCAGAAGCCCAGATGTCAATCCAGCTGATCAACAAGGCA 1021GTGAACGCCCTGATCAACGACCAGCTGATCATGAAGAACCACCTGAGAGACATTATGGGC 1081ATCCCCTACTGTAATTACAGCAAGTATTGGTACCTGAACCACACTACAACCGGGAGAACA 1141TCCCTGCCCAAGTGCTGGCTGGTCAGCAATGGGAGTTATCTGAATGAAACCCATTTCAGC 1201GACGATATCGAACAGCAGGCTGACAACATGATCACAGAGATGCTGCAGAAAGAGTACATG 1261GAAAGACAGGGCAAGACACCACTGGGACTGGTCGATCTGTTCGTCTTCTCCACTAGCTTC 1321TATCTGATTTCCATCTTCCTGCACCTGGTGAAGATCCCCACTCATAGGCACATTGTCGGC 1381AAGAGTTGCCCTAAACCCCATAGGCTGAATCACATGGGGATTTGTAGTTGCGGCCTGTAT 1441AAGCAGCCTGGCGTGCCTGTGAAATGGAAGAGATGA
(89) SEQ ID NO: 3
(90) SEQ ID No: 3 corresponds to a recombinant NP protein of the Lassa Virus strain Josiah encoded by the codon-optimised sequence of SEQ ID No: 4.
(91) TABLE-US-00004 MSASKEIKSFLWTQSLRRELSGYCSNIKLQVVKDAQALLHGLDFSEV SNVQRLMRKERRDDNDLKRLRDLNQAVNNLVELKSTQQKSILRVGTL TSDDLLILAADLEKLKSKVIRTERPLSAGVYMGNLSSQQLDQRRALL NMIGMSGGNQGARAGRDGVVRVWDVKNAELLNNQFGTMPSLTLACLT KQGQVDLNDAVQALTDLGLIYTAKYPNTSDLDRLTQSHPILNMIDTK KSSLNISGYNFSLGAAVKAGACMLDGGNMLETIKVSPQTMDGILKSI LKVKKALGMFISDTPGERNPYENILYKICLSGDGWPYIASRTSITGR AWENTVVDLESDGKPQKADSNNSSKSLQSAGFTAGLTYSQLMTLKDA MLQLDPNAKTWMDIEGRPEDPVEIALYQPSSGCYIHFFREPTDLKQF KQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKL LESQGRKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGVVVEKK KRGGKEEITPHCALMDCIMFDAAVSGGLNTSVLRAVLPRDMVFRTST PRVVL*
(92) SEQ ID NO: 4
(93) SEQ ID No: 4 corresponds to a codon-optimized nucleotide sequence encoding the NP protein of SEQ ID No. 3.
(94) TABLE-US-00005 1ATGAGTGCCAGCAAAGAAATCAAGAGCTTCCTGTGGACCCAGAGTCTGCGGAGGGAACTG 61AGCGGATACTGTAGCAACATCAAACTGCAGGTGGTCAAGGACGCTCAGGCACTGCTGCAT 121GGGCTGGACTTCTCCGAGGTGTCTAATGTGCAGCGGCTGATGCGGAAAGAACGGAGGGAC 181GATAATGACCTGAAGCGACTGCGCGACCTGAACCAGGCAGTGAACAATCTGGTCGAGCTG 241AAGAGCACCCAGCAGAAATCAATCCTGCGGGTCGGGACACTGACATCTGACGACCTGCTG 301ATCCTGGCTGCAGACCTGGAGAAGCTGAAATCGAAAGTGATCCGCACCGAAAGGCCACTG 361TCCGCCGGGGTCTACATGGGCAATCTGTCTTCCCAGCAGCTGGACCAGAGGCGGGCTCTG 421CTGAACATGATTGGGATGTCCGGAGGAAATCAGGGAGCTAGAGCCGGGAGGGACGGAGTC 481GTGCGGGTCTGGGACGTGAAGAATGCCGAACTGCTGAACAACCAGTTCGGGACCATGCCA 541AGTCTGACACTGGCATGCCTGACTAAACAGGGCCAGGTGGATCTGAATGATGCAGTCCAG 601GCTCTGACCGACCTGGGCCTGATCTACACCGCCAAGTACCCCAATACTAGCGACCTGGAT 661AGACTGACCCAGAGCCACCCCATCCTGAACATGATCGACACTAAGAAGTCCTCACTGAAC 721ATCAGTGGCTATAATTTCTCCCTGGGGGCAGCAGTCAAGGCTGGCGCATGCATGCTGGAC 781GGCGGGAATATGCTGGAAACCATCAAAGTGTCTCCCCAGACCATGGATGGCATCCTGAAA 841TCTATTCTGAAAGTCAAGAAGGCCCTGGGAATGTTTATTTCAGACACCCCCGGCGAGAGG 901AATCCATATGAGAACATTCTGTATAAGATTTGCCTGAGTGGCGACGGGTGGCCATACATT 961GCAAGCCGGACATCAATTACCGGAAGAGCTTGGGAGAATACAGTCGTGGACCTGGAAAGC 1021GACGGCAAGCCCCAGAAGGCCGACTCAAACAACTCCTCAAAGAGTCTGCAGTCAGCTGGC 1081TTCACAGCAGGGCTGACTTACTCCCAGCTGATGACACTGAAGGACGCAATGCTGCAGCTG 1141GACCCAAACGCTAAGACATGGATGGACATCGAGGGACGGCCAGAAGATCCAGTGGAAATC 1201GCACTGTATCAGCCATCATCCGGATGCTATATCCATTTCTTCCGGGAACCAACTGATCTG 1261AAGCAGTTCAAGCAGGATGCAAAGTACTCCCACGGAATCGATGTCACCGATCTGTTCGCA 1321ACCCAGCCAGGACTGACATCAGCCGTCATCGATGCCCTGCCTAGGAACATGGTCATTACT 1381TGCCAGGGCTCCGACGATATTAGGAAGCTGCTGGAGAGCCAGGGACGGAAGGATATCAAA 1441CTGATCGATATTGCCCTGTCTAAGACTGATAGCCGGAAATATGAGAATGCAGTCTGGGAT 1501CAGTACAAGGACCTGTGCCATATGCATACCGGAGTGGTCGTCGAGAAGAAGAAGAGGGGC 1561GGAAAGGAAGAGATCACACCCCACTGTGCCCTGATGGATTGCATCATGTTCGACGCAGCC 1621GTGTCCGGGGGCCTGAACACCTCAGTCCTGAGGGCTGTCCTGCCAAGAGATATGGTGTTT 1681AGAACTTCAACCCCAAGAGTCGTCCTGTAA
(95) SEQ ID NO: 5
(96) SEQ ID No: 5 corresponds to a recombinant mutated NP protein of the Lassa Virus strain Josiah encoded by the codon-optimised sequence of SEQ ID No: 6, and wherein the exonuclease activity of the NP protein has been knocked down. Amino acid 388 and amino acid 391 have been mutated (M388D and E391 G).
(97) TABLE-US-00006 MSASKEIKSFLWTQSLRRELSGYCSNIKLQVVKDAQALLHGLDFSEV SNVQRLMRKERRDDNDLKRLRDLNQAVNNLVELKSTQQKSILRVGTL TSDDLLILAADLEKLKSKVIRTERPLSAGVYMGNLSSQQLDQRRALL NMIGMSGGNQGARAGRDGVVRVWDVKNAELLNNQFGTMPSLTLACLT KQGQVDLNDAVQALTDLGLIYTAKYPNTSDLDRLTQSHPILNMIDTK KSSLNISGYNFSLGAAVKAGACMLDGGNMLETIKVSPQTMDGILKSI LKVKKALGMFISDTPGERNPYENILYKICLSGDGWPYIASRTSITGR AWENTVVDLESDGKPQKADSNNSSKSLQSAGFTAGLTYSQLMTLKDA MLQLDPNAKTWMAIEARPEDPVEIALYQPSSGCYIHFFREPTDLKQF KQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKL LESQGRKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGVVVEKK KRGGKEEITPHCALMDCIMFDAAVSGGLNTSVLRAVLPRDMVFRTST PRVVL*
(98) SEQ ID NO: 6
(99) SEQ ID No: 6 corresponds to a codon-optimized nucleotide sequence encoding the mutated NP protein of SEQ ID No. 5. Nucleotides 11661 1175 and 1176 has been mutated (C1166A, C1175G and C1176A).
(100) TABLE-US-00007 1ATGAGTGCCAGCAAAGAAATCAAGAGCTTCCTGTGGACCCAGAGTCTGCGGAGGGAACTG 61AGCGGATACTGTAGCAACATCAAACTGCAGGTGGTCAAGGACGCTCAGGCACTGCTGCAT 121GGGCTGGACTTCTCCGAGGTGTCTAATGTGCAGCGGCTGATGCGGAAAGAACGGAGGGAC 181GATAATGACCTGAAGCGACTGCGCGACCTGAACCAGGCAGTGAACAATCTGGTCGAGCTG 241AAGAGCACCCAGCAGAAATCAATCCTGCGGGTCGGGACACTGACATCTGACGACCTGCTG 301ATCCTGGCTGCAGACCTGGAGAAGCTGAAATCGAAAGTGATCCGCACCGAAAGGCCACTG 361TCCGCCGGGGTCTACATGGGCAATCTGTCTTCCCAGCAGCTGGACCAGAGGCGGGCTCTG 421CTGAACATGATTGGGATGTCCGGAGGAAATCAGGGAGCTAGAGCCGGGAGGGACGGAGTC 481GTGCGGGTCTGGGACGTGAAGAATGCCGAACTGCTGAACAACCAGTTCGGGACCATGCCA 541AGTCTGACACTGGCATGCCTGACTAAACAGGGCCAGGTGGATCTGAATGATGCAGTCCAG 601GCTCTGACCGACCTGGGCCTGATCTACACCGCCAAGTACCCCAATACTAGCGACCTGGAT 661AGACTGACCCAGAGCCACCCCATCCTGAACATGATCGACACTAAGAAGTCCTCACTGAAC 721ATCAGTGGCTATAATTTCTCCCTGGGGGCAGCAGTCAAGGCTGGCGCATGCATGCTGGAC 781GGCGGGAATATGCTGGAAACCATCAAAGTGTCTCCCCAGACCATGGATGGCATCCTGAAA 841TCTATTCTGAAAGTCAAGAAGGCCCTGGGAATGTTTATTTCAGACACCCCCGGCGAGAGG 901AATCCATATGAGAACATTCTGTATAAGATTTGCCTGAGTGGCGACGGGTGGCCATACATT 961GCAAGCCGGACATCAATTACCGGAAGAGCTTGGGAGAATACAGTCGTGGACCTGGAAAGC 1021GACGGCAAGCCCCAGAAGGCCGACTCAAACAACTCCTCAAAGAGTCTGCAGTCAGCTGGC 1081TTCACAGCAGGGCTGACTTACTCCCAGCTGATGACACTGAAGGACGCAATGCTGCAGCTG 1141GACCCAAACGCTAAGACATGGATGGCCATCGAGGCCCGGCCAGAAGATCCAGTGGAAATC 1201GCACTGTATCAGCCATCATCCGGATGCTATATCCATTTCTTCCGGGAACCAACTGATCTG 1261AAGCAGTTCAAGCAGGATGCAAAGTACTCCCACGGAATCGATGTCACCGATCTGTTCGCA 1321ACCCAGCCAGGACTGACATCAGCCGTCATCGATGCCCTGCCTAGGAACATGGTCATTACT 1381TGCCAGGGCTCCGACGATATTAGGAAGCTGCTGGAGAGCCAGGGACGGAAGGATATCAAA 1441CTGATCGATATTGCCCTGTCTAAGACTGATAGCCGGAAATATGAGAATGCAGTCTGGGAT 1501CAGTACAAGGACCTGTGCCATATGCATACCGGAGTGGTCGTCGAGAAGAAGAAGAGGGGC 1561GGAAAGGAAGAGATCACACCCCACTGTGCCCTGATGGATTGCATCATGTTCGACGCAGCC 1621GTGTCCGGGGGCCTGAACACCTCAGTCCTGAGGGCTGTCCTGCCAAGAGATATGGTGTTT 1681AGAACTTCAACCCCAAGAGTCGTCCTGTAA
(101) SEQ ID NO: 7
(102) SEQ ID No: 7 corresponds to a recombinant Z protein of the Lassa Virus strain Josiah encoded by the codon-optimised sequence of SEQ ID No: 8.
(103) TABLE-US-00008 MGNKQAKAPESKDSPRASLIPDATHLGPQFCKSCWFENKGLVECNNH YLCLNCLTLLLSVSNRCPICKMPLPTKLRPSAAPTAPPTGAADSIRP PPYSP*
(104) SEQ ID NO: 8
(105) SEQ ID No: 8 corresponds to a codon-optimized nucleotide sequence encoding the Z protein of SEQ ID No. 7.
(106) TABLE-US-00009 1ATGGGCAATAAGCAGGCAAAGGCACCCGAAAGCAAGGATTCACCTAGAGCATCACTGATT 61CCCGACGCAACTCATCTGGGGCCACAGTTCTGCAAATCCTGTTGGTTCGAGAACAAAGGC 121CTGGTGGAGTGCAATAACCACTACCTGTGCCTGAACTGTCTGACACTGCTGCTGAGTGTG 181AGCAACAGATGCCCAATCTGCAAGATGCCTCTGCCAACAAAGCTGAGGCCTTCTGCTGCA 241CCCACCGCACCACCAACTGGAGCCGCAGACAGCATTAGACCCCCCCCATACTCACCATAA
BIBLIOGRAPHIC REFERENCES
(107) Brandler, S. et al. A recombinant measles vaccine expressing chikungunya virus-like particles is strongly immunogenic and protects mice from lethal challenge with chikungunya virus. Vaccine 31, 3718-3725, doi:10.1016/J. vaccine.2013.05.086 (2013). Mateo, M., Navaratnaraja h, C. K., Syed, S. & Cattaneo, R. The measles virus hemagglutinin beta-propeller head beta4-beta5 hydrophobie groove governs functional interactions with nectin-4 and CD46 but not those with the signalling lymphocytic activation molecule. J Virol 87, 9208-9216, doi:10.1128/JVI.01210-13 (2013). Radecke, F. et al. Rescue of measles viruses from cloned DNA. Embo J 14, 5773-5784 (1995). Stebbings, R. et al. Immunogenicity of a recombinant measles-HIV-1 clade B candidate vaccine. PLoS One 7, e50397, doi:10.1371/journal.pone.0050397 {2012). Reyes-del Valle, J., Hodge, G., McChesney, M. B. & Cattaneo, R. Protective anti-hepatitis B virus responses in rhesus monkeys primed with a vectored measles virus and boosted with a single dose of hepatitis B surface antigen. J Virol 83, 9013-9017, doi:10.1128/JVI.00906-09 {2009). Yoneda, M. et al. Recombinant measles virus vaccine expressing the Nipah virus glycoprotein protects against lethal Nipah virus challenge. PLoS One 8, e58414, doi:10.1371/journal.pone.0058414 (2013). Combredet, C. et al. A molecularly cloned Schwarz strain of measles virus vaccine induces strong immune responses in macaques and transgenic mice. J Virol 77, 11546-11554 {2003). Escriou, N. et al. Protection from SARS coronavirus conferred by live measles vaccine expressing the spike glycoprotein. Virology 452-453, 32-41, doi:10.1016/j.virol.2014.01.002 {2014). Lorin, C. et al. Toxicology, biodistribution and shedding profile of a recombinant measles vaccine vector expressing HIV-1 antigens, in cynomolgus macaques. Naunyn Schmiedebergs Arch Pharmacol 385, 1211-1225, doi:10.1007/s00210-012-0793-4 {2012). Brandler, S. et al. Measles vaccine expressing the secreted form of West Nile virus envelope glycoprotein induces protective immunity in squirrel monkeys, a new model of West Nile virus infection. J Infect Dis 206, 212-219, doi:10.1093/infdis/jis328 (2012). Brandler, S. et al. Pediatric measles vaccine expressing a dengue tetravalent antigen elicits neutralizing antibodies against all four dengue viruses. Vaccine 28, 6730-6739, doi:10.1016/j.vaccine.2010.07.073 (2010). Guerbois, M. et al. Live attenuated measles vaccine expressing HIV-1 Gag virus like particles covered with gp160DeltaV1V2 is strongly immunogenic. Virology 388, 191-203, doi:10.1016/j.virol.2009.02.047 (2009). Brandler, S. et al. Pediatric measles vaccine expressing a dengue antigen induces durable serotype-specific neutralizing antibodies to dengue virus. PLoS Negl Trop Dis 1, e96, doi:10.1371/journal.pntd.0000096 (2007). Lorin, C. et al. A recombinant live attenuated measles vaccine vector primes effective HLA-A0201-restricted cytotoxic T lymphocytes and broadly neutralizing antibodies against HIV-1 conserved epitopes. Vaccine 23, 4463-4472, doi:10.1016/j.vaccine.2005.04.024 (2005).