Methods for Generating Functional Therapeutic B Cells ex-vivo
20190249141 ยท 2019-08-15
Inventors
Cpc classification
A61K39/00
HUMAN NECESSITIES
C12N2537/00
CHEMISTRY; METALLURGY
A61K2239/38
HUMAN NECESSITIES
International classification
Abstract
The various embodiments of the disclosure relate generally to processes, methods, and systems for generating functional B cells ex vivo. It is particularly useful for ex vivo generation of antigen-specific germinal-center (GC) like B cells that are capable of efficient B cell expansion, immunoglobulin (Ig) class switching/class switching recombination (CSR), expression of germinal B cell phenotypes, antibody secretion, and somatic hypermutation (SHM) and resulting affinity maturation center phenotypes.
Claims
1. A method of ex vivo generation of B cells in a synthetic germinal center comprising the steps of: a) exposing at least one nave B cell isolated from a primary source to CD40L and to an antigen in the synthetic germinal center, at least one of which is presented on a three dimensional surface; b) eliminating dead B cells and the three dimensional surface; and c) obtaining antigen-specific B cells with at least three characteristics selected from the group consisting of: efficient B cell expansion/proliferation, class switching recombination (CSR), expression of germinal center B cell or plasma cell phenotypes, antibody secretion, and somatic hypermutation (SHM) and resulting affinity maturation.
2. A method of ex vivo generation of B cells in a synthetic germinal center comprising the steps of: a) exposing least one nave B cell isolated from a primary source to CD40L and to an antigen in the synthetic germinal center, at least one of which is in a soluble form; b) eliminating dead B cells; and c) obtaining antigen-specific B cells with at least three characteristics selected from the group consisting of: efficient B cell expansion/proliferation, class switching recombination (CSR), expression of germinal center B cell or plasma cell phenotypes, antibody secretion, and somatic hypermutation (SHM) and resulting affinity maturation.
3. The method of claim 1, wherein the three dimensional surface comprises a microbead or a microcarrier.
4. The method of claim 1, wherein at least one of the CD40L and the antigen are present in multivalent form.
5. The method of claim 1, wherein step (a) further comprises sorting, classifying or purifying the nave B cell population prior to exposure to CD40L and the antigen.
6. The method of claim 3, wherein at least one of the CD40L and the antigen is bound to the microbead or microcarrier.
7. The method of claim 4, wherein at least one of the CD40L and the antigen is bound to the microbead or microcarrier.
8. The method of claim 1, wherein step (a) further comprises adding soluble factors to the synthetic germinal center.
9. The method of claim 8, wherein the soluble factors comprise cytokines, B cell growth or activation factors, and/or toll-like receptor ligands.
10. The method of claim 9, wherein the cytokines comprise IL-2, IL-4, IL-5, IL-10, and/or IL-21.
11. The method of claim 1, wherein step (b) comprises centrifugation, fluorescence-activated cell sorting (FACS), magnetic-activated cell sorting (MACS), enzymatic degradation, various filtrations, microfluidic cell sorting, and/or size exclusion chromatography to eliminate dead cells and/or three dimensional structures.
12. The method of claim 1, wherein step (b) further comprises purifying antigen-specific B cells.
13. The method of claim 12, wherein purifying the antigen-specific B cells comprises cell sorting, centrifugation, microfluidic cell sorting, and/or size exclusion chromatography.
14. A method of treating the disease or condition related to the antigen comprising the administration of the antigen-specific B cell of claim 1.
15-26. (canceled)
27. The method of claim 1, wherein the CD40L is a protein comprising the amino acid sequence of SEQ ID NO: 18.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
DETAILED DESCRIPTION
[0066] Although preferred embodiments of the disclosure are explained in detail, it is to be understood that other embodiments are contemplated. Accordingly, it is not intended that the disclosure is limited in its scope to the details of construction and arrangement of components set forth in the following description or illustrated in the drawings. The disclosure is capable of other embodiments and of being practiced or carried out in various ways. Also, in describing the preferred embodiments, specific terminology will be resorted to for the sake of clarity.
[0067] It must also be noted that, as used in the specification and the appended claims, the singular forms a, an and the include plural referents unless the context clearly dictates otherwise.
[0068] Also, in describing the preferred embodiments, terminology will be resorted to for the sake of clarity. It is intended that each term contemplates its broadest meaning as understood by those skilled in the art and includes all technical equivalents which operate in a similar manner to accomplish a similar purpose.
[0069] Ranges can be expressed herein as from about or approximately one particular value and/or to about or approximately another particular value. When such a range is expressed, another embodiment includes from the one particular value and/or to the other particular value. Further, the term about means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, about can mean within an acceptable standard deviation, per the practice in the art. Alternatively, about can mean a range of up to 20%, preferably up to 10%, more preferably up to 5%, and more preferably still up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, preferably within 2-fold, of a value. Where particular values are described in the application and claims, unless otherwise stated, the term about is implicit and in this context means within an acceptable error range for the particular value.
[0070] By comprising or comprising or including is meant that at least the named compound, element, particle, or method step is present in the composition or article or method, but does not exclude the presence of other compounds, materials, particles, method steps, even if the other such compounds, material, particles, method steps have the same function as what is named.
[0071] Throughout this description, various components may be identified having specific values or parameters, however, these items are provided as exemplary embodiments. Indeed, the exemplary embodiments do not limit the various aspects and concepts of the present invention as many comparable parameters, sizes, ranges, and/or values may be implemented. The terms first, second, and the like, primary, secondary, and the like, do not denote any order, quantity, or importance, but rather are used to distinguish one element from another.
[0072] It is noted that terms like specifically, preferably, typically, generally, and often are not utilized herein to limit the scope of the claimed invention or to imply that certain features are critical, essential, or even important to the structure or function of the claimed invention. Rather, these terms are merely intended to highlight alternative or additional features that may or may not be utilized in a particular embodiment of the present invention. It is also noted that terms like substantially and about are utilized herein to represent the inherent degree of uncertainty that may be attributed to any quantitative comparison, value, measurement, or other representation.
[0073] It is also to be understood that the mention of one or more method steps does not preclude the presence of additional method steps or intervening method steps between those steps expressly identified. Similarly, it is also to be understood that the mention of one or more components in a device or system does not preclude the presence of additional components or intervening components between those components expressly identified.
[0074] Herein is described a fully synthetic ex vivo system that generates antigen-specific germinal-center (GC) like B cells. An exemplary version of the described synthetic germinal center (sGC) reaction was effectively induced using artificial follicular T helper cells (T.sub.FH) that provided both natural CD40-CD40L ligation as well as crosslinking of CD40; and by mimicking artificial follicular dendritic cells (FDC) to provide efficient antigen presentation. The artificial sGC reaction resulted in efficient B cell expansion, immunoglobulin (Ig) class switching, CSR, SHM, and expression of germinal center phenotypes. Antigen presentation during sGC reaction selectively enhanced the antigen-specific B cell population and induced somatic hyper-mutations, indicating potential affinity maturation. The resulting B cell population consisted primarily of GC-like B cells (centrocytes) as well as some plasma-like B cells expressing CD138. With concurrent cell sorting, highly enriched (100 fold) populations of antigen-specific B cells were successfully created. Adoptive transfer of these GC-like B cells into non-irradiated isogeneic or non-lethally irradiated congenic recipient mice showed successful engraftment and survival of the sGC B cells for 4 weeks. Herein it is shown that this sGC system can be successfully applied to not only splenic B cells but also B cells isolated from more therapeutically relevant sources such as peripheral blood mononuclear cells (PBMCs), thus making the described method an exciting prospect in the new era of personalized medicine and custom-immunotherapy.
[0075] It was hypothesized that the GC reaction can be recapitulated ex vivo by effectively synthesizing the critical signaling events provided by T.sub.FH cells and FDCs (
[0076] The selective expansion of antigen-specific B cell clones is initiated by the effective antigen presentation by FDC. As these B cell clones proliferate in the GCs, the affinities toward antigenic epitopes are increased by somatic hypermutation (SHM) of immunoglobulin (Ig) antigen receptor genes under a concurrent selection mechanism.sup.10-12 for high-affinity clones (affinity maturation). There has been little effort to emulate this critical aspect of the GC reaction ex vivo. If successful, such sGC reaction and ex vivo generation of high quality and high affinity antigen-specific B cells could provide significant advancement in treating various diseases that require antigen-specific humoral immunity.
[0077] The present disclosure demonstrates that GC reactions can be effectively recapitulated ex vivo by purely biomaterials-based artificial T.sub.FH and FDCs, as described further herein. By testing and comparing various CD40 ligation methods for their capability to induce expansion, class switch recombination, and expression of GC B cell-specific phenotypes, it was found that surface-density controlled CD40L presentation by a three dimensional structure such as microbeads were the most effective as artificial T.sub.FH cells. Additionally, microbead surface-bound or multimeric antigen presentation methods were successfully employed to create enriched populations of antigen-specific B cells that had undergone class-switching and somatic hypermutation, though soluble antigen presentation is also contemplated herein. These sGC reactions were successfully applied to not only spleen-isolated B cells but also the B cells isolated from peripheral blood mononuclear cells (PBMCs), a critical aspect for clinical translation. Ex vivo sGC-generated B cells engrafted to the spleen and the lymph nodes following adoptive transfer, suggesting that these cells possess a tremendous potential in immunotherapy as a novel means to confer antigen-specific humoral immunity.
[0078] Method of Ex Vivo Generation of B Cells
[0079] In one embodiment, a method of ex vivo generation of B cells in a sGC comprises the steps of:
[0080] a) isolating nave B cells from a primary source (e.g., PMBCs, spleen, lymph node, stem/progenitor cells);
[0081] b) exposing the B cell to CD40L and to an antigen in a synthetic germinal center, at least one of which is presented on a three dimensional surface;
[0082] c) eliminating dead B cells and the three dimensional surface; and
[0083] d) obtaining antigen-specific B cells with at least three characteristics selected from the group consisting of: efficient B cell expansion/proliferation, class switching recombination (CSR), antibody secretion, expression of germinal center B cell or plasma cell and somatic hypermutation (SHM) and resulting affinity maturation.
[0084] In another embodiment, a method of ex vivo generation of B cells in a sGC comprises the steps of:
[0085] a) isolating nave B cells from a primary source (e.g., PMBCs, spleen, lymph node, stem/progenitor cells);
[0086] b) exposing the B cell to CD40L and to an antigen in a synthetic germinal center, at least one of which is presented on a microbead;
[0087] c) eliminating dead B cells and microbeads; and
[0088] d) obtaining antigen-specific B cells with at least three characteristics selected from the group consisting of: efficient B cell expansion/proliferation, class switching recombination (CSR), antibody secretion, expression of germinal center B cell or plasma cell and somatic hypermutation (SHM) and resulting affinity maturation.
[0089] In another embodiment, a method of ex vivo generation of B cells in a sGC comprises the steps of:
[0090] a) isolating nave B cells from a primary source (e.g., PMBCs, spleen, lymph node, stem/progenitor cells);
[0091] b) exposing the B cell to CD40L and to an antigen in a synthetic germinal center, at least one of which is in a soluble form;
[0092] c) eliminating dead B cells; and
[0093] d) obtaining antigen-specific B cells with at least three characteristics selected from the group consisting of: efficient B cell expansion/proliferation, class switching recombination (CSR), antibody secretion, expression of germinal center B cell or plasma cell and somatic hypermutation (SHM) and resulting affinity maturation.
[0094] In an embodiment of any of the methods described above, the antigen may be present in multivalent form. In another embodiment, CD40L may be present in multivalent form. In yet another embodiment, both the antigen and CD40L are present in multivalent form.
[0095] In an embodiment of any of the above methods, step (a) further comprises sorting, classifying or purifying the nave B cell population prior to step (b). In an embodiment of any of the above methods, the nave B cell population can be isolated from secondary lymphoid organs such as for example and not limitation, the spleen or lymph nodes, or peripheral blood mononuclear cells (PBMCs), or can be induced from hematopoietic stem/progenitor cells isolated from, e.g., bone marrow or cord blood.
[0096] In an embodiment of any of the above methods, the CD40L is presented on an artificial/synthetic T follicular helper cell (sT.sub.FH). In another embodiment, the sT.sub.FH comprises a microbead or microcarrier. In one embodiment, the CD40L is bound to the microbead or microcarrier. In one embodiment, the sT.sub.FH comprises a microbead coated with antibodies, and the CD40L is bound to the sT.sub.FH via a tag designed to interact with the antibodies. In an alternative embodiment, the sT.sub.FH comprises a microbead coated with streptavidin, and the CD40L is bound to the sT.sub.FH via a biotin tag. In a further embodiment, the sT.sub.FH comprises a microbead coated with anti-HA antibodies, and the CD40L is bound to the sT.sub.FH via a HA tag. In yet a further embodiment, the HA-tagged or biotinylated CD40L is present in multivalent form.
[0097] In an embodiment of any of the above methods, the antigen is presented on an artificial/synthetic follicular dendritic cell (sFDC). In another embodiment, the sFDC comprises a microbead or microcarrier. In one embodiment, the antigen is bound to the microbead or microcarrier. In a further embodiment, the sFDC comprises a microbead coated with streptavidin, and the antigen is bound to the sFDC via a biotin tag. In an alternative embodiment, the sFDC comprises a microbead coated with antibodies, and the antigen is bound to the sFDC via a tag designed to interact with the antibodies. In yet a further embodiment, the biotinylated or tagged antigen is present in multivalent form. In still a further embodiment, the biotinylated or tagged antigen is still capable of producing an immune response and/or activating the B cell.
[0098] In an embodiment of any of the above methods, step (b) further comprises adding soluble factors to the synthetic germinal center. In a further embodiment, the soluble factors comprise cytokines (e.g., interleukins such as for example and not limitation, IL-2, IL-4, IL-5, IL-10, IL-21), B cell growth or activation factors (e.g., BAFF), and/or ligands for toll-like receptors (e.g., LPS, CpG).
[0099] In an embodiment of any of the above methods, step (c) comprises centrifugation, fluorescence-activated cell sorting (FACS), magnetic-activated cell sorting (MACS), enzymatic degradation, various filtrations, microfluidic cell sorting, and/or size exclusion chromatography to eliminate dead cells and/or three dimensional structures.
[0100] In an embodiment of any of the above methods, step (c) further comprises purifying antigen-specific B cells. In a further embodiment, step (c) comprises cell sorting (e.g., antibody-based cell sorting such as FACS or MACS), centrifugation, microfluidic cell sorting, various filtrations, and/or size exclusion chromatography.
[0101] In an embodiment of any of the above methods, the antigen-specific B cells are used to treat the disease or condition related to the antigen. For example, B cells that were exposed to the HER2 antigen in step (b) are specific to HER2, can raise an immune response against HER2, and can be used to treat breast cancer, or other cancers associated with the HER2 antigen. Similarly, B cells that were exposed to a streptococcal antigen in step (b) are now capable of recognizing that streptococcal antigen, raising an immune response against it, and thereby treating the streptococcal infection (e.g., strep throat, impetigo, necrotizing fasciitis).
[0102] In an embodiment of any of the above methods, the resulting antigen-specific B cells can be used for adoptive B cell transfer immunotherapy for infectious diseases, cancer, autoimmune diseases; and for the production of human antibodies.
[0103] In an embodiment of any of the above methods, the CD40L is a recombinant CD40L. In another embodiment, the CD40L comprises a protein having SEQ ID NO: 18. In a further embodiment, the CD40L is tagged such that it associates with the microbead. In a specific embodiment, the CD40L comprises a protein having SEQ ID NO: 19.
[0104] Antigen Presentation
[0105] In any of the methods described above, the antigen can be presented in a soluble form or associated with a three-dimensional structure. For example and not limitation, the antigen may be associated with (e.g., bound to) a microbead (e.g., magnetic or paramagnetic microbead, polymeric microbead, polystyrene microbead, collagen bead, or glass microbead), and/or a 3-D scaffold, such as for example and not limitation, a microcarrier.
[0106] In any of the methods described above, the antigen may further be presented in a multivalent form.
[0107] In any of the methods described above, the three-dimensional support may comprise a lipid bilayer or synthetic cell membrane.
[0108] CD40 Presentation
[0109] In any of the methods described above, the CD40L can be presented in a soluble form or associated with a three-dimensional structure. For example and not limitation, the CD40L may be associated with (e.g., bound to) a microbead (e.g., magnetic or paramagnetic microbead, polymeric microbead, or glass microbead), and/or a 3-D scaffold, such as for example and not limitation, a microcarrier.
[0110] In any of the methods described above, the CD40L may further be presented in a multivalent form.
[0111] In any of the methods described above, the three-dimensional support may comprise a lipid bilayer or synthetic cell membrane.
[0112] Antigens Useful in the Disclosure
[0113] Antigens that can be utilized in the methods disclosed above include, for example and not limitation, antigens associated with and/or specific to cancers/tumors, infectious diseases, inflammatory and autoimmune diseases. The antigens may also be specific to the patient/subject from whom the B cells are isolated. Antigens include, for example and not limitation, proteins, lipids, glycolipids, nucleic acids, glycoproteins, peptides, etc.
[0114] Non-limiting examples of such cancers/tumors include, e.g., breast cancer (HER2, VGEFR), pancreatic cancer, liver cancer, lung cancer, prostate cancer, colon cancer, renal cancer, bladder cancer, head and neck carcinoma, thyroid carcinoma, soft tissue sarcoma, ovarian cancer, primary or metastatic melanoma, squamous cell carcinoma, basal cell carcinoma, brain cancers of all histopathologic types, angiosarcoma, hemangiosarcoma, bone sarcoma, fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma, testicular cancer, uterine cancer, cervical cancer, gastrointestinal cancer, mesothelioma, Ewing's tumor, leiomyosarcoma, Ewing's sarcoma, rhabdomyosarcoma, carcinoma of unknown primary (CUP), squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, Waldenstroom's macroglobulinemia, papillary adenocarcinomas, cystadenocarcinoma, bronchogenic carcinoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilms' tumor, lung carcinoma, epithelial carcinoma, testicular tumor, glioma, glioblastoma, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, meningioma, retinoblastoma, leukemia, neuroblastoma, small cell lung carcinoma, bladder carcinoma, lymphoma, multiple myeloma, medullary carcinoma, B cell lymphoma, T cell lymphoma, NK cell lymphoma, large granular lymphocytic lymphoma or leukemia, gamma-delta T cell lymphoma or gamma-delta T cell leukemia, mantle cell lymphoma, myeloma, leukemia, chronic myeloid leukemia, acute myeloid leukemia, chronic lymphocytic leukemia, acute lymphocytic leukemia, hairy cell leukemia, hematopoietic neoplasias, thymoma, sarcoma, non-Hodgkin's lymphoma, Hodgkin's lymphoma, Epstein-Barr virus (EBV) induced malignancies of all types including but not limited to EBV-associated Hodgkin's and non-Hodgkin's lymphoma, all forms of post-transplant lymphomas including post-transplant lymphoproliferative disorder (PTLD), uterine cancer, renal cell carcinoma, hepatoma, hepatoblastoma, etc.
[0115] Non-limiting examples of infectious diseases include, e.g., bacterial diseases, viral diseases, fungal diseases, protozoal/parasitic diseases, etc.
[0116] Non-limiting examples of inflammatory and autoimmune diseases include, e.g., inflammatory bowel disease (IBD), graft-versus host disease (GVHD), ulcerative colitis (UC), Crohn's disease, diabetes (e.g., diabetes mellitus type 1), multiple sclerosis, arthritis (e.g., rheumatoid arthritis), Graves' disease, lupus erythematosus, ankylosing spondylitis, psoriasis, Behcet's disease, autistic enterocolitis, Guillain-Barre Syndrome, myasthenia gravis, pemphigus vulgaris, acute disseminated encephalomyelitis (ADEM), transverse myelitis autoimmune cardiomyopathy, Celiac disease, dermatomyositis, Wegener's granulomatosis, allergy, asthma, contact dermatitis, atherosclerosis (or any other inflammatory condition affecting the heart or vascular system), autoimmune uveitis, as well as other autoimmune skin conditions, autoimmune kidney, lung, or liver conditions, autoimmune neuropathies, etc.
[0117] Non-limiting examples of bacterial diseases include, e.g., Lyme disease, granuloma inguinale, bacterial vaginosis, gonorrhea, syphilis, congenital syphilis, mycobacterium avium complex, melioidosis, anthrax, leptospirosis, whooping cough, leprosy, tetanus, plague, bubonic plague, pneumonic plague, scarlet fever, streptococcal infections, invasive Group A streptococcal disease, streptococcal toxic shock syndrome, meningococcal disease, bacteremia, strep throat, cholera, dysentery, amebic dysentery, shigellosis, diphtheria, cutaneous diphtheria, respiratory diphtheria, Legionnaires' disease, tuberculosis, latent tuberculosis, Hemophilus influenzae B infection, typhoid fever, Rocky Mountain spotted fever, vibrio infections, yersiniosis, Whipple's disease, bacterial digestive infections, acute appendicitis, meningitis, bacterial meningitis, encephalitis, impetigo, cellulitis, carbuncle, boil, acne, sepsis, septicemia, pneumonia, ptomaine food poisoning, Salmonella food poisoning, Staphylococcal infection, Staphylococcus aureus food poisoning, botulism food poisoning, E. coli food poisoning, rheumatic fever, brucellosis, ehrlichiosis, psittacosis, relapsing fever, diarrheagenic Escherichia coli, listeriosis, scombrotoxic fish poisoning, trachoma. Chlamydia pneumonia infections, Mycoplasma pneumoniae infections, mycobacterial infections, Q fever, STARI, Yaws, actinomycosis, Lymphogranuloma venereum, conjunctivitis, prostatitis, pericarditis, abscess, endocarditis, myelitis, osteomyelitis, dermatitis, fever, pertussis, urinary tract infection, etc.
[0118] Non-limiting examples of viral diseases include, e.g., common cold, chickenpox, flu (influenza), herpes, human immunodeficiency virus (HIV/AIDS), human papillomavirus (hpv), infectious mononucleosis, mumps, measles, rubella, shingles, viral gastroenteritis (stomach flu), viral hepatitis (Hepatitis A, Hepatitis B, and/or Hepatitis C), viral meningitis, viral pneumonia, Herpes simplex virus 1 infection, Herpes simplex virus 2 infection, Kaposi sarcoma, multicentric Castleman disease, Reye syndrome, poliomyelitis, rabies, etc.
[0119] Non-limiting examples of fungal diseases include, e.g., aspergillosis, blastomycosis, candidiasis, coccidioidomycosis (Valley fever), Cryptococcus neoformans infection, Cryptococcus gattii infection, keratitis, endophthalmitis, histoplasmosis, mucormycosis, Pneumocystis pneumonia, ringworm, sporotrichosis, Exserohilum and Cladosporium infections, etc.
[0120] Non-limiting examples of protozoal/parasitic diseases include, e.g., Acanthamoeba infection, granulomatous amebic encephalitis, Naegleria infection, amoebiasis, giardiasis, African sleeping sickness, Leishmaniasis, toxoplasmosis, malaria, babesiosis, trichomoniasis, Chagas disease, trypanosomiasis, ancylostomiasis, cercarial dermatitis, filariasis, lymphatic filariasis, enterobiasis, roundworm infection, hookworm infection, tapeworm infection, whipworm infection, onchocerciasis, etc.
EXAMPLES
[0121] The present invention is also described and demonstrated by way of the following examples. However, the use of these and other examples anywhere in the specification is illustrative only and in no way limits the scope and meaning of the invention or of any exemplified term. Likewise, the invention is not limited to any particular preferred embodiments described here. Indeed, many modifications and variations of the invention may be apparent to those skilled in the art upon reading this specification, and such variations can be made without departing from the invention in spirit or in scope. The invention is therefore to be limited only by the terms of the appended claims along with the full scope of equivalents to which those claims are entitled.
Example 1Development of Ex Vivo System
[0122] Ligation of CD40 by Either Soluble Anti-CD40 Antibody or Soluble Recombinant CD40L (CD154) Induces Incomplete B Cell Activation and GC Reaction.
[0123] For effective activation of B cells in the GC reaction, both CD40-CD40L (CD154) interaction and the soluble factors secreted by T.sub.FH and FDCsincluding interleukins (e.g. IL-4) and B cell activating factor (BAFF)provide critical signals.sup.13. (
[0124] Microbead-Based Artificial T.sub.FH Design Presenting CD40L with a Controlled Surface Density Effectively Induced sGC Reaction.
[0125] In order to induce effective crosslinking of CD40 while leveraging the natural CD40-CD40L ligation, a microbead-based artificial T.sub.FH cell was designed using recombinant CD40L tagged with HA peptide and iron oxide microbeads coated with anti-HA antibodies (
[0126] The unique advantage of such a biomaterial-based sGC design is that critical reaction parameters can be quantitatively controlled and tested. Specifically, it was investigated how the sGC reaction can be modulated by controlling the dose of CD40L, the surface density of CD40L, and the ratio of B cells to artificial T.sub.FH microbeads. sGC reaction conditions using soluble CD40L, with or without the soluble crosslinking antibody, were also tested for direct comparisons. First, the dose of CD40L was optimized by testing a range of densities over several orders of magnitudefrom 0.1 to 100 ng ml.sup.1 per 10.sup.5 cells. Microbeads were coated with CD40L molecules at a maximum density, approximately 2.710.sup.4 molecules m.sup.2. To achieve the maximum dose (100 ng ml.sup.1 for 10.sup.5 cells), approximately 100 microbeads per B cell were needed. Two different methods were employed to test lower dosesfirst by lowering the cell to bead ratio while keeping the maximum CD40L surface density constant, and second by lowering the CD40L surface density while keeping the cell to bead ratio constant (at 1 to 100). B cell expansion, measured by live cell count on Day 6 of sGC culture (
[0127] Next, using flow cytometry, the CSR and differentiation status of the B cells harvested at Day 6 of each sGC culture was investigated. First, the use of microbeads-bound CD40L as artificial T.sub.FH significantly improved the CSR, compared to the soluble systems (
[0128] Second, the differentiation status of resulting B cells was also tested by checking the expression of typical GC B cell markers, GL7+Fas+ and CD38-CD80+(
[0129] It is noteworthy that this sGC reaction was also successfully applicable to B cells isolated from PBMCs (
[0130] IL-4 Induced sGC B Cells are Transcriptionally Similar to Centrocytes and Commit to Plasma Cell Lineage Upon Incubation in IL-21.
[0131] The transcriptional programs involved in the sGC B cell differentiation process were investigated by using real-time quantitative PCR (RT-PCR) analysis. First, the expression level of activation induced cytidine deaminase (AICDA or AID), which is known to be highly expressed in GC B cells and is involved in both CSR and SHM, was tested..sup.14-16 As expected, sGC B cells expressed high levels of AICDA mRNA within 3 days of culture, compared to nave follicular B cells as well as antigen-specific natural GC (nGC) B cells isolated 2 weeks after vaccination (
[0132] In a separate experiment, it was observed that switching the exogenous cytokine from IL-4 to IL-21 on Day 3 of sGC culture (sGC_421) enhanced the IgG1-expressing populations and the plasma cell marker, CD138-positive populations, compared to maintaining IL-4 for the whole sGC culture period of 6 days (sGC_44) (
[0133] Altogether, the sGC B cells induced under IL-4 seem to be able to undergo AICDA-dependent GC reactions such as CSR and SHM, and rapidly differentiate into a centrocyte-like state by suppressing BCL6 activity. Upon switching cytokine environment from IL4 to IL-21, AICDA is down-regulated and differentiation commitment into plasma cell lineage is greatly enhanced.
[0134] Enriched Populations of Functional Antigen-Specific B Cells were Effectively Induced by sGC Reaction Following Fluorescence Activated Cell Sorting (FACS).
[0135] In order to fully recapitulate the induction of antigen-specific humoral immunity as a result of physiological GC reactions, the selection of B cell populations containing antigen-specific immunoglobulin membrane receptors were tested by use of fluorescence activated cell sorting (FACS). Whole protein ovalbumin (OVA) was first chosen as a model antigen, for which two labeling strategies were tried: i) labeling with unmodified OVA followed by FITC-conjugated rabbit polyclonal anti-OVA antibodies (Abcam); ii) labeling with OVA-tetramers formed between custom prepared biotinylated OVA and PE-conjugated streptavidin. The first strategy takes advantage of commercially available anti-OVA antibodies. Meanwhile, it is theoretically possible to apply the second labeling strategy to any antigen of interest. However, this method carries a risk of losing some natural epitopes of a protein antigen if the amino acid within an epitope is used for the biotin-modification. Nevertheless, both strategies typically yielded 0.2% cells of spleen isolated nave B cell populations that are positively stained at a varying degree of fluorescence signal with the antigen. This population is a mixture of nave B cell clones that possess membrane immunoglobulin receptors with mixed levels of affinity toward the antigen. For the selection of a B cell population with receptors towards a more defined epitope, peptide-tetramers of an H-2b-restricted class II OVA epitope, OVA (323-339, ISQAVHAAHAEINEAGR (SEQ ID NO: 1)) were used. The peptide-tetramer was freshly prepared by incubation of PE-streptavidin with excess of N-terminal biotin-labeled OVA peptide followed by purification steps. Using this tetramer of a single OVA epitope, the fraction of positive staining nave B cell population is reduced to 0.02%0.1%, as expected.
[0136] Using these fluorescence-labeling strategies, the antigen-specific B cell populations were enriched via FACS before introducing them to sGC cultures. Without FACS enrichment, the staining pattern after 6 days of sGC reaction was not very different from the staining pattern of nave B cells (
[0137] Microbead Surface-Bound Antigen Presentation During sGC Reaction Selectively Increased the Fraction of Antigen-Specific B Cell Population.
[0138] In a physiological GC, B cells are given opportunities to survey the antigens presented by follicular dendritic cell. Those B cells that possess antigen-specific B cell receptors (BCRs) bind to, internalize, and process (degrade) the antigen, and further present the antigenic epitopes to the T cells in a major histocompatibility complex-restricted manner. This antigen-BCR interaction and cell-cycle-dependent subsequent signaling enables the clonal selection and proliferation of antigen-specific B cells by either enhancing survival of high-affinity B cells.sup.11 or by better antigen presentation to the T cells.sup.12. Thus, it was tested how presenting antigens in the described sGC reaction affects the antigen-specific populations. First, the size of OVA-specific B cell populations after 6 days of sGC cultures with or without the presence of soluble OVA antigens were compared. When 2 g ml.sup.1 of monomeric soluble OVA was added to sGC reactions, the OVA-specific populations grew to 1.76% compared to 0.26% without OVA during the culture (6 times increase,
[0139] Even though BCRs can directly bind to soluble antigens, B cells in in vivo GC encounter a majority of antigens either as integral components of a membrane or in Fc- or complement receptor-tethered forms on the membrane of follicular dendritic cells (FDCs).sup.24-26. Thus, simple artificial FDCs were developed for surface-bound presentation of OVA by incubating streptavidin-coated microbeads with biotinylated OVA molecules. The resulting artificial FDC surface presented OVA molecules in a maximum density of approximately 8.410.sup.4 molecules m.sup.2. Neither soluble nor bead-bound OVA brought about a significant increase in the size of OVA-specific population, up to 100 ng ml.sup.1, compared to that without using OVA. However, at the maximum dose tested, 1 g ml.sup.1, soluble and bead presentation of OVA yielded 2.4 and 18 times higher OVA-specific populations compared to no-OVA-in-culture conditions, respectively (
[0140] sGC Culture Induced Somatic Hypermutation Leading to a Potential Affinity Maturation.
[0141] As a critical outcome of GC reactions, B cell containing high-affinity BCRs toward a specific antigen are selectively expanded to become long-lived plasma cells and memory B cells. In GCs, this affinity maturation of B cells is achieved by repeated cycles.sup.27 of cell division and hypermutation of IgV region genes.sup.28,29 under selective pressure toward higher affinity BCRs. In order to test if a similar affinity maturation can be induced during a sGC reaction, it was decided to limit the model antigen to a single epitope, peptide OVA 323-339. Without the FACS enrichment, the pOVA specific population comprised only about 0.2 to about 0.5% of the total B cells after sGC reaction with the concurrent use of pOVA-tetramer in culture (
[0142] To study the antigen-driven effects, it was decided to enrich the pOVA specific populations by use of FACS before sGC reactions. As shown above, FACS enrichment gave rise to more than 10% of pOVA specific cells after 6 days of sGC cultures. It was intriguing that high-fluorescence staining populations emerged only from the culture with pOVA-tetramer (
[0143] Next, a next-generation sequencing technology (454 Sequencing, Roche) was employed to investigate the occurrence of mutations in the heavy chain of resulting BCRs from sGC reactions. For the two pOVA-specific B cell populations harvested from sGC reactions, with or without the tetrameric pOVA during the cultures, a total of 1,644 sequences were acquired, representing 6 different VH gene families and 85 clones with shared CDR3 junctions. For each population, only productive, full-length heavy chain sequences were analyzed. The sequences acquired using forward primer (5 VHE) were analyzed separately from the sequences acquired using reverse primer (3 C). Thus the forward sequencing data represent potentially all isotype classes, while the reverse sequencing data were IgM-specific. Interestingly, when the average number of mutations per sequence were calculated for each dataset, the forward sequencing data from the sGC culture with tetrameric pOVA gave rise to a significantly high number (8.83), compared to the others (forward sequencing data without the antigen (3.31), IgM-specific sequencing data with and without the antigen, 1.65 and 3.19, respectively) (
[0144] When the ratio of transitions to transversions was examined in each dataset, transition mutations were favored over transversion mutations in both sGC B cell samples as well as in natural GC B cells, while the detected mutations in the Pre-B cell sample were quite randomly distributed and were more than likely simply sequencing artifacts (
[0145] Even though it is unlikely, there remained a nominal possibility that the mutations found in isotype-switched IgGs came from the expansion of B cell clones that originally had possessed physiologically induced mutations (before Day 0 of sGC culture). In order to evaluate whether the ex vivo ligation of CD40L induced new mutations during sGC cultures, a B1-8 mouse model was employed, where a knock-in IgHV186.2 (IgV1-72) gene segment produces NP-specific antibody when paired with 1 light chains. By employing FACS-sorted 1+ B1-8 B cells, a large number of B cells that originated from the single germ-line IgHV gene sequence could be analyzed. As the investigators could not isolate detectable mRNAs of IgGs from the nave B cells directly isolated from B1-8 mice (8-12 week old, non-vaccinated, kept under a pathogen-free condition), IgM sequences of nave B cells were first analyzed as the starting population on Day 0 and compared with sequences acquired from newly generated IgG chains on Day 6 of sGC culture. It was consistent that the average number of mutations per sequence observed in IgG chains is consistently higher than the number acquired form IgM chains (
[0146] Altogether, these results indicate that sGC cultures clearly can induce a higher frequency of mutations in the Ig V region, mimicking the AID-targeted SHM that occurs in the physiological GCs, from which high affinity B cell populations can emerge when cultured with presentation of multimeric epitopes.
[0147] Adoptively Transferred sGC B Cells Engrafted in the Secondary Lymphoid Organs, Maintaining their Centrocyte or Memory B Phenotypes.
[0148] If the B cells generated from the described sGC reaction can be adoptively transferred, such method could potentially serve as a novel autologous cell therapy regimen for the induction of long-term antigen-specific humoral immunity. In order to test the feasibility of this method, approximately 110.sup.7 CFSE-loaded B cells were adoptively transferred from a 6-day sGC culture into non-irradiated syngeneic mice. The spleen and lymph nodes were harvested 4 days after the adoptive B cell transfer (ABCT). In flow cytometry analyses, both the spleen and the pooled lymph nodes harvested from the mice after ABCT contained higher number of CFSE-positive cells compared to the control mice without the ABCT (
[0149] In order to track the adoptively transferred sGC B cells for a longer period, sGC B cells were generated expressing genetic marker (CD45.1+) and transferred them into non-lethally irradiated (6.5 Gy) congenic host mice intravenously. After 4 weeks, donor-derived B cells (CD45.1+CD19+) were evidently detected both in the spleen and in the lymph nodes (
DISCUSSION
[0150] Previously, engagement of CD40 molecules on B cells using soluble anti-CD40 or CD40L were widely used to activate B cells without comprehensive studies on their potential usage in artificial GC reactions. Here, it was found that both of these approaches were only partially effective in recapitulating the GC reaction, i.e., the anti-CD40 antibody can induce isotype class switching in the activated B cells with minimal cell expansion and minimal expression of GC B cell phenotypes, while soluble CD40L enabled quite effective expansion and differentiation into GC-like B cells but only with minimal isotype class switching. In fact, CD40 engagement in B cells induces various biological outcomes including survival of B cells, expression and down-regulation of various surface proteins, production of numerous cytokines and chemokines, in addition to promoting germinal center formation.sup.34, which are achieved by activation of multiple pathways including NF-B, MAPK, and STAT3.sup.35. Multiple factors mediate these complex activation pathways by direct or indirect interactions with CD40 molecules.sup.36,37, and it is likely that different methods of engagement for CD40 might induce an equal variety of gene expression profiles. In vivo, CD40L is expressed as a homotrimer on plasma membrane.sup.2,38, and it was shown that clustering of membrane-bound CD40L molecules is necessary for CD40-medicated B cell activation.sup.39. However, the 18 kDa soluble form of CD40L (which also naturally arises from proteolytic processing), as well as all of monomeric, dimeric and trimeric forms of soluble CD40L, bind to CD40 molecules on the B cell membrane and activate the B cells at a certain level..sup.4,40
[0151] The described system of modifying microbeads with CD40L in a defined and controllable molecular density, mimicking T.sub.H cells, is a rational approach to controlling the quality and quantity of CD40-mediated B cell activation. The results herein demonstrate that varying doses of CD40L on artificial T.sub.H cells can effectively modulate the proliferation of B cells, CSR, and the expression of GC B cell phenotypes. Some optimal conditions to induce all of these canonical GC functions ex vivo have also been successfully determined. Together with RT-PCR analysis, it is demonstrated herein that this sGC reaction activates B cells to differentiate into the rapidly proliferating cytoblast-like cells in the initial phase, and then quickly differentiate into the centrocyte-like B cells in which downregulation of BCL6 initiates various signaling pathways.sup.20. As early as 3 days following sGC culture, a significant transcriptional upregulation of AICDA, which induces CSR and SHM, is observed. At this point, a small fraction of sGC centrocytes start committing into the plasma cell lineage (CD138+) with a transcriptional upregulation of PRDM1, which is enhanced by switching the cytokine environment from IL-4 to IL-21.sup.21. Notably, suppression of apoptosis by BCL6 is rapidly reduced in the sGC culture. Therefore, a novel culture strategy where antigen-presentation occurs for an optimal period of the centroblast stage for an extended survival and expansion, followed by provision of artificial T.sub.FH signals for induction of centrocyte stage, or even where these stepwise reactions are alternated, could be encompassed herein. In the same vein, artificial presentation of other molecular signals that are present in the immunological synapse between B cell and T cell such as adhesion, co-stimulatory, and accessory receptors and ligands.sup.41 can be utilized in the described methods for better induction and maintenance of in vitro GC reactions.
[0152] In order to examine, recapitulate, and leverage the generation of antigen-specific B cells, a critical attribute of GC reactions, ex vivo, fluorochrome-conjugated multimers of whole protein model antigen OVA as well as a single B cell epitope peptide of OVA were used for detection and isolation of B cell populations with the corresponding BCR specificity.sup.42-46 using flow cytometry. Using the described sGC reaction in conjunction with an isolation of antigen-specific B cells by FACS, highly enriched antigen-specific GC-like B cells were able to be routinely generated.
[0153] Without an extraneous enrichment step, simply including the soluble antigen in the sGC culture enhanced the fraction of antigen-specific B cell populations in a dose dependent manner. A more pronounced enhancement in the fraction of antigen-specific B cell population was achieved by providing the antigen in a surface-bound form on microbeads. In the described sGC reaction, CD40L and BAFF are provided in a nonselective manner regardless of the B cells' affinity toward the model antigen. Thus, this observed enhancement of a selective population of antigen-specific B cells is most likely due to the additional survival and proliferative signals provided by BCR-antigen interaction, which effectively mimic the selective survival and proliferation of GC B cells upon binding of their BCRs to antigen presented by FDCs.sup.47,48. As the concentration of antigen required for triggering effective BCR signaling is inversely proportional to the affinity toward the antigen.sup.49, the observed antigen-dose-dependent increase of antigen-specific B cells might be due to the BCR-dependent activation of lower affinity B cells with an increasing amount of antigen up to a certain threshold.
[0154] Moreover, it is intriguing that a B cell population that is highly stained with pOVA tetramers was repeatedly observed to emerge in flow cytometry only when FACS-enriched antigen specific B cells were cultured in sGC conditions with pOVA tetramer in the culture. This brighter fluorescence could be due to either expression of higher number or BCRs or increased BCR affinity. While there is no simple explanation for the higher expression of BCRs in these centrocyte-like B cells, there are feasible mechanisms for the emergence of B cell populations with higher affinity BCRs. First, this could be the result of advantageous signals for survival and proliferation provided by BCR-antigen interactions to the high affinity B cell clones. Above, the same rationale was applied to account for the selective increase in antigen specific populations after sGC reactions in the presence of antigen even without the FACS enrichment step. The FACS enrichment step prior to the sGC culture simply made the selective increase in higher affinity B cells more visible. In this scenario, the presence of tetrameric epitope was essential to induce BCR-antigen affinity-dependent survival/proliferation signaling. Alternatively, the increase in BCR affinity toward the antigen could also be introduced to the antigen-specific B cell populations as a result of somatic hypermutation (SHM) of the immunoglobulin (Ig) genes. In the GC, affinity maturation of the antibody responses is enabled by SHM of the variable regions of immunoglobulin genes.sup.50,51 and subsequent selection of higher-affinity B cell clones.sup.52. Similarly to CSR, SHM is known to be driven by AID (AICDA), which is largely expressed in GC B cells.sup.14-16. As previously described, RT-PCR analysis confirmed that AICDA mRNA expression is highly upregulated in the described sGC culture, even higher than in the natural GC B cells. Further, it was previously reported that SHM can be induced in vitro when the surface BCRs are cross-linked in the presence of help from cognate T cells.sup.53,54. From the high-throughput sequencing analyses for the V region gene of peptide-OVA-positive B cell clones as shown herein, B cells emerging from sGC reactions with the addition of tetrameric peptide OVA epitope showed a significantly higher number of mutations within their potentially isotype-switched Ig heavy chains. Among the increased number of mutations, transition mutations were much more favored over the transversion mutations, mimicking AID-initiated physiological SHMs.sup.30. An equivalent result was acquired from the sequencing of NP-positive sGC B cells. Compared to the pre-B cell control group in which the observed mutations might dominantly originate from spontaneous random mutations or other sequencing errors, lacking active SHM present, NP-specific sGC B cells showed higher number of mutations per sequence, with transitions favored over transversions.
[0155] Interestingly, a similar enhancement of mutations was observed within the NP-specific sGC B cells cultured in the absence of NP-CGG, even though the enhancement of mutations was slightly lower than the sGC B cells cultured in the presence of antigen. Whether this observation is due to the effect of residual NP-BSA-biotin labeling in the initial FACS step, or due to the BCR cross-reactivity of NP-specific B cells to the bovine serum proteins in the culture media, or to another cause, is unclear at this point. Nevertheless, in further analyses of the distribution of mutations, the described sGC B cells as well as the natural GC B cells show an increase in replacement mutations (those that alter the amino acid sequence) in the complementarity determining regions (CDRs) over those found in the frameworks (FRs), a hallmark of antigen-driven selection. In the present sGC model, artificial T-cell help signals are universally provided, thus this selection of higher affinity B cells is most likely not due to the competition in uptake of antigen for better presentation to the T cells.sup.10. Instead, the BCR-antigen interaction could provide not only selective signals for better proliferation and survival but could also enhance the number of mutations in Ig genes, which also positively correlates to the number of cell division. By analyzing mutation patterns of large number of B cells that share a common germline IgHV gene sequence IgHV 186.2, it is demonstrated herein that the mutations detected within the isotype-switched IgV chains are the mutations that are newly acquired and accumulated during the ex vivo culture, regardless of presence of antigen (
[0156] Lastly, the clonal lineage trees formulated from peptide-OVA and NP-specific sequences show no more than 5 generations of accumulated mutations, and the majority of mutated sequences are within 3 generations from the germline sequences (
[0157] Recently, cellular immunotherapies such as the adoptive transfer of antigen-specific T cells have been actively pursued for treatment of viral infections and multiple cancers including relapsed hematologic malignancies. CD40-activated B cells have been proposed either as effective antigen presenting cells (APCs) to augment T cell immunotherapies.sup.55-57 or themselves as effector cells in cancer adoptive immunotherapies.sup.8,57,58. It was encouraging to observe that the resulting B cells from the described sGC reaction had migrated to and engrafted within the secondary lymphoid organs upon adoptive transfer into the non-irradiated syngeneic and non-lethally irradiated congenic host mice. Further, the isotype-switched donor B cells maintained Fas+ and CD80.sup.hi GC B cell phenotypes for a short period (1 week), and survived for a long term (at least up to the tested period of 4 weeks) as latent B cells. Altogether, the described sGC cultured antigen-specific B cells show a tremendous potential as an alternative or an adjunct immunotherapy regimen to the costly development of monoclonal antibody drugs and T cell adoptive therapies against cancers and infections.sup.59,60 for which no effective treatments are currently available.
[0158] Methods.
[0159] Mice and Isolation of Nave B Cells.
[0160] All experiments were performed using the B cells isolated from 8-12 week old C57BL/6J or C57BL/6-CD45.1 (B6.SJL-Ptprc.sup.a Pepc.sup.b/BoyJ) mice purchased from the Jackson Laboratory (ME, USA). B1-8 mice were originally received from Dr. Garnett Kelsoe (Duke University), and have been inbred by the Jacob lab. All mice were maintained in the Georgia Institute of Technology or Emory University (B1-8) animal facility under pathogen-free conditions. Procedures involving mouse were under protocols approved by the IACUC of the Georgia Institute of Technology. From the spleen, single-cell suspensions of white blood cells were prepared by simply pushing the spleen through a 40 micron cell strainer (Falcon) and incubation in ammonium chloride RBC lysis buffer (eBioscience). For the PBMC, blood was drawn by cardiac puncture from a sacrificed mouse and directly diluted in PBS with 2 mM EDTA. The PBMC were collected from the interfacial layer after a density-gradient centrifugation using Histopaque (Sigma). From these single cell suspensions, nave B cells were further purified using a negative magnetic sorting (B cell isolation kit, Miltenyi). After depletion of cells labelled with monoclonal antibodies against CD43, CD4, and Ter-119, the resulting cell suspension typically consist of more than 97% of B cells (
[0161] sGC Cell Culture.
[0162] In a typical sGC cell culture, purified nave B cells (10.sup.5 cells per well) were cultured in a 24-well tissue culture plate (Corning) in RPMI-1640 medium (Gibco) supplemented with 10% FBS (Sigma), 1 mM sodium pyruvate, 10 mM HEPES, 5.510.sup.5 M -ME, 100 units ml.sup.1 penicillin, and 100 g ml.sup.1 streptomycin (Gibco). Murine recombinant IL-4 (20 ng ml.sup.1, Peptrotech) and BAFF (50 ng ml.sup.1, R&D Systems) were added in the initial culture medium and supplemented in every 2-3 days. For sGC_421 culture, IL-4 was replaced by murine recombinant IL-21 (10 ng ml.sup.1, Peptrotech) on day 3. The CD40-CD40L ligation conditions and addition of model antigens were varied as specified in the text. For the initial comparative test for soluble CD40L vs. anti-CD40 antibody, CD40L (E61-L260, R&D Systems) or anti-CD40 antibody (clone 1C10, eBioscience) was used at 1 g ml.sup.1. For the direct comparison between soluble CD40L and microbead-bound CD40L, recombinant murine CD40L (M112-L260; SEQ ID NO: 18) with N-terminal HA tag (YPYDVPDYA (SEQ ID NO: 2) was employed. For the crosslinking of soluble CD40L, mouse anti-HA peptide antibody (clone 543851, R&D Systems) was added at 1 g ml.sup.1. The microbeads with surface-bound CD40L molecules (SEQ ID NO: 19) were prepared as artificial T.sub.FH cells freshly, not more than 3 hours before initial application to sGC cell culture. Superparamagnetic microbeads (diameter of 1 m) with covalently attached anti-HA peptide antibody (Pierce) were washed by repeating magnetic precipitation (DynaMag, Invitrogen) and resuspension in fresh PBS for at least 3 times, before incubation with CD40L molecules for 2 hours at 4 C. under rotation. For the exact control for surface density of CD40L, the binding capacity of CD40L molecules to microbeads was determined by measuring protein concentration (absorbance at 280 nm) of supernatant before and after incubation with microbeads. The dose of microbead-bound CD40L was controlled as specified in the main text for the direct comparison to the equivalent dose of soluble CD40L. In all the other subsequent sGC cultures, microbeads were employed as artificial T.sub.FH cells with surface density of approximately 510.sup.3 m.sup.2 and maintained for the cell to beads ratio of 1:101:50, unless otherwise specified. The live B cell number was counted using hemocytometer with trypan blue dye exclusion. All cultures were performed in a humidified atmosphere at 37 C. with 5% CO.sub.2.
[0163] Flow Cytometry and FACS.
[0164] Cells suspended in PBS supplemented with 0.5% (w/v) BSA and 2 mM EDTA were incubated with anti-CD16/CD32 monoclonal antibody (clone 93, eBioscience) and simultaneously stained with combinations of the following antibodies: FITC-, PE-, PE-Cy7, or APC-conjugated anti-mouse CD19, IgM, IgE, IgG1, CD45R (B220), CD80 (B7.1), CD138, CD3c, CD11b, GL7 (Ly77), CD38, and CD95 (Fas) (eBioscience). Typically, 0.1 to 0.5 g of antibody was used for staining of approximately 10.sup.510.sup.7 cells in 100 l. For the control staining experiment for OVA-specific B cells, the cells were first incubated with OVA (1 g ml.sup.1), washed two times, and stained with FITC-conjugated rabbit polyclonal anti-OVA antibody (Abcam). The live cells were gated out from the dead cells and the microbeads based on FSC versus SSC. The positive gating was made based on the negative and/or isotype staining controls. All samples were analyzed using a Accuri C6 or LSR II (BD Biosciences), and fluorescence-activated cell sorting (FACS) was performed using FACSAria III cell sorter (BD Biosciences). The data were analyzed suing FlowJo software.
[0165] Detection and Enrichment of Antigen-Specific B Cells.
[0166] The model antigen protein OVA (Hyglos) was biotinylated using reaction with sulfo-NHS-LC-biotin (Pierce), followed by purification (Zeba spin desalting columns with 7000 MWCO, Pierce) and lyophilization. Using HABA assay (Pierce), the level of biotin incorporation was measured and the number of biotin per modified OVA molecule was determined to be 2.65. For the detection and FACS of OVA-specific B cells, multimeric OVA was freshly prepared by incubation of biotinylated OVA with PE- or APC-conjugated streptavidin in 4:1 molar ratio for 30 min at 4 C. The incubated protein mixture was directly added into cell suspensions for the flow cytometry at 110 g ml.sup.1 per 10.sup.6 cells. For the preparation of microbeads with surface-bound OVA molecules, streptavidin-coated superparamagnetic beads (Dynabeads with a diameter of 2.8 m, Invitrogen) was incubated with biotinylated OVA for 1 hour at 4 C. with rotation after preparative washing steps. The loading of OVA onto the microbeads was confirmed by measuring protein concentration (absorbance at 280 nm) of supernatant before and after incubation with microbeads, and the surface density was calculated accordingly. For a model peptide epitope, N-terminal biotinylated OVA 323-339 (biotin-ISQAVHAAHAEINEAGR (SEQ ID NO: 1)) was purchased from AnaSpec and used without further purification. For pOVA tetramer formation, 1 volume of 100 M pOVA stock solution in DMSO was slowly added into 4 volume of 2 M PE-streptavidin (eBioscience) or non-conjugated streptavidin (Pierce) in PBS and incubated for 2 hours at 4 C. with rotation, which was followed by repeated purification by filtration (Amicon Ultra, MWCO 10k, EMD Millipore). For staining of pOVA-specific population, 310 nM of pOVA-tetramer was used per 10.sup.6 cells. For detection and sorting of NP-specific B cells, NP.sub.5BSA-Biotin (Biosearch Technologies) were directly added to B cell suspensions at 110 g ml.sup.1 per 10.sup.6 cells. Following 20 min incubation at 4 C., cells were washed 3 times before subsequently incubated with PE-conjugated streptavidin for 30 min at 4 C. Upon washing, the B cells were analyzed.
[0167] RT-PCR Analysis.
[0168] RNA from each sorted B cell population was prepared with RNeasy kit (Qiagen). The cDNA was prepared by using SuperScript III First-Strand Synthesis kit and Oligo(dT).sub.20 (Invitrogen). Quantitative real-time PCR was performed using RT.sup.2 SYBR Green qPCR Mastermix (Qiagen) and a Step One Plus Real-Time PCR System (Applied Biosystems). Gene expression was normalized to that of -actin (ACT), and a fold difference of the normalized values relative to that of follicular B cells are reported (2 to the power of CT). All the gene-specific primers for AICDA, BCL6, PRDM1, and -actin were purchased from Qiagen and used without further purification steps.
[0169] Elispot Assays.
[0170] OVA-specific antibody secreting cells (ASCs) generated by sGC cell cultures were detected and quantified by ELISPOT assay on a 96-well MultiScreenHTS-IP filter plate (Millipore). The plate was coated with 10 g ml.sup.1 OVA for overnight at 4 C. The cells harvested from sGC culture were washed twice before a defined number of cells were added to each well in triplicate for at least three orders of serial dilution with complete RPMI-1640 cell culture media as described above. After overnight incubation in a humidified atmosphere at 37 C. with 5% CO.sub.2, anti-OVA IgM and anti-OVA IgG1 spots were detected by AP-conjugated goat anti-mouse IgM and IgG1 antibodies (Southern Biotech) in conjunction with Vector Blue AP substrate (Vector Laboratories). The image of wells were acquired using CTL-ImmunoSpot plate reader (Cellular Technology Limited).
[0171] Immunization for Generation of NP-Specific Natural Germinal Center B Cells.
[0172] 812 week old mice were immunized with 100 g of NP.sub.45-CGG mixed with Alum (2% Alhydrogel, Brenntag Biosector) intraperitoneally. 2 weeks after vaccination, NP+, CD19+, CD43, GL7+, Fas+ physiological GC B cells were isolated from the spleen via FACS.
[0173] Next Generation Sequencing.
[0174] The pOVA- or NP-positive B cells were sorted by FACS upon 6-day sGC cultures. The total RNA from each sample was purified using RNeasy kit (Qiagen). From the RNA, cDNA was synthesized using random hexamers and Superscript III or AccuScript High Fidelity reverse transcriptase (Agilent Technologies) for sequencing experiment for pOVA- and NP-specific B cells, respectively. From the cDNA, mouse Ig heavy chain V region gene transcripts were amplified by two rounds of semi-nested PCR. The PCR reaction scheme and the basic primer designs were adapted from the previous literature.sup.61 and slightly modified. The adapted primers originally designed by examining published Ig gene segment nucleotide sequences from the IGMT, the international ImMunoGeneTics information system (www.imgt.org) and NCBI (www.ncbi.nlm.nih.gov/igblast/) databases were modified with the 454 Sequencing adaptor sequences and multiplex identifiers (MIDs) (Table 1). All PCR reactions were performed in a total reaction volume of 50 l per reaction containing 4 l of cDNA from the previous RT-PCR as template, 200 nM each primer, 300 M each dNTP (Invitrogen) and 1.5 U HotStar Taq DNA polymerase (Qiagen) or Q5 Hot Start High-Fidelity DNA polymerase (New England Biolabs) for pOVA- and NP-specific B cells, respectively. The first round of PCR was performed at 94 C. for 15 min followed by 50 cycles of 94 C. for 30 seconds, 56 C. for 30 seconds, 72 C. for 55 seconds, and final incubation at 72 C. for 10 minutes. Semi-nested second round PCR was performed with 4 l of unpurified first round PCR product with the same reaction mixture at 94 C. for 15 minute followed by 50 cycles of 94 C. for 30 seconds, 60 C. for 30 seconds, 72 C. for 45 seconds, and final incubation at 72 C. for 10 minutes. The resulting PCR products were analyzed on 2% agarose gels, which clearly showed DNA bands corresponding to heavy chain genes with IgGs and IgM isotype. The DNA were purified from the cutout bands using Gel Extraction Kit (Qiagen). The next-generation sequencing was performed using 454 Sequencing System (Roche). All analyses for the resulting sequences were performed using IMGT/highV-Quest. The sequences showing V region identity of less than 90%, fewer than 200 base pairs, or unproductive protein translations were excluded from the analyses. Ig lineage trees were produced using IgTree software.sup.62, information for which can be found at immsilico2.lnx.biu.ac.il/Software.html. Clones were identified by their CDR3 sequences and aligned with the germline variable sequence as identified by IGMT/highV-Quest.
TABLE-US-00001 TABLE1 Thelistofprimerdesignsemployedfortworoundsofsemi-nested PCRforamplificationofmouseIgheavychainVregiongenetranscripts.Forthe2.sup.nd roundofPCR,adaptorsequencesusedin454SequencingSystem(.sup.a)andmultiplex identifiers(.sup.b)wereaddedontothetemplatespecificprimersequences(.sup.c). 1.sup.st Primer PCR Name PrimerSequence(5 to3) 5 MsVHE GGGAATTCGAGGTGCAGCTGCAGGAGTCTGG(SEQIDNO:3) 3 C outer AGGGGGCTCTCGCAGGAGACGAGG(SEQIDNO:4) 3 C1outer 2.sup.nd Primer TemplateSpecific PCR Name 454Adaptor.sup.a MID.sup.b Primer.sup.c Modification 5 CGTATCGCCT ACGAGTGCG GGGAATTCGAGG MsVHE-1 CCCTCGCGCC T(SEQIDNO: TGCAGCTGCAGG ATCAG(SEQ 8) AGTCTGG(SEQ IDNO:6) IDNO:3) 5 CGTATCGCCT ACGCTCGAC GGGAATTCGAGG MsVHE-2 CCCTCGCGCC A(SEQIDNO: TGCAGCTGCAGG ATCAG(SEQ 9) AGTCTGG(SEQ IDNO:6) IDNO:3) 3 C CTATGCGCCT ACGAGTGCG AGGGGGAAGAC 5 inner-1 TGCCAGCCCG T(SEQIDNO: ATTTGGGAAGGA biotinylation CTCAG(SEQ 8) C(SEQIDNO:10) IDNO:7) 3 C CTATGCGCCT ACGCTCGAC AGGGGGAAGAC 5 inner-2 TGCCAGCCCG A(SEQIDNO: ATTTGGGAAGGA biotinylation CTCAG(SEQ 9) C(SEQIDNO:10) IDNO:7) 3 C1 CTATGCGCCT ACGAGTGCG GCTCAGGGAAAT 5 inner-1 TGCCAGCCCG T(SEQIDNO: AGCCCTTGAC biotinylation CTCAG(SEQ 8) (SEQIDNO:11) IDNO:7) 3 C1 CTATGCGCCT ACGCTCGAC GCTCAGGGAAAT 5 inner-2 TGCCAGCCCG A(SEQIDNO: AGCCCTTGAC biotinylation CTCAG(SEQ 9) (SEQIDNO:11) IDNO:7)
[0175] Adoptive Transfer.
[0176] sGC B cells were derived by sGC_44 cultures for 56 days. For a short-term tracking of the transferred syngeneic B cells, the sGC cells were loaded with CFSE (Molecular Probes) by incubation in 5 M CFSE for 15 min at room temperature followed by washing and incubation in complete RPMI-1640 medium for 10 min at room temperature. The microbeads and dead cells were sequentially depleted from the cell suspension using a magnetic precipitation (DynaMag, Invitrogen) and negative MACS sorting by Dead Cell Removal Kit (Miltenyi) applied on LS column (Miltenyi), respectively. Approximately 110.sup.7 purified cells suspended in 200 ul of physiological saline per mouse were injected into mice via tail vein. For the short-term syngeneic or the long-term congenic transfer experiments, sGC B cells derived from C57BL6/J or C57BL6-CD45.1 mice were transferred into C57BL6/J mice (CD45.2+) with or without the non-lethal irradiation (6.5 Gy), respectively. 4 days or 4 weeks after injections, B cells isolated from pooled lymph nodes (inguinal, axillary, and brachial) and the spleen of the recipient mice and control mice were analyzed by flow cytometry and immunofluorescence microscopy.
[0177] Immunofluorescence Microscopy.
[0178] The inguinal lymph nodes harvested from the recipient mice embedded in O.C.T. compound (Sakura) were frozen in liquid nitrogen and kept at 80 C. Frozen sections (7 m thick) were fixed in cold acetone for 1 min. After washing 3 times with PBS, the sections were incubated with a blocking buffer (eBioscience) for 2 hours at room temperature. The sections were stained with 5 g ml-1 anti-CD4-eFluor570 (eBioscience) and anti-CD45R-APC (eBioscience) in TBS with 1% BSA for 4 hours at 4 C. After 3 times of rinsing with 5 minute gentle agitation in TBS containing 0.025% Triton-X and 3 times of final washing with TBS, the sections were mounted with ProLong Gold antifade medium (Molecular Probes). All the samples were examined using Zeiss LSM 700 confocal microscope (Zeiss).
[0179] Statistical Analysis.
[0180] The Student's t-test was performed for verification of statistical significance. For multiple group comparison, ordinary one-way ANOVA analyses followed by Tukey's test were performed using GraphPad Prism software.
SEQUENCE LISTING
[0181]
TABLE-US-00002 SEQ ID NO: Type Source Sequence 1 Protein Synthetic ISQAVHAAHAEINEAGR 2 Protein Synthetic YPYDVPDYA 3 DNA Synthetic GGGAATTCGAGGTGCAGCTGCAGGAGTCTGG 4 DNA Synthetic AGGGGGCTCTCGCAGGAGACGAGG 5 DNA Synthetic GGAAGGTGTGCACACCGCTGGAC 6 DNA Synthetic CGTATCGCCTCCCTCGCGCCATCAG 7 DNA Synthetic CTATGCGCCTTGCCAGCCCGCTCAG 8 DNA Synthetic ACGAGTGCGT 9 DNA Synthetic ACGCTCGACA 10 DNA Synthetic AGGGGGAAGACATTTGGGAAGGAC 11 DNA Synthetic GCTCAGGGAAATAGCCCTTGAC 12 DNA Synthetic CGTATCCCTCCCTCGCGCCATCAGACACGAGTGCGTGG GAATTCGAGGTGCAGCTGCAGGAGTCTGG 13 DNA Synthetic CGTATCGCCTCCCTCGCGCCATCAGACACGCTCGACAG GGAATTCGAGGTGCAGCTGCAGGAGTCTGG 14 DNA Synthetic CTATGCGCCTTGCCAGCCCGCTCAGACGAGTGCGTAGG GGGAAGACATTTGGGAAGGAC 15 DNA Synthetic CTATGCGCCTTGCCAGCCCGCTCAGACGCTCGACAAGG GGGAAGACATTTGGGAAGGAC 16 DNA Synthetic CTATGCGCCTTGCCAGCCCGCTCAGACGAGTGCGTGCTC AGGGAAATAGCCCTTGAC 17 DNA Synthetic CTATGCGCCTTGCCAGCCCGCTCAGACGCTCGACAGCTC AGGGAAATAGCCCTTGAC 18 Protein Synthetic IEKKIEAIEKKIEAIEKKIEAIEKKIEAGGGSGGGSGGGSMQ RGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNL VMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVG LWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQ AGASVFVNVTEASQVIHRVGFSSFGLLKL 19 Protein Synthetic YPYDVPDYAIEKKIEAIEKKIEAIEKKIEAIEKKIEAGGGSG GGSGGGSMQRGDEDPQIAAHVVSEANSNAASVLQWAKK GYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNR EPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSV HLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL
REFERENCES
[0182] 1 Banchereau, J., Depaoli, P., Valle, A., Garcia, E. & Rousset, F. Long-Term Human B-Cell Lines Dependent on Interleukin-4 and Antibody to Cd40. Science 251, 70-72, doi:DOI 10.1126/science.1702555 (1991). [0183] 2 Hollenbaugh, D. et al. The human T cell antigen gp39, a member of the TNF gene family, is a ligand for the CD40 receptor: expression of a soluble form of gp39 with B cell co-stimulatory activity. The EMBO journal 11, 4313-4321 (1992). [0184] 3 Spriggs, M. K. et al. Recombinant human CD40 ligand stimulates B cell proliferation and immunoglobulin E secretion. The Journal of experimental medicine 176, 1543-1550 (1992). [0185] 4 Mazzei, G. J. et al. Recombinant soluble trimeric CD40 ligand is biologically active. The Journal of biological chemistry 270, 7025-7028 (1995). [0186] 5 Cocks, B. G., Malefyt, R. D., Galizzi, J. P., Devries, J. E. & Aversa, G. I1-13 Induces Proliferation and Differentiation of Human B-Cells Activated by the Cd40-Ligand. International immunology 5, 657-663, doi:DOI 10.1093/intimm/5.6.657 (1993). [0187] 6 Arpin, C. et al. Generation of Memory B-Cells and Plasma-Cells in-Vitro. Science 268, 720-722, doi:DOI 10.1126/science.7537388 (1995). [0188] 7 Nojima, T. et al. In-vitro derived germinal centre B cells differentially generate memory B or plasma cells in vivo. Nature communications 2, 465, doi:10.1038/ncomms1475 (2011). [0189] 8 Moutai, T., Yamana, H., Nojima, T. & Kitamura, D. A novel and effective cancer immunotherapy mouse model using antigen-specific B cells selected in vitro. PloS one 9, e92732, doi:10.1371/journal.pone.0092732 (2014). [0190] 9 Purwada, A. et al. Ex vivo engineered immune organoids for controlled germinal center reactions. Biomaterials 63, 24-34, doi:10.1016/j.biomaterials.2015.06.002 (2015). [0191] 10 Zhang, Y. et al. Germinal center B cells govern their own fate via antibody feedback. The Journal of experimental medicine 210, 457-464, doi:10.1084/jem.20120150 (2013). [0192] 11 Anderson, S. M. et al. Taking advantage: high-affinity B cells in the germinal center have lower death rates, but similar rates of division, compared to low-affinity cells. Journal of immunology 183, 7314-7325, doi:10.4049/jimmunol.0902452 (2009). [0193] 12 Khalil, A. M., Cambier, J. C. & Shlomchik, M. J. B Cell Receptor Signal Transduction in the GC Is Short-Circuited by High Phosphatase Activity. Science 336, 1178-1181, doi:10.1126/science.1213368 (2012). [0194] 13 Kalled, S. L. Impact of the BAFF/BR3 axis on B cell survival, germinal center maintenance and antibody production. Semin Immunol 18, 290-296, doi:10.1016/j.smim.2006.06.002 (2006). [0195] 14 Muramatsu, M. et al. Class switch recombination and hypermutation require activation-induced cytidine deaminase (AID), a potential RNA editing enzyme. Cell 102, 553-563 (2000). [0196] 15 Revy, P. et al. Activation-induced cytidine deaminase (AID) deficiency causes the autosomal recessive form of the Hyper-IgM syndrome (HIGM2). Cell 102, 565-575 (2000). [0197] 16 Peled, J. U. et al. The biochemistry of somatic hypermutation. Annu Rev Immunol 26, 481-511, doi:10.1146/annurev.immunol.26.021607.090236 (2008). [0198] 17 Ye, B. H. et al. The BCL-6 proto-oncogene controls germinal-centre formation and Th2-type inflammation. Nat Genet 16, 161-170, doi:10.1038/ng0697-161 (1997). [0199] 18 Dent, A. L., Shaffer, A. L., Yu, X., Allman, D. & Staudt, L. M. Control of inflammation, cytokine expression, and germinal center formation by BCL-6. Science 276, 589-592 (1997). [0200] 19 Basso, K. et al. Tracking CD40 signaling during germinal center development. Blood 104, 4088-4096, doi:10.1182/blood-2003-12-4291 (2004). [0201] 20 Basso, K. & Dalla-Favera, R. BCL6: master regulator of the germinal center reaction and key oncogene in B cell lymphomagenesis. Adv Immunol 105, 193-210, doi:10.1016/S0065-2776(10)05007-8 (2010). [0202] 21 Ding, B. B., Bi, E., Chen, H., Yu, J. J. & Ye, B. H. IL-21 and CD40L synergistically promote plasma cell differentiation through upregulation of Blimp-1 in human B cells. Journal of immunology 190, 1827-1836, doi:10.4049/jimmunol.1201678 (2013). [0203] 22 Shapiro-Shelef, M. et al. Blimp-1 is required for the formation of immunoglobulin secreting plasma cells and pre-plasma memory B cells. Immunity 19, 607-620 (2003). [0204] 23 Angelin-Duclos, C., Cattoretti, G., Lin, K. I. & Calame, K. Commitment of B lymphocytes to a plasma cell fate is associated with Blimp-1 expression in vivo. Journal of immunology 165, 5462-5471 (2000). [0205] 24 Tew, J. G., Kosco, M. H., Burton, G. F. & Szakal, A. K. Follicular dendritic cells as accessory cells. Immunological reviews 117, 185-211 (1990). [0206] 25 Klaus, G. G., Humphrey, J. H., Kunkl, A. & Dongworth, D. W. The follicular dendritic cell: its role in antigen presentation in the generation of immunological memory. Immunological reviews 53, 3-28 (1980). [0207] 26 Batista, F. D., Iber, D. & Neuberger, M. S. B cells acquire antigen from target cells after synapse formation. Nature 411, 489-494, doi:10.1038/35078099 (2001). [0208] 27 Kepler, T. B. & Perelson, A. S. Cyclic Reentry of Germinal Center B-Cells and the Efficiency of Affinity Maturation. Immunol Today 14, 412-415, doi:Doi 10.1016/0167-5699(93)90145-B (1993). [0209] 28 Berek, C., Berger, A. & Apel, M. Maturation of the Immune-Response in Germinal-Centers. Cell 67, 1121-1129, doi:Doi 10.1016/0092-8674(91)90289-B (1991). [0210] 29 Jacob, J., Kelsoe, G., Rajewsky, K. & Weiss, U. Intraclonal Generation of Antibody Mutants in Germinal-Centers. Nature 354, 389-392, doi:Doi 10.1038/354389a0 (1991). [0211] 30 Di Noia, J. M. & Neuberger, M. S. Molecular mechanisms of antibody somatic hypermutation. Annu Rev Biochem 76, 1-22, doi: 10.1146/annurev.biochem.76.061705.090740 (2007). [0212] 31 Dorner, T. et al. Delineation of selective influences shaping the mutated expressed human Ig heavy chain repertoire. Journal of immunology 160, 2831-2841 (1998). [0213] 32 Dadgostar, H. et al. Cooperation of multiple signaling pathways in CD40-regulated gene expression in B lymphocytes. Proceedings of the National Academy of Sciences of the United States of America 99, 1497-1502, doi:10.1073/pnas.032665099 (2002). [0214] 33 Elgueta, R. et al. Molecular mechanism and function of CD40/CD40L engagement in the immune system. Immunological reviews 229, 152-172, doi:10.1111/j.1600-065X.2009.00782.x (2009). [0215] 34 Pype, S. et al. TTRAP, a novel protein that associates with CD40, tumor necrosis factor (TNF) receptor-75 and TNF receptor-associated factors (TRAFs), and that inhibits nuclear factor-kappa B activation. The Journal of biological chemistry 275, 18586-18593, doi:10.1074/jbc.M000531200 (2000). [0216] 35 Brown, K. D., Hostager, B. S. & Bishop, G. A. Differential signaling and tumor necrosis factor receptor-associated factor (TRAF) degradation mediated by CD40 and the Epstein-Barr virus oncoprotein latent membrane protein 1 (LMP1). The Journal of experimental medicine 193, 943-954 (2001). [0217] 36 Armitage, R. J. et al. Molecular and biological characterization of a murine ligand for CD40. Nature 357, 80-82, doi:10.1038/357080a0 (1992). [0218] 37 Grassme, H., Bock, J., Kun, J. & Gulbins, E. Clustering of CD40 ligand is required to form a functional contact with CD40. The Journal of biological chemistry 277, 30289-30299, doi:10.1074/jbc.M200494200 (2002). [0219] 38 Graf, D. et al. A soluble form of TRAP (CD40 ligand) is rapidly released after T cell activation. European journal of immunology 25, 1749-1754, doi:10.1002/eji.1830250639 (1995). [0220] 39 McHeyzer-Williams, M., Okitsu, S., Wang, N. & McHeyzer-Williams, L. Molecular programming of B cell memory. Nat Rev Immunol 12, 24-34, doi:10.1038/nri3128 (2012). [0221] 40 Bardelli, M. et al. Ex vivo analysis of human memory B lymphocytes specific for A and B influenza hemagglutinin by polychromatic flow-cytometry. PloS one 8, e70620, doi:10.1371/journal.pone.0070620 (2013). [0222] 41 Franz, B., May, K. F., Jr., Dranoff, G. & Wucherpfennig, K. Ex vivo characterization and isolation of rare memory B cells with antigen tetramers. Blood 118, 348-357, doi:10.1182/blood-2011-03-341917 (2011). [0223] 42 Moody, M. A. & Haynes, B. F. Antigen-specific B cell detection reagents: use and quality control. Cytometry A 73, 1086-1092, doi:10.1002/cyto.a.20599 (2008). [0224] 43 Newman, J., Rice, J. S., Wang, C., Harris, S. L. & Diamond, B. Identification of an antigen-specific B cell population. J Immunol Methods 272, 177-187 (2003). [0225] 44 Kodituwakku, A. P., Jessup, C., Zola, H. & Roberton, D. M. Isolation of antigen-specific B cells. Immunol Cell Biol 81, 163-170, doi:10.1046/j.1440-1711.2003.01152.x (2003). [0226] 45 Wilker, P. R. et al. Transcription factor Mef2c is required for B cell proliferation and survival after antigen receptor stimulation. Nature immunology 9, 603-612, doi:10.1038/ni.1609 (2008). [0227] 46 Kurosaki, T., Shinohara, H. & Baba, Y. B cell signaling and fate decision. Annu Rev Immunol 28, 21-55, doi:10.1146/annurev.immunol.021908.132541 (2010). [0228] 47 Batista, F. D. & Neuberger, M. S. Affinity dependence of the B cell response to antigen: a threshold, a ceiling, and the importance of off-rate. Immunity 8, 751-759 (1998). [0229] 48 Berek, C., Berger, A. & Apel, M. Maturation of the immune response in germinal centers. Cell 67, 1121-1129 (1991). [0230] 49 Jacob, J., Kelsoe, G., Rajewsky, K. & Weiss, U. Intraclonal generation of antibody mutants in germinal centres. Nature 354, 389-392, doi:10.1038/354389a0 (1991). [0231] 50 Klein, U. & Dalla-Favera, R. Germinal centres: role in B-cell physiology and malignancy. Nat Rev Immunol 8, 22-33, doi:10.1038/nri2217 (2008). [0232] 51 Denepoux, S. et al. Induction of somatic mutation in a human B cell line in vitro. Immunity 6, 35-46 (1997). [0233] 52 Kallberg, E., Jainandunsing, S., Gray, D. & Leanderson, T. Somatic mutation of immunoglobulin V genes in vitro. Science 271, 1285-1289 (1996). [0234] 53 Schultze, J. L. et al. CD40-activated human B cells: an alternative source of highly efficient antigen presenting cells to generate autologous antigen-specific T cells for adoptive immunotherapy. The Journal of clinical investigation 100, 2757-2765, doi:10.1172/JC1119822 (1997). [0235] 54 Wennhold, K., Shimabukuro-Vornhagen, A., Theurich, S. & von Bergwelt-Baildon, M. CD40-activated B cells as antigen-presenting cells: the final sprint toward clinical application. Expert review of vaccines 12, 631-637, doi:10.1586/erv.13.39 (2013). [0236] 55 Li, Q. et al. Adoptive transfer of tumor reactive B cells confers host T-cell immunity and tumor regression. Clinical cancer research: an official journal of the American Association for Cancer Research 17, 4987-4995, doi:10.1158/1078-0432.CCR-11-0207 (2011). [0237] 56 Namm, J. P. et al. B lymphocytes as effector cells in the immunotherapy of cancer. Journal of surgical oncology 105, 431-435, doi:10.1002/jso.22093 (2012). [0238] 57 Klenovsek, K. et al. Protection from CMV infection in immunodeficient hosts by adoptive transfer of memory B cells. Blood 110, 3472-3479, doi:10.1182/blood-2007-06-095414 (2007). [0239] 58 de Wit, J. et al. Antigen-specific B cells reactivate an effective cytotoxic T cell response against phagocytosed Salmonella through cross-presentation. PloS one 5, e13016, doi:10.1371/journal.pone.0013016 (2010). [0240] 59 Tiller, T., Busse, C. E. & Wardemann, H. Cloning and expression of murine Ig genes from single B cells. J Immunol Methods 350, 183-193, doi:10.1016/j.jim.2009.08.009 (2009). [0241] 60 Barak, M., Zuckerman, N. S., Edelman, H., Unger, R. & Mehr, R. IgTree: creating Immunoglobulin variable region gene lineage trees. J Immunol Methods 338, 67-74, doi:10.1016/j.jim.2008.06.006 (2008).
[0242] It is to be understood that the embodiments and claims disclosed herein are not limited in their application to the details of construction and arrangement of the components set forth in the description and illustrated in the drawings. Rather, the description and the drawings provide examples of the embodiments envisioned. The embodiments and claims disclosed herein are further capable of other embodiments and of being practiced and carried out in various ways. Also, it is to be understood that the phraseology and terminology employed herein are for the purposes of description and should not be regarded as limiting the claims.
[0243] Accordingly, those skilled in the art will appreciate that the conception upon which the application and claims are based can be readily utilized as a basis for the design of other structures, methods, and systems for carrying out the several purposes of the embodiments and claims presented in this application. It is important, therefore, that the claims be regarded as including such equivalent constructions.
[0244] All patents, applications, publications, test methods, literature, and other materials cited herein are hereby incorporated by reference in their entirety as if physically present in this specification.