TREATMENTS FOR PRURIGO NODULARIS
20220411518 · 2022-12-29
Inventors
- Valerie JULIA (Biot, FR)
- Jayendra Kumar KRISHNASWAMY (Pully, CH)
- Christophe PIKETTY (Montargis, FR)
- Francois ROUSSEAU (Publier, FR)
Cpc classification
A61K39/395
HUMAN NECESSITIES
C12Q2600/106
CHEMISTRY; METALLURGY
C07K16/2866
CHEMISTRY; METALLURGY
C12Q1/6883
CHEMISTRY; METALLURGY
International classification
Abstract
Described herein are treatments and preventions for prurigo nodularis (PN), antibodies and pharmaceutical compositions for use in the treatment or prevention of PN, and uses of an anti-IL-31RA antibody (e.g., nemolizumab) in the manufacture of a medicament for the treatment or prevention of PN. Also described herein are biomarkers of PN and methods of altering or improving these biomarkers via treatments with an antibody that binds to IL-31RA (e.g., nemolizumab).
Claims
1. A method of treating or preventing prurigo nodularis (PN) in a subject, comprising administering to a subject with PN an anti-IL-31RA antibody, wherein the subject differentially expresses at least one gene selected from the genes disclosed in Table 1 compared to a reference level of expression for the at least one gene.
2. A method of normalizing differentially expressed genes (DEGs) in a subject with PN, comprising administering to a subject with PN an anti-IL-31RA antibody, wherein the subject differentially expresses at least one gene selected from the genes disclosed in Table 1 compared to a reference level of expression for the at least one gene and wherein administration of the anti-IL-31RA antibody normalizes the expression level of the at least one gene.
3. The method of claim 2, wherein normalization is determined about 4 weeks after administration of the anti-IL-31RA antibody.
4. The method of claim 1, wherein differential expression of the at least one gene was determined by RT-qPCR, RT-PCR, RNA-seq, Northern blotting, Serial Analysis of Gene Expression (SAGE), or DNA or RNA microarrays; or wherein differential expression of the at least one gene was determined at protein level by Western blotting, ELISA, surface plasmon resonance, or mass spectrometry.
5. The method of claim 1, wherein at least two, at least three, at least four, or at least five genes disclosed in Table 1 are differentially expressed.
6. The method of claim 1, wherein the differentially expressed gene(s) are selected from KRT6C, DEFB4A, KRT16, LCE5A, AQP7, IL36A, IL36G, IL19, IL20, IL22, IL24, and IL26.
7. The method of claim 1, wherein KRT6C, DEFB4A, and/or KRT16 are overexpressed compared to a reference level of expression.
8. The method of claim 1, wherein LCE5A and/or AQP7 are under expressed compared to a reference level of expression.
9. The method of claim 1, wherein IL1A, IL1B, and/or IL4R are overexpressed compared to a reference level of expression.
10. The method of claim 1, wherein Ki67 (MKI67), CDKN1A, and/or IL-1 and IL-36 are overexpressed in the skin of the subject compared to a reference level of expression.
11. The method of claim 1, wherein the reference level is the level of expression in a person that does not have PN.
12. The method of claim 1, wherein the subject possesses a gene ontology disclosed in Table 2.
13. The method of claim 1, wherein the anti-IL-31RA antibody is administered subcutaneously.
14. The method of claim 1, wherein the anti-IL-31RA antibody is administered once every two to four weeks.
15. The method of claim 1, wherein the anti-IL-31RA antibody is administered at a dose of about 0.01 mg/kg to about 10 mg/kg.
16. The method of claim 1, wherein the anti-IL-31RA antibody is administered at a dose of about 10 mg to about 30 mg about 90 mg.
17. The method of claim 1, wherein the anti-IL-31RA antibody is administered according to a flat dosing regimen.
18. The method of claim 1, wherein the anti-IL-31RA antibody is administered according to a loading dose regimen.
19. The method of claim 1, wherein pruritus scoring is improved in the subject.
20. The method of claim 1, wherein the anti-IL-31RA antibody comprises a heavy chain variable region comprising a HCDR1 comprising SEQ ID NO: 8, a HCDR2 comprising SEQ ID NO: 9, and a HCDR3 comprising SEQ ID NO: 10, and a light chain variable region comprising a LCDR1 comprising SEQ ID NO: 12, a LCDR2 comprising SEQ ID NO: 13, and a LCDR3 comprising SEQ ID NO: 14.
21. The method of claim 1, wherein the anti-IL-31RA antibody is nemolizumab or a fragment or variant thereof.
22. The method of claim 21, wherein the anti-IL-31RA antibody is nemolizumab.
23. A method of normalizing epidermal hyperproliferation and/or normalizing epidermal differentiation in a subject with prurigo nodularis (PN), comprising administering to a subject with PN an anti-IL-31RA antibody, thereby normalizing epidermal hyperproliferation and/or normalizing epidermal differentiation as compared to a person that does not have PN, wherein normalization is determined about 4 weeks after administration of the anti-IL-31RA antibody.
24. (canceled)
25. A method of decreasing an inflammatory Th2 response in the skin of a subject with prurigo nodularis (PN), comprising administering to a subject with PN an anti-IL-31RA antibody, thereby decreasing an inflammatory Th2 response in the skin.
26. The method of claim 25, wherein the inflammatory Th2 response comprises overexpression of IL-13, IL-17A, IL-1, and/or IL-36.
27-45. (canceled)
46. A method of diagnosing prurigo nodularis (PN), comprising detecting in a sample obtained from a subject suspected of having PN the expression level of at least one, at least two, at least three, at least four, or at least five of the differentially expressed genes (DEGs) in Table 1, and comparing the expression level of the DEGs to a reference level, wherein the reference level is the corresponding level of gene expression for each DEG in a sample from an individual that does not have PN.
47-54. (canceled)
55. A method of determining whether a subject with prurigo nodularis (PN) will respond to treatment with an anti-IL-31RA antibody, comprising detecting in a sample obtained from a subject with PN the expression level of at least one, at least two, at least three, at least four, or at least five of the differentially expressed genes (DEGs) in Table 1, and comparing the expression level of the DEGs to a reference level, wherein the reference level is the corresponding level of gene expression for each DEG in a sample from an individual that does not have PN.
56-65. (canceled)
66. A method of determining whether a subject with prurigo nodularis (PN) is responding to treatment with an anti-IL-31RA antibody, comprising detecting in a post-treatment sample obtained from a subject with PN that has been administered at least one dose of an anti-IL-31RA antibody the expression level of at least one, at least two, at least three, at least four, or at least five of the differentially expressed genes DEGs in Table 1, and comparing the expression level of the DEGs to a baseline level of expression, wherein the baseline level of gene expression is from a sample from the same individual before treatment was commenced.
67-77. (canceled)
78. A method of treating or preventing prurigo nodularis (PN) in a subject, comprising administering to a subject with PN an anti-IL-31RA antibody, wherein treatment with the anti-IL-31RA antibody results in: (a) a decrease in migration of leukocytes or cell movement of leukocytes; (b) an inhibition of a STAT3 pathway; (c) an inhibition of a STAT5b pathway; (d) a downregulation of IL-6 or an IL-6 pathway; (e) a downregulation of VEGF or a VEGF pathway; (f) a decrease in TGFB1 pathway activation, or (g) a combination thereof.
79. A method of altering an immune response in a subject with PN, comprising administering to a subject with PN an anti-IL-31RA antibody, wherein administration of the anti-IL-31RA antibody results in: (a) a decrease in migration of leukocytes or cell movement of leukocytes; (b) an inhibition of a STAT3 pathway; (c) an inhibition of a STAT5b pathway; (d) a downregulation of IL-6 or an IL-6 pathway; (e) a downregulation of VEGF or a VEGF pathway; (f) a decrease in TGFB1 pathway activation, or (g) a combination thereof.
80. The method of claim 78, wherein (a) the decrease in migration of leukocytes or cell movement of leukocytes; (b) the inhibition of a STAT3 pathway; (c) the inhibition of a STAT5b pathway; (d) the downregulation of IL-6 or an IL-6 pathway; (e) the downregulation of VEGF or a VEGF pathway; (f) the decrease in TGFB1 pathway activation, or (g) the combination thereof is determined relative to (i) a control sample obtained from an individual or individuals without PN or (ii) a biological sample obtained from the subject prior to administration of the anti-IL-31RA antibody.
81. The method of claim 78, wherein (a) the decrease in migration of leukocytes or cell movement of leukocytes; (b) the inhibition of a STAT3 pathway; (c) the inhibition of a STAT5b pathway; (d) the downregulation of IL-6 or an IL-6 pathway; (e) the downregulation of VEGF or a VEGF pathway; (f) the decrease in TGFB1 pathway activation, or (g) the combination thereof is assessed after about 4 weeks after the administration of the anti-IL-31RA antibody.
82. The method of claim 78, wherein (a) the decrease in migration of leukocytes or cell movement of leukocytes; (b) the inhibition of a STAT3 pathway; (c) the inhibition of a STAT5b pathway; (d) the downregulation of IL-6 or an IL-6 pathway; (e) the downregulation of VEGF or a VEGF pathway; (f) the decrease in TGFB1 pathway activation, or (g) the combination thereof is determined by mass spectrometry performed on one or more biological sample(s) obtained from the subject.
83. The method of claim 82, wherein the one or more biological sample(s) is a plasma sample.
84. The method of claim 78, wherein the subject exhibits at least two of, at least three of, at least four of, at least five of, or all six of (a) the decrease in migration of leukocytes or cell movement of leukocytes; (b) the inhibition of a STAT3 pathway; (c) the inhibition of a STAT5b pathway; (d) the downregulation of IL-6 or an IL-6 pathway; (e) the downregulation of VEGF or a VEGF pathway; (f) the decrease in TGFB1 pathway activation.
85. A method of decreasing an inflammatory response in the plasma of a subject with prurigo nodularis (PN), comprising administering to a subject with PN an anti-IL-31RA antibody.
86-88. (canceled)
89. The method of claim 78, wherein at least 4 weeks after administration of the anti-IL-31RA antibody, the subject additionally exhibits at least two, at least three, or all four of (a) a decrease in migration of leukocytes or cell movement of leukocytes; (b) an inhibition of a STAT3 pathway; (c) an inhibition of a STAT5b pathway; (d) a decrease in TGFB1 pathway activation.
90. The method of claim 78, wherein the subject exhibits a downregulation in a neuronal ontology selected from CREB signaling in neurons, Synaptogenesis signaling pathway, Cell death of neuroglia and Apoptosis of neuroglia, and a combination thereof following administration of the anti-IL-31RA antibody.
91. The method of claim 78, wherein the anti-IL-31RA antibody is administered subcutaneously.
92. The method of claim 78, wherein the anti-IL-31RA antibody is administered once every two to four weeks.
93. The method of claim 78, wherein the anti-IL-31RA antibody is administered at a dose of about 0.01 mg/kg to about 10 mg/kg.
94. The method of claim 78, wherein the anti-IL-31RA antibody is administered at a dose of about 10 mg to about 90 mg.
95. The method of claim 78, wherein the anti-IL-31RA antibody is administered according to a flat dosing regimen.
96. The method of claim 78, wherein the anti-IL-31RA antibody is administered according to a loading dose regimen.
97. The method of claim 78, wherein pruritus scoring is improved in the subject.
98. The method of claim 78, wherein the anti-IL-31RA antibody comprises a heavy chain variable region comprising a HCDR1 comprising SEQ ID NO: 8, a HCDR2 comprising SEQ ID NO: 9, and a HCDR3 comprising SEQ ID NO: 10, and a light chain variable region comprising a LCDR1 comprising SEQ ID NO: 12, a LCDR2 comprising SEQ ID NO: 13, and a LCDR3 comprising SEQ ID NO: 14.
99. The method of claim 78, wherein the anti-IL-31RA antibody is nemolizumab or a fragment or variant thereof.
100. The method of claim 99, wherein the anti-IL-31RA antibody is nemolizumab.
101. A method of determining whether a subject with prurigo nodularis (PN) is responding to treatment with an anti-IL-31RA antibody, comprising detecting in a post-treatment plasma sample obtained from a subject with PN that has been administered at least one dose of an anti-IL-31RA antibody the amount of at least one, at least two, at least three, at least four, or at least five of: (a) a decrease in migration of leukocytes or cell movement of leukocytes; (b) an inhibition of a STAT3 pathway; (c) an inhibition of a STAT5b pathway; (d) a downregulation of IL-6 or an IL-6 pathway; (e) a downregulation of VEGF or a VEGF pathway; (f) a decrease in TGFB1 pathway activation, or (g) a combination thereof; where the decrease or inhibition is measured relative to a baseline amount and the decrease or inhibition indicates responsiveness to treatment, wherein the baseline amount was determined from a plasma sample obtained from the same subject before treatment was commenced.
102-107. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
DETAILED DESCRIPTION
[0081] Described herein are treatments and preventions of prurigo nodularis (PN) using an anti-IL-31RA antibody (e.g., nemolizumab), as well as biomarkers and gene signatures associated with PN that were never previously known. The disclosed biomarkers, which include differentially expressed genes (DEGs), PN-specific gene ontologies (GOs), and other inflammatory and hyperproliferative markers, can be used to identify a subject with PN, determine whether a subject is likely to respond to treatment (e.g., with an anti-IL-31RA antibody), and track a subject's responsiveness to treatment. The disclosed treatments and preventions achieve therapeutic endpoints (e.g., normalizing DEGs, normalizing epidermal hyperproliferation, normalizing epidermal differentiation, and/or decreasing inflammatory responses in the skin) that were not previously known or obtainable with conventional treatments for PN.
I. Definitions
[0082] It is to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting.
[0083] Technical and scientific terms used herein have the meanings commonly understood by one of ordinary skill in the art, unless otherwise defined. Unless otherwise specified, materials and/or methodologies known to those of ordinary skill in the art can be utilized in carrying out the methods described herein, based on the guidance provided herein.
[0084] As used herein, the singular terms “a,” “an,” and “the” include plural referents unless the context clearly dictates otherwise. Reference to an object in the singular is not intended to mean “one and only one” unless explicitly so stated, but rather “one or more.”
[0085] As used herein, “about” when used with a numerical value means the numerical value stated as well as plus or minus 10% of the numerical value. For example, “about 10” should be understood as both “10” and “9-11.”
[0086] Also as used herein, “and/or” refers to and encompasses any and all possible combinations of one or more of the associated listed items, as well as the lack of combinations when interpreted in the alternative (“or”).
[0087] As used herein, a phrase in the form “A/B” or in the form “A and/or B” means (A), (B), or (A and B); a phrase in the form “at least one of A, B, and C” means (A), (B), (C), (A and B), (A and C), (B and C), or (A, B, and C).
[0088] As used herein, the phrase “therapeutically effective amount” with reference to an anti-IL31R antibody (e.g. nemolizumab) means that dose of the antibody that provides the specific pharmacological effect for which the drug is administered in a subject in need of such treatment. A therapeutically effective amount may be effective to reduce, ameliorate, or eliminate itching, scratching, and/or lesion or nodule formation and/or improve quality of life in a subject with PN. It is emphasized that a therapeutically effective amount of an anti-IL31R antibody (e.g. nemolizumab) will not always be effective in treating PN in every individual subject, even though such dose is deemed to be a therapeutically effective amount by those of skill in the art. Those skilled in the art can adjust what is deemed to be a therapeutically effective amount in accordance with standard practices as needed to treat a specific subject. A therapeutically effective amount may vary based on, for example, the age and weight of the subject, and/or the subject's overall health, and/or the severity of the subject's PN.
[0089] The terms “treat,” “treatment” or “treating” as used herein with reference to PN refer to reducing, ameliorating, or eliminating itching, scratching, and/or lesion or nodule formation and/or improving quality of life in a subject with PN.
[0090] The terms “prevent,” “preventing” or “prevention” as used herein with reference to a PN refer to precluding or reducing the risk of developing lesions or nodules or preventing the development of the disclosed biomarker signatures that are associated with PN. Prevention may also refer to the prevention of a PN flare or recurrence once an initial flare has been treated or cured.
[0091] The terms “individual,” “subject,” and “patient” are used interchangeably herein, and refer to any individual mammalian subject, e.g., bovine, canine, feline, equine, or human. In specific embodiments, the subject, individual, or patient is a human.
II. Prurigo Nodularis (PN) and Biomarkers
[0092] Prurigo nodularis (or “PN”) is a skin disease that causes hard, itchy lumps (nodules) to form on the skin. The itching (pruritus) can be intense, causing people to scratch themselves to the point of bleeding or pain. Scratching can cause more skin lesions to appear. The itching is worsened by heat, sweating, or irritation from clothing. In some cases, people with PN have a history of other diseases including eczema (atopic dermatitis), diabetes, lymphoma, HIV infection, severe anemia, or kidney disease. The exact cause of PN was not previously well-understood. It was thought that nodules were more likely to form when skin has been scratched or irritated in some way. Therefore, the act of a person scratching skin can cause the nodules to form. However, the cause of the skin to originally become intensely itchy was unclear.
[0093] Roughly 50% of people with PN have a history of atopy. The main symptom of PN is the formation of hard, very itchy lumps (nodules) on the skin. The nodules can range in size from very small to about half an inch in diameter. The nodules often have a rough, dry top and can range in number from a few to hundreds. Nodules most commonly form on the outer arms, shoulders, and legs. Nodules can also form on the neck and trunk, and they rarely form on the face and palms. They may be lighter or darker in color than the surrounding skin. Scarring may occur after nodules begin to heal. The symptoms of PN can begin at any age but are most common in adults after 50 years. People who have PN may become very concerned about the appearance of the nodules, and the intensely itchy skin may interfere with sleep or with everyday activities. This can cause people with PN to develop stress and depression.
[0094] Pruritus refers to itchy skin and/or an itch sensation. Pruritus may be caused by PN or other diseases or conditions such as dry skin. In some cases, pruritus involves generalized itchy skin over the whole body. In some cases, pruritus is localized to specific regions of the body such as on an arm or leg. Pruritus can be chronic or acute. Symptoms of pruritus include but are not limited to skin excoriations, redness, bumps, spots, blisters, dry skin, cracked skin, and leathery or scaly texture to the skin. In some cases, pruritus does not result in detectable changes to the skin. Behavioral responses to pruritus include but are not limited to skin scratching and/or skin massage. In some cases, skin scratching can result in excoriations that range from mild to severe. In some cases, patients with pruritus abstain from scratching and/or massaging the skin. Traditional treatments for PN include, but are not limited to, skin moisturizers, topical emollients, antihistamines such as diphenhydramine, topical corticosteroids, topical calcineurin inhibitors, and phototherapy. With narrow banded UVB and systemic immunosuppressive drugs like cyclosporine or methotrexate.
[0095] The present disclosure for the first time illuminates underlying gene expression patterns that are associates with PN and may be used to diagnose PN, identify a subject that is likely to respond to treatment (such as treatment with an anti-IL-31RA antibody), and determine whether a subject is properly responding to a treatment.
[0096] In particular, the present disclosure shows that a subject with PN may differentially express at least 5,934 genes (known as differentially expressed genes or DEGs), which are shown in
[0100] Decreased genes include: [0101] LCE5A, which may be decreased at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9-fold, at least 10-fold, or at least 11 fold compared to the expression level in a sample (e.g., a skin sample) from an individual that does not have PN; and [0102] AQP7, which may be decreased at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, or at least 7.9 fold compared to the expression level in a sample (e.g., a skin sample) from an individual that does not have PN.
[0103] Genes that encode cytokines may also be overexpressed in subjects suffering from PN. For the cytokine genes, the most prominent up-regulated genes are IL-36 family members and IL-20 family members. These upregulated or overexpressed genes may include: [0104] IL36A (e.g., about 6.8-fold, FDR=1.8×10.sup.−4); [0105] IL36G (e.g., about 8.4-fold, FDR=3.9×10.sup.−25); [0106] IL19 (e.g., about 5.1-fold, FDR=7.4×10.sup.−4); [0107] IL20 (e.g., about 3.5-fold, FDR=1.7×10.sup.−3); [0108] IL22 (e.g., about 2.7-fold, FDR=2.9×10.sup.−2); [0109] IL24 (e.g., about 5.8-fold, FDR=3.8×10.sup.−10); and [0110] IL26 (e.g., about 4.9-fold, FDR=3.3×10.sup.−3).
Each of these IL-36 and IL-20 family member cytokine genes may be overexpressed by at least about 2-fold, at least about 2.5-fold, at least about 3-fold, at least about 3.5-fold, at least about 4-fold, at least about 4.5-fold, at least about 5-fold, at least about 5.5-fold, at least about 6-fold, at least about 6.5-fold, at least about 7-fold, at least about 7.5-fold, at least about 8-fold, or at least about 8-5-fold compared to the expression level in a sample (e.g., a skin sample) from an individual that does not have PN.
[0111] Other factors that may be upregulated or overexpressed include IL1A (e.g., about 4.7-fold, FDR=1.0×10.sup.−12) and IL1B (e.g., about 4.1-fold, FDR=3.7×10.sup.−6). Additionally, the IL4R gene may be increased by e.g., about 2.6-fold (FDR=6.3×10.sup.−19). Table 1 at the end of the examples section of the specification provides a more exhaustive list of the DEGs.
[0112] In addition to the foregoing genes, the present disclosure also shows that certain plasma markers or signatures may be altered as a result of successful treatment of PN with an anti-IL-31RA antibody, such as nemolizumab. Such markers or signatures are detectable by, for example, by mass spectrometry and other methods of protein assessment (e.g., ELISA, Western blot, etc.). Circulating plasma protein markers or signatures that may be modulated as a result of treatment with an anti-IL-31RA antibody, such as nemolizumab, can include leukocyte migration and cell movement, the IL-6 pathway, the vascular endothelial growth factor (VEGF) pathway, the STAT3 (signal transducer and activator of transcription 3) pathway, the STAT5b (signal transducer and activator of transcription 5b) pathway, the TGFB1 (transforming growth factor beta-1) pathway, and neuronal ontologies.
[0113] The STAT3 pathway, a direct target of IL-31 signaling is also inhibited in the disclosed nemolizumab responder signature, this suggesting target engagement. STAT3 activity and expression may be comparatively high in a subject with PN relative to an individual or population without PN or in the subject prior to commencing treatment with an anti-IL-31RA antibody, such as nemolizumab.
[0114] The amount of circulating pro-inflammatory cytokines may also be comparatively high in a subject with PN relative to an individual or population without PN or in the subject prior to commencing treatment with an anti-IL-31RA antibody, such as nemolizumab. Such pro-inflammatory cytokine signatures can include, but are not limited to, IL-6 and VEGF. In a PN subject that receives treatment with an anti-IL-31RA antibody, such as nemolizumab, the treatment may result in a decrease in one or both of IL-6 and VEGF, or decreases or inhibtio of the IL-6, VEGF, or both signaling pathways relative to a baseline level. The baseline level may be determined relative to (i) a control sample obtained from an individual or individuals (i.e., a population) without PN or (ii) a biological sample obtained from the subject prior to administration of the anti-IL-31RA antibody.
[0115] TGFB1 activity is also inhibited in the disclosed nemolizumab responder signature. TGFB1 activity and expression may be comparatively high in a subject with PN relative to an individual or population without PN or in the subject prior to commencing treatment with an anti-IL-31RA antibody, such as nemolizumab.
[0116] For the purposes of the disclosed plasma protein markers, the amount of the disclosed protein markers in the plasma of a subject with PN may be at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9-fold, at least 10-fold, at least 15-fold, at least 20-fold, at least 25-fold, at least 30-fold, at least 35-fold, at least 40-fold, at least 45-fold, or at least 50-fold higher than a baseline level. The baseline level may be determined relative to (i) a control sample obtained from an individual or individuals (i.e., a population) without PN or (ii) a biological sample obtained from the subject prior to administration of the anti-IL-31RA antibody. Similarly, after a subject with PN is treated with an anti-IL-31RA antibody, such as nemolizumab (e.g., 2 weeks, 4 weeks, 6 weeks, 8 weeks, 10 weeks, or 12 weeks after administration of the antibody), the amount of the disclosed plasma protein markers in the subject may decrease at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9-fold, at least 10-fold, at least 15-fold, at least 20-fold, at least 25-fold, at least 30-fold, at least 35-fold, at least 40-fold, at least 45-fold, or at least 50-fold relative to a baseline level. The baseline level may be determined relative to (i) a control sample obtained from an individual or individuals (i.e., a population) without PN or (ii) a biological sample obtained from the subject prior to administration of the anti-IL-31RA antibody.
[0117] Additionally, neuronal ontologies (e.g., CREB signaling in neurons, Synaptogenesis signaling pathway, Cell death of neuroglia and Apoptosis of neuroglia) may be upregulated in subject with PN, and subsequently downregulated in nemolizumab responders subjects, thus emphasizing the impact of IL-31 as a neuro-inflammatory cytokine in PN.
[0118] Thus, the present disclosure provides methods of diagnosing PN, comprising detecting in a sample obtained from a subject suspected of having PN the expression level of at least one, at least two, at least three, at least four, or at least five of the differentially expressed genes (DEGs) in Table 1 (e.g., KRT6C, DEFB4A, KRT16, LCE5A, AQP7, IL-36 family members, IL-20 family members, etc.) and comparing the expression level of the DEGs to a reference level, which may be based on the gene expression level in a sample (e.g., a skin sample) from an individual that does not have PN. In some embodiments, the sample obtained from the subject suspected of having PN is a skin sample, which may comprise a lesion or a nodule. If certain genes are upregulated or overexpressed (e.g., KRT6C, DEFB4A, KRT16) and/or if other genes are down regulated or under expressed (e.g., LCE5A, AQP7) then the subject may be diagnosed with PN.
[0119] The present disclosure also provides methods of determining the likelihood of a positive response to treatment (e.g., treatment with an anti-IL-31RA antibody, such as nemolizumab) in a subject with PN, comprising detecting in a sample obtained from a subject with PN the expression level of at least one, at least two, at least three, at least four, or at least five of the differentially expressed genes (DEGs) in Table 1 (e.g., KRT6C, DEFB4A, KRT16, LCE5A, AQP7, IL-36 family members, IL-20 family members, etc.) and comparing the expression level of the DEGs to a reference level, which may be based on the gene expression level in a sample (e.g., a skin sample) from an individual that does not have PN. In some embodiments, the sample obtained from the subject with PN is a skin sample, which may comprise a lesion or a nodule. If certain genes are upregulated or overexpressed (e.g., KRT6C, DEFB4A, KRT16) and/or if other genes are down regulated or under expressed (e.g., LCE5A, AQP7) then the subject is likely to respond to the treatment.
[0120] The present disclosure also provides methods of determining whether a subject with PN is responding to treatment (e.g., treatment with an anti-IL-31RA antibody, such as nemolizumab), comprising detecting in a sample obtained from a subject with PN the expression level of at least one, at least two, at least three, at least four, or at least five of the differentially expressed genes (DEGs) in Table 1 (e.g., KRT6C, DEFB4A, KRT16, LCE5A, AQP7, IL-36 family members, IL-20 family members, etc.) and comparing the expression level of the DEGs to a baseline level of expression, wherein baseline level of gene expression is from a sample (e.g., a skin sample) from the same individual before treatment was commenced. In some embodiments, the samples may be skin samples, which may comprise a lesion or a nodule. If the expression levels of certain genes decreases (e.g., KRT6C, DEFB4A, KRT16) and/or if the expression level of other genes increases (e.g., LCE5A, AQP7) then the subject is responding to the treatment.
[0121] The present disclosure also provides methods of determining whether a subject with PN is responding to treatment (e.g., treatment with an anti-IL-31RA antibody, such as nemolizumab), comprising detecting in a post-treatment plasma sample obtained from a subject with PN that has been administered at least one dose of an anti-IL-31RA antibody one or more biomarkers selected from leukocyte migration and cell movement, the IL-6 pathway, the VEGF pathway, the STAT3 pathway, the STAT5b pathway, the TGFB1 pathway, and the disclosed neuronal ontologies; wherein a decrease in leukocyte migration and cell movement, a decrease in IL-6 or a decrease in IL-6 pathway signaling, a decrease in VEGF or a decrease in VEGF pathway signaling, a decrease in STAT3 or a decrease in STAT3 pathway signaling, a decrease in STAT5b or a decrease in STAT5b pathway signaling, a decrease in TGFB1 or a decrease in TGFB1 pathway signaling, or an increase in the disclosed neuronal ontologies relative to a baseline amount indicates responsiveness to treatment, wherein the baseline amount was determined from a plasma sample obtained from the same subject before treatment was commenced.
[0122] The present disclosure also defines for the first time the biological processes that are enriched in PN skin gene ontology (GO). The most prominent GO categories associated with PN are: [0123] “cornified envelope” (FDR=1.5×10.sup.−12), [0124] “epidermal cell differentiation” (FDR=6.4×10.sup.−10), [0125] “keratinization” (FDR=1.6×10.sup.−12), [0126] “peptidase regulator activity” (FDR=1.1×10.sup.−4), [0127] “interleukin-4 and 13 signaling” (FDR=6.8×10.sup.−7), [0128] “interferon alpha/beta signaling” and “response to interferon gamma” (FDR=4.1×10.sup.−7, and FDR=4.1×10.sup.−6, respectively), [0129] “IL23 pathway” (FDR=2×10.sup.−5), and [0130] “mitotic metaphase and anaphase” (FDR=3.8×10.sup.−10).
[0131] These GO categories are defined in more detail by
[0132] The present disclosure also discloses 20 co-expression modules that were identified in non-lesional skin and 10 clusters in lesional PN skin, as shown in
[0133] The present disclosure also provides specific cell-type signatures for non-lesional and lesional PN skin samples. Enrichment for transcriptomic signature associated with epithelial cells and keratinocytes was observed (p<0.001 and p<0.0001, respectively), as shown in
[0134] As shown in
[0135] Thus, the present disclosure provides methods of identifying or diagnosing PN based on gene ontology, co-expression module, and/or gene signature. For example, a subject may present with a PN skin gene ontology (GO) shown in
[0136] The expression levels of the genes and markers disclosed herein can be determined by any suitable methods known in the art, including but not limited to RT-qPCR, RT-PCR, RNA-seq, Northern blotting, Serial Analysis of Gene Expression (SAGE), DNA or RNA microarrays, and in situ hybridization. At the protein level, the disclosed biomarkers may be detected or measured using, for example, Western blotting, ELISA (Enzyme-Linked ImmunoSorbent Assay), surface plasmon resonance, and mass spectrometry.
[0137] Subjects with PN or suspected of having PN that present with any of the disclosed DEGs, gene ontologies, co-expression modules, or gene signatures are suitable for treatment or preventions with an anti-IL-31RA antibody, such as nemolizumab, as described in further detail herein.
[0138] The present disclosure provides a combination of (1) a pharmaceutical composition for use in the treatment or prevention of prurigo nodularis (PN), comprising an anti-IL31RA antibody (e.g., nemolizumab or a fragment or variant thereof), as an active ingredient; and (2) a diagnostic agent which detects in a subject suspected of having PN the expression level of at least one gene selected from the genes disclosed in Table 1 compared to a reference level of expression for the at least one gene.
III. Therapeutic Antibodies and Interleukin 31 Receptor Subunit Alpha (IL-31RA)
[0139] Interleukin-31 (IL-31) is a neuro-inflammatory cytokine that could activate both structural, immune cells and peripheral nerves. It has been involved in a number of chronic inflammatory diseases, including atopic dermatitis. IL-31 is produced by a variety of cells, including type 2 helper (Th2) T-cells. IL-31 sends signals through a receptor complex made of IL-Interleukin 31 receptor subunit alpha (“IL-31RA,” also known as NR10, glm-r, and GPL) and oncostatin M receptor β (OSMRβ) expressed in immune and epithelial cells, as well as in a subset of neurons.
[0140] IL-31RA forms a heterodimer with oncostatin M receptor (OSMR) when functioning as an IL-31 receptor. There are multiple known splicing variants of human-derived IL-31RA (WO 00/075314): NR10.1 consists of 662 amino acids and contains a transmembrane domain. NR10.2 is a soluble receptor-like protein consisting of 252 amino acids without the transmembrane domain. Further, known IL-31RA splicing variants that function as transmembrane receptor proteins include NR10.3 and IL-31RAv3. Preferred IL-31RA variants include NR10.3 (also referred to as ILRAv4 (Nat Immunol 5, 752-60, 2004) and IL-31RAv3. NR 10.3 (IL31RAv4) consists of 662 amino acids (WO 00/075314; Nat Immunol 5, 752-60, 2004) and IL31RAv3 consists of 732 amino acids (GenBank Accession No: NM-139017).
[0141] The amino acid sequence of IL31RAv4 is:
TABLE-US-00001 (SEQ ID NO: 1) MKLSPQPSCVNLGMMWTWALWMLPSLCKFSLAALP AKPENISCVYYYRKNLTCTWSPGKETSYTQYTVKR TYAFGEKHDNCTTNSSTSENRASCSFFLPRITIPD NYTIEVEAENGDGVIKSHMTYWRLENIAKTEPPKI FRVKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRF RTVNSTSWMEVNFAKNRKDKNQTYNLTGLQPFTEY VIALRCAVKESKFWSDWSQEKMGMTEEEAPCGLEL WRVLKPAEADGRRPVRLLWKKARGAPVLEKTLGYN IWYYPESNTNLTETMNTTNQQLELHLGGESFWVSM ISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVA EDQLVVKWQSSALDVNTWMIEWFPDVDSEPTTLSW ESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVG EPYSIQAYAKEGVPSEGPETKVENIGVKTVTITWK EIPKSERKGIICNYTIFYQAEGGKGFSKTVNSSIL QYGLESLKRKTSYIVQVMASTSAGGTNGTSINFKT LSFSVFEIILITSLIGGGLLILIILTVAYGLKKPN KLTHLCWPTVPNPAESSIATWHGDDFKDKLNLKES DDSVNTEDRILKPCSTPSDKLVIDKLVVNFGNVLQ EIFTDEARTGQENNLGGEKNGTRILSSCPTSI
[0142] The amino acid sequence of IL31RAv3 is:
TABLE-US-00002 (SEQ ID NO: 2) MMWTWALWMLPSLCKFSLAALPAKPENISCVYYYR KNLTCTWSPGKETSYTQYTVKRTYAFGEKHDNCTT NSSTSENRASCSFFLPRITIPDNYTIEVEAENGDG VIKSHMTYWRLENIAKTEPPKIFRVKPVLGIKRMI QIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNF AKNRKDKNQTYNLTGLQPFTEYVIALRCAVKESKF WSDWSQEKMGMTEEEAPCGLELWRVLKPAEADGRR PVRLLWKKARGAPVLEKTLGYNIWYYPESNTNLTE TMNTTNQQLELHLGGESFWVSMISYNSLGKSPVAT LRIPAIQEKSFQCIEVMQACVAEDQLVVKWQSSAL DVNTWMIEWFPDVDSEPTTLSWESVSQATNWTIQQ DKLKPFWCYNISVYPMLHDKVGEPYSIQAYAKEGV PSEGPETKVENIGVKTVTITWKEIPKSERKGIICN YTIFYQAEGGKGFSKTVNSSILQYGLESLKRKTSY IVQVMASTSAGGTNGTSINFKTLSFSVFEIILITS LIGGGLLILIILTVAYGLKKPNKLTHLCWPTVPNP AESSIATWHGDDFKDKLNLKESDDSVNTEDRILKP CSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQEN NLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPP RKSQYLRSRMPEGTRPEAKEQLLFSGQSLVPDHLC EEGAPNPYLKNSVTAREFLVSEKLPEHTKGEV
[0143] Mouse-derived IL-31RA comprises the amino acid sequence:
TABLE-US-00003 (SEQ ID NO: 3) MWTLALWAFSFLCKFSLAVLPTKPENISCVFYFDR NLTCTWRPEKETNDTSYIVTLTYSYGKSNYSDNAT EASYSFPRSCAMPPDICSVEVQAQNGDGKVKSDIT YWHLISIAKTEPPIILSVNPICNRMFQIQWKPREK TRGFPLVCMLRFRTVNSSRWTEVNFENCKQVCNLT GLQAFTEYVLALRFRFNDSRYWSKWSKEETRVTME EVPHVLDLWRILEPADMNGDRKVRLLWKKARGAPV LEKTFGYHIQYFAENSTNLTEINNITTQQYELLLM SQAHSVSVTSFNSLGKSQEAILRIPDVHEKTFQYI KSMKAYIAEPLLVVNWQSSIPAVDTWIVEWLPEAA MSKFPALSWESVSQVTNWTIEQDKLKPFTCYNISV YPVLGHRVGEPYSIQAYAKEGTPLKGPETRVENIG LRTATITWKEIPKSARNGFINNYTVFYQAEGGKEL SKTVNSHALQCDLESLTRRTSYTVWVMASTRAGGT NGVRINFKTLSISVFEIVLLTSLVGGGLLLLSIKT VTFGLRKPNRLTPLCCPDVPNPAESSLATWLGDGF KKSNMKETGNSGDTEDVVLKPCPVPADLIDKLVVN FENFLEVVLTEEAGKGQASILGGEANEYVTSPSRP DGPPGKSFKEPSVLTEVASEDSHSTCSRMADEAYS ELARQPSSSCQSPGLSPPREDQAQNPYLKNSVTTR EFLVHENIPEHSKGEV
[0144] Cynomolgus monkey-derived IL-31RA comprises the amino acid sequence:
TABLE-US-00004 (SEQ ID NO: 4) MMWTWALWMFPLLCKFGLAALPAKPENISCVYYYR KNLTCTWSPGKETSYTQYTAKRTYAFGKKHDNCTT SSSTSENRASCSFFLPRITIPDNYTIEVEAENGDG VIKSDMTCWRLEDIAKTEPPEIFSVKPVLGIKRMI RIEWIKPELAPVSSDLKYALRFRTVNSTSWMEVNF AKNRKDTNQTYNLMGLQAFTEYVVALRCAVKESKF WSDWSQEKMGMTEEEAPCGLELWRVLKPTEVDGRR PVRLLWKKARGAPVLEKTLGYNIWYFPENNTNLTE TVNTTNQQLELHLGGESYWVSMISYNSLGKSPVTT LRIPAIQEKSFRCIEVMQACLAEDQLVVKWQSSAL DVNTWMIEWFPDMDSEHPTLSWESVSQATNWTIQQ DKLKPFWCYNISVYPMLHDKVGEPYSIQAYAKEGI PSKGPETKVENIGVKTVTITWKEIPKSERKGIICN YTIFYQAEGGKGFSKTVNSSILQYGLESLKRKTSY TVRVMASTSAGGINGTSINFKTLSFSVFEIILITS LIGGGLLILIILTVAYGLKKPNKLTHLCWPSVPNP AESSIATWRGDDFKDKLNLKESDDSVNTEDRILKP CSTPSDKLVIDKSVVNFGNVLQEMFTDEARTGQEN NLGGEKNEYVTHPFRADCPLGKSFEELPVSPEIPP RKSQYLRSRMPEGTCLEAEEQLLVSGQSLESLAPD HVREAAAPNPYLKNSVTTREFLVSQKLPEHTKGEV
[0145] For the purposes of the present disclosure, an anti-IL-31RA antibody (i.e., a therapeutic antibody), such as nemolizumab, must bind to at least human IL-31RA or a splice variant thereof.
[0146] As used herein, the term “antibody” collectively refers to immunoglobulins or immunoglobulin-like molecules including IgA, IgD, IgE, IgG and IgM, combinations thereof or fragments thereof. Fragments of antibodies may include, for example, Fab fragments and single chain variable fragments (scFv). An antibody generally comprises heavy (H) chains and light (L) chains interconnected by disulfide bonds. There are two types of light chain, lambda (λ) and kappa (κ). There are five main heavy chain classes (or isotypes) which determine the functional activity of an antibody molecule: IgM, IgD, IgG, IgA and IgE. Each heavy and light chain contains a constant region and a variable region (also known as “domains”). In combination, the heavy and the light chain variable regions, also called the “Fab region,” specifically bind to a given antigen. Light and heavy chain variable regions contain a “framework” region interrupted by three hypervariable regions, also called “complementarity-determining regions” or “CDRs.” The extent of the framework region and CDRs has been defined (see Kabat et al., Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 1991). The Kabat database is now maintained online. The sequences of the framework regions of different light or heavy chains are relatively conserved within a species, and framework regions act to form a scaffold that provides for positioning the CDRs in correct orientation by inter-chain, non-covalent interactions.
[0147] The CDRs are primarily responsible for binding to an epitope on an antigen. The CDRs of each chain are typically referred to as CDR1, CDR2, and CDR3, numbered sequentially starting from the N-terminus, and are also typically identified by the chain in which the particular CDR is located. Thus, a HCDR3 is located in the variable domain of the heavy chain of the antibody in which it is found, whereas a LCDR1 is the CDR1 from the variable domain of the light chain of the antibody in which it is found. An antibody that binds IL-31RA will have a specific V.sub.H region and the V.sub.L region sequence, and thus specific CDR sequences. Antibodies with different specificities generally have different CDRs. Although it is the CDRs that vary from antibody to antibody, only a limited number of amino acid positions within the CDRs are directly involved in antigen binding. These positions within the CDRs are called specificity determining residues (SDRs).
[0148] The Fc fragment region (Fc) of an antibody plays a role in modulating immune cell activity. The Fc region functions to guarantee that each antibody generates an appropriate immune response for a given antigen, by binding to a specific class of proteins found on certain cells, such as B lymphocytes, follicular dendritic cells, natural killer cells, macrophages, neutrophils, etc. and are called “Fc receptors.” Because the constant domains of the heavy chains make up the Fc region of an antibody, the classes of heavy chain in antibodies determine their class effects. The heavy chains in antibodies include alpha, gamma, delta, epsilon, and mu, and correlate to the antibody's isotypes IgA, IgG, IgD, IgE, and IgM, respectively. Thus, different isotypes of antibodies have different class effects due to their different Fc regions binding and activating different types of receptors.
[0149] There are four subclasses of IgG, which is the most abundant antibody isotype found in human serum. The four subclasses, IgG1, IgG2, IgG3, and IgG4, which are highly conserved. The amino acid sequence of the constant regions of these peptides are known in the art, e.g., see Rutishauser, U. et al. (1968) “Amino acid sequence of the Fc region of a human gamma G-immunoglobulin” PNAS 61(4):1414-1421; Shinoda et al. (1981) “Complete amino acid sequence of the Fc region of a human delta chain” PNAS 78(2):785-789; and Robinson et al. (1980) “Complete amino acid sequence of a mouse immunoglobulin alpha chain (MOPC 511)” PNAS 77(8):4909-4913.
[0150] All therapeutic antibodies, for the purposes of the disclosed methods and pharmaceutical uses, are antibodies or fragments thereof that bind to IL-31RA, but the specific anti-IL-31RA antibody is not limited. Nemolizumab is a preferred anti-IL-31RA antibody, but other anti-IL-31RA antibodies can be used as well. A therapeutic antibody suitable for use in the disclosed methods and pharmaceutical uses may be human, humanized, or chimeric, and it may be an IgA, IgG (i.e., IgG1, IgG2, IgG3, and IgG4), IgD, IgE, or IgM.
[0151] Nemolizumab is a humanized monoclonal antibody that binds to IL-31RA. Nemolizumab is annotated as follows: immunoglobulin G2-kappa, anti-[Homo sapiens IL31RA (interleukin 31 receptor subunit alpha)], humanized monoclonal antibody; gamma2 heavy chain (1-445) [humanized VH (Homo sapiens IGHV1-2*02 (83.70%)-(IGHD)-IGHJ5*01) [8.8.14] (1-121)-Homo sapiens IGHG2*01 (CH1 C10>S (135), R12>K (137), E16>G (141), S17>G (142) (122-219), hinge C4>S (223) (220-231), CH2 H30>Q (268) (232-340), CH3 R11>Q (355), Q98>E (419) (341-445)) (122-445)], (224-214′)-disulfide with kappa light chain (1′-214′) [humanized V-KAPPA (Homo sapiens IGKV1-39*01 (82.10%)-IGKJ4*01) [6.3.9] (1′-107′)-Homo sapiens IGKC*01 (108′-214′)]; dimer (227-227″:230-230″)-bisdisulfide. Nemolizumab has disulfide bridges at the following locations: Intra-H (C23-C104) 22-96 148-204 261-321 367-425 22″-96″ 148″-204″ 261″-321″ 367″-425″; Intra-L (C23-C104) 23′-88′ 134′-194′ 23′″-88′″ 134′″-194′″; Inter-H-L (h 5-CL 126) 224-214′ 224″-214′″; Inter-H-H (h 8, h 11) 227-227″ 230-230″. Nemolizumab has N-glycosylation sites at the following locations: H CH2 N84.4: 297, 297″. Nemolizumab lacks H chain C-terminal glycine and lysine (CHS G1>del, K2>del).
[0152] Nemolizumab comprises the following heavy chain amino acid sequence:
TABLE-US-00005 (SEQ ID NO: 5) QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYIMN WVRQAPGQGLEWMGLINPYNGGTDYNPQFQDRVTI TADKSTSTAYMELSSLRSEDTAVYYCARDGYDDGP YTLETWGQGTLVTVSSASTKGPSVFPLAPSSKSTS GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP AVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKP SNTKVDKTVERKSCVECPPCPAPPVAGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVD GVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLN GKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYT LPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQEG NVFSCSVMHEALHNHYTQKSLSLSP.
[0153] Nemolizumab comprises the following light chain amino acid sequence:
TABLE-US-00006 (SEQ ID NO: 6) DIQMTQSPSSLSASVGDRVTITCQASEDIYSFVAW YQQKPGKAPKLLIYNAQTEAQGVPSRFSGSGSGTD FTLTISSLQPEDFATYYCQHHYDSPLTFGGGTKVE IKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFY PREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFN RGEC.
[0154] The heavy chain variable region of nemolizumab comprises the amino acid sequence:
TABLE-US-00007 (SEQ ID NO: 7) QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYIMN WVRQAPGQGLEWMGLINPYNGGTDYNPQFQDRVTI TADKSTSTAYMELSSLRSEDTAVYYCARDGYDDGP YTLETWGQGTLVTVSS.
[0155] The HCDR1 of nemolizumab comprises the amino acid sequence GYIMN (SEQ ID NO: 8), the HCDR2 comprises the amino acid sequence LINPYNGGTDYNPQFQD (SEQ ID NO: 9), and the HCDR3 comprises the amino acid sequence DGYDDGPYTLET (SEQ ID NO: 10).
[0156] The light chain variable region of nemolizumab comprises the amino acid sequence:
TABLE-US-00008 (SEQ ID NO: 11) DIQMTQSPSSLSASVGDRVTITCQASEDIYSFVAW YQQKPGKAPKLLIYNAQTEAQGVPSRFSGSGSGTD FTLTISSLQPEDFATYYCQHHYDSPLTFGGGTKVE IKR.
[0157] The LCDR1 of nemolizumab comprises the amino acid sequence QASEDIYSFVA (SEQ ID NO: 12), the LCDR2 comprises the amino acid sequence NAQTEAQ (SEQ ID NO: 13), and the LCDR3 comprises the amino acid sequence QHHYDSPLT (SEQ ID NO: 14).
[0158] For the purposes of this disclosure “variant antibodies” or “variant” of nemolizumab may include, but are not limited to: (i) antibodies with heavy chains comprising at least 55%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% amino acid sequence identity to nemolizumab's heavy chain sequence, (ii) antibodies with light chains comprising at least 55%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% amino acid sequence identity to nemolizumab's light chain sequence, (iii) antibodies with variable regions comprising at least 55%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% amino acid sequence identity to nemolizumab's variable region sequences, (iv) antibodies with CDRs comprising at least 55%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% amino acid sequence identity to nemolizumab's CDR sequences, and (v) combinations thereof. For example, suitable variants include immunoglobulins or immunoglobulin-like molecules with the same or substantially similar heavy and light chain amino acid sequences as nemolizumab. Other suitable therapeutic antibodies may bind to the same isoform of IL-31RA as nemolizumab (e.g., IL31-RAv3), optionally the same epitope of IL-31RA, block or neutralize IL-31RA, or combinations thereof. Additional exemplary therapeutic antibodies are described, for example, in WO 2010/064697.
[0159] Variants of nemolizumab and suitable therapeutic antibodies may be monoclonal or polyclonal antibodies. Such monoclonal antibodies having IL31-RA-binding and/or neutralizing activity can be obtained, for example, by the following procedure: anti-IL31-RA monoclonal antibodies are prepared by using as an antigen IL31-RA or a fragment thereof that is derived from a mammal such as human or mouse by known methods, and then antibodies having IL31-RA-binding and/or neutralizing activity are selected from the thus obtained anti-IL31-RA monoclonal antibodies. Specifically, a desired antigen or cells expressing the desired antigen are used as a sensitizing antigen for immunization according to conventional immunization methods. Anti-IL31-RA monoclonal antibodies can be prepared by fusing the obtained immune cells with known parental cells using conventional cell fusion methods, and screening them for monoclonal antibody-producing cells (hybridomas) by conventional screening methods. Animals to be immunized include, for example, mammals such as mice, rats, rabbits, sheep, monkeys, goats, donkeys, cows, horses, and pigs. The antigen can be prepared using the known IL31-RA gene sequence according to known methods, for example, by methods using baculovirus (for example, WO 98/46777). Variants of nemolizumab and suitable therapeutic antibodies may also include intrabodies, peptibodies, nanobodies, single domain antibodies, multi-specific antibodies (e.g., bispecific antibodies, diabodies, triabodies, tetrabodies, tandem di-scFV, tandem tri-scFv), darpins, heavy chain monomers, heavy chain dimers, or single-domain antibodies (i.e., a V.sub.HH fragment or a “camelid-like” antibody), any of which may be derived from the sequence and/or binding domain of nemolizumab.
[0160] Hybridomas can be prepared, for example, according to the method of Milstein et al. (Kohler, G. and Milstein, C., Methods Enzymol. (1981) 73: 3-46). When the immunogenicity of an antigen is low, immunization may be performed after linking the antigen with a macromolecule having immunogenicity, such as albumin. Antigens used to prepare monoclonal antibodies that have a binding and/or neutralizing activity against human IL31-RA are not particularly limited, as long as they enable preparation of antibodies that have a binding and/or neutralizing activity against human IL31-RA. For example, it is known that there are a number of variants of human IL31-RA, and any variant may be used as an immunogen as long as it enables preparation of antibodies that have a binding and/or neutralizing activity against human IL31-RA. Alternatively, under the same condition, a peptide fragment of IL31-RA or a protein in which artificial mutations have been introduced into the natural IL31-RA sequence may be used as an immunogen. Human IL31-RA.3 is one of preferred immunogens in preparing antibodies that have an activity of binding and/or neutralizing IL31-RA in the present disclosure.
[0161] The IL31-RA-binding activity of therapeutic antibodies can be determined by methods known to those skilled in the art. Methods for determining the antigen-binding activity of an antibody include, for example, ELISA (enzyme-linked immunosorbent assay), EIA (enzyme immunoassay), RIA (radioimmunoassay), and fluorescent antibody method. For example, when enzyme immunoassay is used, antibody-containing samples, such as purified antibodies and culture supernatants of antibody-producing cells, are added to antigen-coated plates. A secondary antibody labeled with an enzyme, such as alkaline phosphatase, is added and the plates are incubated. After washing, an enzyme substrate, such as p-nitrophenyl phosphate, is added, and the absorbance is measured to evaluate the antigen-binding activity. The binding and/or neutralizing activity of a therapeutic antibody against IL31-RA can be measured, for example, by observing the effect of suppressing the growth of the IL-31-dependent cell line. For example, the activity of a purified mouse IL-31 antibody can be assayed by assessing the IL-31-dependent growth of Ba/F3 cells transfected with mouse IL-31 receptor α and mouse OSMR genes.
[0162] Any of the anti-IL31RA antibodies (i.e. “therapeutic antibodies”) disclosed herein, including nemolizumab and fragments or variants thereof, can be used for treating and/or preventing PN and achieving the disclosed therapeutic endpoints. Optimal doses and routes of administration may vary.
IV. Pharmaceutical Compositions
[0163] Provided herein are pharmaceutical compositions for use in the treatment or prevention of prurigo nodularis (PN), including skin lesions or nodules or pruritus caused by PN. The pharmaceutical compositions comprise an anti-IL31RA antibody (i.e. “therapeutic antibody”), such as nemolizumab or a fragment or variant thereof, as an active ingredient.
[0164] The phrase “comprise(s) nemolizumab or a fragment or variant thereof as an active ingredient” means comprising nemolizumab or a fragment or variant thereof as at least one of the active ingredients, and does not limit the proportion of the antibody. In addition, the therapeutic agents for PN in the present disclosure may also comprise, in combination with nemolizumab or a fragment or variant thereof, other ingredients that enhance the treatment or prevention of PN. For example, the composition may comprise one or more topical corticosteroid creams or injections, ointments with menthol or phenol to cool and soothe itchy skin, capsaicin cream, oral corticoseroids, selective serotonin reuptake inhibitors (SSRIs), and oral antihistamines.
[0165] Pharmaceutical compositions of nemolizumab or a fragment or variant thereof of the present disclosure can be prepared as formulations according to standard methods (see, for example, Remington's Pharmaceutical Science, Mark Publishing Company, Easton, USA). The pharmaceutical compositions generally comprise a carrier and/or additive in addition to the antibody. For example, in some embodiments, the pharmaceutical composition comprises one or more surfactants (for example, PEG and Tween), excipients, antioxidants (for example, ascorbic acid), coloring agents, flavoring agents, preservatives, stabilizers, buffering agents (for example, phosphoric acid, citric acid, and other organic acids), chelating agents (for example, EDTA), suspending agents, isotonizing agents, binders, disintegrators, lubricants, fluidity promoters, corrigents, light anhydrous silicic acid, lactose, crystalline cellulose, mannitol, starch, carmelose calcium, carmelose sodium, hydroxypropylcellulose, hydroxypropylmethylcellulose, polyvinylacetaldiethylaminoacetate, polyvinylpyrrolidone, gelatin, medium chain fatty acid triglyceride, polyoxyethylene hydrogenated castor oil 60, sucrose, carboxymethylcellulose, corn starch, and inorganic salt. In some embodiments, the pharmaceutical composition comprises one or more other low-molecular-weight polypeptides, proteins such as serum albumin, gelatin, and immunoglobulin, and amino acids such as glycine, glutamine, asparagine, arginine, and lysine.
[0166] When nemolizumab or a fragment or variant thereof may be prepared as an aqueous solution for injection, in which nemolizumab or a fragment or variant thereof may be dissolved in an isotonic solution containing, for example, physiological saline, dextrose, or other excipients or tonifiers (i.e., tonicity agents). The tonifier may include, for example, D-sorbitol, D-mannose, D-mannitol, and sodium chloride. In addition, appropriate solubilizing agents, for example, alcohols (for example, ethanol), polyalcohols (for example, propylene glycols and PEGs), and non-ionic detergents (polysorbate 80 and HCO-50) may be used concomitantly.
[0167] In some embodiments, nemolizumab or a fragment or variant thereof may be encapsulated in microcapsules (microcapsules made of hydroxymethylcellulose, gelatin, polymethylmethacrylate, and the like), and made into components of colloidal drug delivery systems (liposomes, albumin microspheres, microemulsions, nano-particles, and nano-capsules) (for example, see “Remington's Pharmaceutical Science 16th edition” &, Oslo Ed. (1980)). Moreover, methods for making sustained-release drugs are known, and these can be applied for nemolizumab or a fragment or variant thereof (Langer et al., J. Biomed. Mater. Res. (1981) 15, 167-277; Langer, Chem. Tech. (1982) 12, 98-105; U.S. Pat. No. 3,773,919; European Patent Application (EP) No. 58,481; Sidman et al., Biopolymers (1983) 22, 547-56; EP 133,988).
[0168] The pharmaceutical compositions of the present disclosure can be administered either orally or parenterally, but are preferably administered parenterally. Specifically, the pharmaceutical compositions are administered to patients by injection or percutaneous administration. Injections include, for example, intravenous injections, intramuscular injections, and subcutaneous injections, for systemic or local administration. The pharmaceutical compositions may be given to sites where inflammation and/or itching is to be suppressed, or areas surrounding the sites by local infusion or intramuscular or subcutaneous injection. In some embodiments, the pharmaceutical compositions are administered at the site of one or more skin excoriations, lesions, or nodules, or proximal to the site of one or more skin excoriations, lesions, or nodules.
[0169] The administration methods can be properly selected according to the patient's age, weight, and condition. The single-administration dose can be selected, for example, from within the range of 0.0001 to 100 mg of the antibody (e.g., nemolizumab or a fragment or variant thereof) per kg body weight. Alternatively, for example, when the antibody is administered to human patients, the dose of the antibody can be selected from within the range of 0.001 to 1,000 mg/kg body weight. In some embodiments, the composition is formulated to administer a dose containing, for example, about 0.01 to 50 mg/kg, about 0.01 mg/kg to about 0.1 mg/kg, about 0.05 mg/kg to 0.15 mg/kg, about 0.1 mg/kg to about 0.6 mg/kg, about 0.1 mg/kg to about 1 mg/kg, about 0.25 mg/kg to about 0.75 mg/kg, about 0.4 mg/kg to about 0.8 mg/kg, about 0.4 mg/kg to about 1.8 mg/kg, about 0.5 to about 2.5 mg/kg, about 0.8 mg/kg to about 2.2 mg/kg, about 1 mg/kg to about 2.5 mg/kg, about 1 mg/kg to about 3.5 mg/kg, about 1 mg/kg to about 5 mg/kg, about 2 mg/kg to about 4 mg/kg, about 2.5 mg/kg to about 10 mg/kg, about 5 mg/kg to about 10 mg/kg, about 10 mg/kg to about 20 mg/kg, about 10 mg/kg to about 40 mg/kg, about 20 mg/kg to about 50 mg/kg, about 25 mg/kg to about 75 mg/kg, about 50 mg/kg to about 100 mg/kg, or about 100 mg/kg to about 500 mg/kg, or about 100 mg/kg to about 1000 mg/kg body weight of nemolizumab or a fragment or variant thereof. In preferred embodiments, the dose ranges from about 0.01 mg/kg to about 0.1 mg/kg, about 0.1 mg/kg to about 0.5 mg/kg, about 0.5 mg/kg to about 1.5 mg/kg, about 1.5 mg/kg to about 2.5 mg/kg, or about 2.5 mg/kg to about 10 mg/kg. In some embodiments, the dose is about 0.01 mg/kg, about 0.02 mg/kg, about 0.03 mg/kg, about 0.04 mg/kg, about 0.05 mg/kg, about 0.06 mg/kg, about 0.07 mg/kg, about 0.08 mg/kg, about 0.09 mg/kg, about 0.1 mg/kg, about 0.2 mg/kg, about 0.3 mg/kg, about 0.4 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.7 mg/kg, about 0.8 mg/kg, about 0.9 mg/kg, about 1 mg/kg, about 1.1 mg/kg, about 1.2 mg/kg, about 1.3 mg/kg, about 1.4 mg/kg, about 1.5 mg/kg, about 1.6 mg/kg, about 1.7 mg/kg, about 1.8 mg/kg, about 1.9 mg/kg, about 2 mg/kg, about 2.1 mg/kg, about 2.2 mg/kg, about 2.3 mg/kg, about 2.4 mg/kg, about 2.5 mg/kg, about 2.6 mg/kg, about 2.7 mg/kg, about 2.8 mg/kg, about 2.9 mg/kg, about 3 mg/kg, about 3.5 mg/kg, about 4 mg/kg, about 4.5 mg/kg, about 5 mg/kg, about 6 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, about 10 mg/kg, about 15 mg/kg, about 25 mg/kg, about 50 mg/kg, about 75 mg/kg, about 100 mg/kg, about 500 mg/kg, or about 1,000 mg/kg. In particular embodiments, the effective amount of nemolizumab or a fragment or variant thereof is about 0.1 mg/kg, about 0.5 mg/kg, about 1 mg/kg, about 1.5 mg/kg, about 2 mg/kg, or about 2.5 mg/kg. In a preferred embodiment, the dose is about 0.5 mg/kg.
[0170] The present disclosure provides a pharmaceutical composition for use in the treatment or prevention of prurigo nodularis (PN) in a subject, comprising an anti-IL31RA antibody (e.g., nemolizumab or a fragment or variant thereof), as an active ingredient, wherein the subject differentially expresses at least one gene selected from the genes disclosed in Table 1 compared to a reference level of expression for the at least one gene.
[0171] The present disclosure provides a pharmaceutical composition for use in the treatment or prevention of prurigo nodularis (PN) in a subject, comprising an anti-IL31RA antibody (e.g., nemolizumab or a fragment or variant thereof), as an active ingredient, wherein the subject differentially expresses at least one gene selected from the genes disclosed in Table 1 compared to a reference level of expression for the at least one gene, and wherein the subject is diagnosed as having prurigo nodularis (PN), by detecting in a sample obtained from a subject suspected of having PN the expression level of at least one, at least two, at least three, at least four, or at least five of the differentially expressed genes (DEGs) in Table 1, and comparing the expression level of the DEGs to a reference level, wherein the reference level is the corresponding level of gene expression for each DEG in a sample from an individual that does not have PN.
[0172] Any of the pharmaceutical compositions disclosed herein, including nemolizumab and fragments or variants thereof, can be used for treating and/or preventing PN and achieving the disclosed therapeutic endpoints. Optimal doses and routes of administration may vary.
V. Methods of Treatment/Prevention and Compositions for Treating or Preventing PN
[0173] The present disclosure provides methods of treating or preventing pruritus in a subject having prurigo nodularis (PN), the method comprising, consisting of, or consisting essentially of administering an anti-IL-31RA antibody (i.e., a “therapeutic antibody”), such as nemolizumab or a fragment or variant thereof to the subject. The disclosed methods may be performed to achieve specific therapeutic endpoints, which are discussed in more detail below. Also disclosed herein are uses of an anti-IL-31RA antibody (i.e., a “therapeutic antibody”), such as nemolizumab or a fragment or variant thereof to the subject for treating or preventing PN and/or achieving the disclosed therapeutic endpoints. Also disclosed herein are anti-IL-31RA antibodies (i.e., a “therapeutic antibodies”), such as nemolizumab or a fragment or variant thereof to the subject for use in treating or preventing PN and/or achieving the disclosed therapeutic endpoints. Additionally, particular subgroups of subjects with PN may be especially suitable for treatment according to the disclosed methods and uses (e.g., patients presenting with any of the DEGs disclosed in Table 1).
[0174] The present disclosure is the first to report a transcriptomic signature for PN that is able to not only identify and positively diagnose PN, but also identify subjects with PN that will likely response to treatment with an anti-IL-31RA antibody (e.g., nemolizumab) and track the response of the treatment with an anti-IL-31RA antibody (e.g., nemolizumab).
[0175] The present disclosure is also the first to report a plasma proteome signature for PN subjects that were successfully treated with an anti-IL-31RA antibody, such as nemolizumab. This “responder signature” may be used not only as a marker of positive clinical endpoints, but also identify subjects with PN that will likely response to treatment with an anti-IL-31RA antibody (e.g., nemolizumab) and track the response of the treatment with an anti-IL-31RA antibody (e.g., nemolizumab).
[0176] A. Subject Being Treated
[0177] A subject being treated for PN according to the disclosed methods and uses may exemplify one or more of the underlying gene expression patterns that are disclosed herein. In particular, a subject with PN that is to be treated according to the disclosed methods and uses may differentially express up to or at least 5,943 genes (known as differentially expressed genes or DEGs), which are shown in
[0181] Decreased genes include: [0182] LCE5A, which may be decreased at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9-fold, at least 10-fold, or at least 11 fold compared to the expression level in a sample (e.g., a skin sample) from an individual that does not have PN; and [0183] AQP7, which may be decreased at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, or at least 7.9 fold compared to the expression level in a sample (e.g., a skin sample) from an individual that does not have PN.
[0184] Genes that encode cytokines may also be overexpressed in subjects suffering from PN that can be treated or prevented according to the disclosed methods and uses. For the cytokine genes, the most prominent up-regulated genes are IL-36 family members and IL-20 family members. These upregulated or overexpressed genes may include: [0185] IL36A (e.g., about 6.8-fold, FDR=1.8×10.sup.−4); [0186] IL36G (e.g., about 8.4-fold, FDR=3.9×10.sup.−25); [0187] IL19 (e.g., about 5.1-fold, FDR=7.4×10.sup.−4); [0188] IL20 (e.g., about 3.5-fold, FDR=1.7×10.sup.−3); [0189] IL22 (e.g., about 2.7-fold, FDR=2.9×10.sup.−2); [0190] IL24 (e.g., about 5.8-fold, FDR=3.8×10.sup.−10); and [0191] IL26 (e.g., about 4.9-fold, FDR=3.3×10.sup.−3).
[0192] Each of these IL-36 and IL-20 family member cytokine genes may be overexpressed by at least about 2-fold, at least about 2.5-fold, at least about 3-fold, at least about 3.5-fold, at least about 4-fold, at least about 4.5-fold, at least about 5-fold, at least about 5.5-fold, at least about 6-fold, at least about 6.5-fold, at least about 7-fold, at least about 7.5-fold, at least about 8-fold, or at least about 8-5-fold compared to the expression level in a sample (e.g., a skin sample) from an individual that does not have PN.
[0193] Other factors that may be upregulated or overexpressed in a sample (e.g., a skin sample) obtained from a subject with PN that is to be treated may include IL1A (e.g., about 4.7-fold, FDR=1.0×10.sup.−12), IL1B (e.g., about 4.1-fold, FDR=3.7×10.sup.−6, and IL4R (e.g., about 2.6-fold (FDR=6.3×10.sup.−19). Table 1 at the end of the examples section of the specification provides a more exhaustive list of the DEGs.
[0194] Certain gene ontology (GO) categories also may be evident in the skin of subjects with PN that are treated according to the disclosed methods and uses. These GO categories are: [0195] “cornified envelope” (FDR=1.5×10.sup.−12), [0196] “epidermal cell differentiation” (FDR=6.4×10.sup.−10), [0197] “keratinization” (FDR=1.6×10.sup.−12), [0198] “peptidase regulator activity” (FDR=1.1×10.sup.−4), [0199] “interleukin-4 and 13 signaling” (FDR=6.8×10.sup.−7), [0200] “interferon alpha/beta signaling” and “response to interferon gamma” (FDR=4.1×10.sup.−7, and FDR=4.1×10.sup.−6, respectively), [0201] “IL23 pathway” (FDR=2×10.sup.−5), and [0202] “mitotic metaphase and anaphase” (FDR=3.8×10.sup.−10).
[0203] These categories reflect the hyperproliferative nature of PN, which was discovered to be associated with altered epidermal differentiation and inflammatory components. In some embodiments, a subject with PN that is treated according to the disclosed methods and uses may overexpress the proliferative marker Ki67 (MKI67), the cell cycle gene CDKN1A, and/or inflammatory networks involving IL-1 and IL-36.
[0204] A subject with PN that is treated according to the disclosed methods or uses may additionally or alternatively present with one or more of the co-expression modules or clusters shown in
[0205] The present disclosure also provides specific cell-type signatures for non-lesional and lesional PN skin that can be present in subjects with PN that are treated according to the disclosed methods and uses. For example, a subject with PN may possess the transcriptomic signature associated with epithelial cells and keratinocytes was observed in
[0206] In general, the disclosed methods and uses can treat or prevent PN in subjects that suffer from mild, moderate, or severe pruritus. In some embodiments, the PN may be categorized as moderate to severe. In some embodiments, the PN may be categorized as moderate, while in other embodiments, the PN may be categorized as severe. In some embodiments, pruritus can be scored as none, mild, moderate, or severe. “None,” “mild,” “moderate,” and “severe” are terms of art in describing the presence, extent, and/or intensity of excoriations. Those of skill in the art know the metes and bounds of these terms. For example, pruritus can be characterized according to one or more of the following methods known by those skilled in the art. The intensity can be quickly measured with monodimensional scales that are routinely used in clinical care. See Pereira et al., Allergology International (2017) 66:3-78. Additionally or alternatively, patients can be asked to rate their itch intensity from 0 (“no itch”) to 10 (“worst imaginable itch”) with the numerical rating scale (NRS). Another monodimensional scale, the visual analogue scale (VAS), provides patients with the opportunity to indicate the intensity of their itch by marking on a 10 cm long, ruler-shaped scale. Both endpoints are marked with a number corresponding to the intensity, with 0 representing “no itch” and 10 the “worst imaginable itch.” Scores below 3.0 VAS/NRS points are generally associated with mild itch, whereas scores higher than 6.9 illustrate severe itch. Scores above 9.0 represent a very severe itch. The verbal rating scale (VRS) is a further monodimensional scale that allows patients to describe their itch intensity by means of gradually rising adjectives (0—no itch, 4—worst imaginable itch). The NRS, VAS and VRS have been validated in large-scale studies consisting of chronic pruritus patients with pruritic dermatoses or pruritus of various origins. These instruments have high reproducibility and there was a high correlation between scales 6, 7, 8. Chronic pruritus can greatly reduce patient quality of life. For this reason, Dermatology Life Quality Index (DLQI) is widely used and has been validated. DLQI scores range from 0 to 30, with higher scores indicating a lower quality of life. Investigators' Global Assessment (IGA) scores range from 0 (clear) to 5 (very severe disease) and are presented as a percentage of patients in the indicated population. In the present study, IGA scores range from 0 to 4.
[0207] A subject being treated for PN according to the disclosed methods and uses may exemplify one or more of the disclosed plasma protein signature alterations that are disclosed herein. In particular, a subject with PN that is to be treated according to the disclosed methods and uses may exhibit (a) a decrease in migration and cell movement of leukocytes; (b) an inhibition of STAT3 and STAT5b pathways; (c) a downregulation in IL-6 and VEGF pathways; (d) a decrease in TGFB1 pathway, or (e) a combination thereof. The foregoing decreases or inhibitions may be observed at a specified time point after the commencement of treatment, such as 2 weeks, 4 weeks, 6 weeks, 8 weeks, 10 weeks, or 12 weeks. The decreases or inhibitions may be determined relative to (i) a control sample obtained from an individual or individuals without PN or (ii) a biological sample obtained from the subject prior to administration of the anti-IL-31RA antibody. Additionally or alternatively, the subject may exhibit an upregulation in a neuronal ontology terms including CREB signaling in neurons, Synaptogenesis signaling pathway, Cell death of neuroglia and Apoptosis of neuroglia and a combination thereof following administration of the anti-IL-31RA antibody.
[0208] A subject with PN that is suitable for treatment according to the disclosed methods and uses may exhibit high levels of leukocyte migration or leukocyte cell movement relative to an individual or population without PN or in the subject prior to commencing treatment with an anti-IL-31RA antibody, such as nemolizumab. Additionally or alternatively, a suitable subject may exhibit STAT3 pathway activity or expression that is comparatively high relative to an individual or population without PN or in the subject prior to commencing treatment with an anti-IL-31RA antibody, such as nemolizumab. Additionally or alternatively, a suitable subject may exhibit TGFB1 pathway activity or expression that is comparatively high relative to an individual or population without PN or in the subject prior to commencing treatment with an anti-IL-31RA antibody, such as nemolizumab. Additionally or alternatively, a suitable subject may exhibit amounts of circulating cytokine signature that are comparatively high in a subject with PN relative to an individual or population without PN or in the subject prior to commencing treatment with an anti-IL-31RA antibody, such as nemolizumab. Such cytokine pathways can include, but are not limited to IL-6, and VEGF pathways.
[0209] Prior to treatment with an anti-IL-31Ra antibody, such as nemolizumab, the amount of the disclosed protein markers in the plasma of a subject with PN may be at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9-fold, at least 10-fold, at least 15-fold, at least 20-fold, at least 25-fold, at least 30-fold, at least 35-fold, at least 40-fold, at least 45-fold, or at least 50-fold higher than a baseline level. The baseline level may be determined relative to (i) a control sample obtained from an individual or individuals (i.e., a population) without PN or (ii) a biological sample obtained from the subject prior to administration of the anti-IL-31RA antibody.
[0210] In some embodiments, the subject has been diagnosed of PN for at least about 6 months. In particular embodiments, the subject has at least about 20 nodules on his/her body with a bilateral distribution. In particular embodiments, the subject has prurigo lesions on upper limbs, with or without lesions on the trunk or lower limbs. In some embodiments, the pruritus has been assigned a score of at least 7 on the Numerical Rating Scale (NRS). In some embodiments, the mean of the worst daily intensity of the NRS score is at least 7 over the previous 3 days. In some embodiments, the mean of the worst daily intensity of the NRS score is at least 7 over the previous week.
[0211] In some embodiments, the subject does not have atopic dermatitis (AD). In some embodiments, the subject does not have chronic pruritus resulting from a condition other than PN, such as scabies, insect bite, lichen simplex chronicus, psoriasis, acne, folliculitis, habitual picking, lymphomatoid papulosis, chronic actinic dermatitis, dermatitis herpetiformis, sporotrichosis, or bullous disease. In some embodiments, the subject does not have neuropathic or psychogenic pruritus, such as notalgia paresthetica, brachioradial pruritus, dilutional parasitosis, or pathomimia.
[0212] B. Therapeutic Endpoints for Treatment
[0213] Based on the data provided herein, it is believed that IL-31 signaling is upstream of IL-17 and IL-4 signaling, at least in subjects with PN, as treatment with the anti-IL-31RA antibody nemolizumab was able to alter the transcriptome expression signature of IL-17 and IL-4. Accordingly, the disclosure provides methods of normalizing differentially expressed genes (DEGs) in subjects with PN, comprising administering to a subject with PN an anti-IL-31RA antibody, such as nemolizumab or a fragment or variant thereof. As shown in the Examples section below, treatment or prevention with nemolizumab leads to normalization of a number of PN associated DEGs for both increased (e.g., about 969 genes), and decreased genes (e.g., about 1,268 genes). See
[0214] GO categories enriched amongst DEGs may also be decreased or altered as a result of treatment with an anti-IL-31RA antibody (e.g., nemolizumab). For example, after 12 weeks of treatment, the following GO categories were observed to decrease: “cell cycle” (FDR=5.6×10.sup.−14), “keratinocyte differentiation” (FDR=1.8×10.sup.−4), and “interleukin-4 and 13 signaling” (FDR=1.5×10.sup.−2). Indeed, the data provided in the Examples section demonstrates that nemolizumab treatment (and treatment with other anti-IL-31RA antibodies) normalizes epidermal hyperproliferation, normalizes differentiation, and decreases inflammatory responses, particularly related to Th2 responses. Accordingly, the present disclosure provides methods of normalizing epidermal hyperproliferation, normalizing epidermal differentiation, and/or decreasing inflammatory responses in the skin, comprising administering to a subject with PN an anti-IL-31RA antibody (e.g., nemolizumab). In some embodiments, the inflammatory response may be a Th2 response. In some embodiments, administration of the anti-IL-31RA antibody (e.g., nemolizumab) may be once a week, once every 2 weeks, once every 3 week, once every 4 weeks, once every 5 weeks, once every 6 week, once every 7 week, or once every 8 weeks. Administration about once every 4 weeks may be preferred. Administration may be perform via injection, such as subcutaneous injection.
[0215] With respect to the disclosed methods of decreasing inflammatory responses in the skin of a subject with PN, in some embodiments, the cytokine response signatures generated in human epidermal rafts of the subject's skin may be altered. For example, IL17A mRNA expression was not significantly different in non-lesional vs lesional skin, nor was it different after a 12 week treatment with nemolizumab. A consistent decrease in IL-31 responses, either solitary, or in combination with other inflammatory cytokines, including the Th2 cytokine IL-13 or IL-17A can be seen in
[0216] In some embodiment, a basal keratinocyte (KRT14+) signature may be elevated in the lesional skin of PN, and this signature may be restored to normal (i.e., non-PN) when treated according to the disclosed methods and uses. In some embodiments, a spinous layer (KRT10+) signature may be elevated in the PN lesional skin, and this signature may be restored to normal (i.e., non-PN) when treated according to the disclosed methods and uses (
[0217] In some embodiments, transcription factor binding site (TFBS) that are enriched among genes up-regulated in baseline lesional skin are more likely to be enriched among the nemolizumab down-regulated genes following treatment with an anti-IL-31RA antibody, such as nemolizumab (e.g., by week 12 post-treatment, as shown in
[0218] The present disclosure additionally provides plasma protein markers that have been identified in subjects that were successfully treated with nemolizumab, and therefore the resulting alteration in biomarkers can be considered a “responder signature” for establishing success, as well as a means of tracking responsiveness. Thus, disclosed herein are methods of treating or preventing prurigo nodularis (PN) in a subject, comprising administering to a subject with PN an anti-IL-31RA antibody, wherein treatment with the anti-IL-31RA antibody results in: (a) a decrease in leukocyte migration and cell movement, (b) a decrease in IL-6 or a decrease in IL-6 pathway signaling, (c) a decrease in VEGF or a decrease in VEGF pathway signaling, (d) a decrease in STAT3 or a decrease in STAT3 pathway signaling, (e) a decrease in STAT5b or a decrease in STAT5b pathway signaling, (f) a decrease in TGFB1 or a decrease in TGFB1 pathway signaling, or (g) a combination thereof. In some embodiments, the subject may also exhibit an increase in the disclosed neuronal ontologies. Additionally, disclosed here are methods of altering an immune response in a subject with PN, comprising administering to a subject with PN an anti-IL-31RA antibody, wherein treatment with the anti-IL-31RA antibody results in: (a) a decrease in leukocyte migration and cell movement, (b) a decrease in IL-6 or a decrease in IL-6 pathway signaling, (c) a decrease in VEGF or a decrease in VEGF pathway signaling, (d) a decrease in STAT3 or a decrease in STAT3 pathway signaling, (e) a decrease in STAT5b or a decrease in STAT5b pathway signaling, (f) a decrease in TGFB1 or a decrease in TGFB1 pathway signaling, or (g) a combination thereof. In some embodiments, the subject may also exhibit an increase in the disclosed neuronal ontologies. The disclosed plasma protein markers are detectable by, for example, mass spectrometry and other methods of protein assessment (e.g., ELISA, Western blot, etc.).
[0219] In particular, when a subject with PN is treated with an anti-IL-31RA antibody, such as nemolizumab, the immune cells (e.g., leukocytes) may experience a decrease migration or cell movement or both.
[0220] STAT3 pathway activity, may decrease in a subject with PN that is treated with an anti-IL-31RA antibody, such as nemolizumab, relative to an individual or population without PN or to the subject prior to commencing treatment with an anti-IL-31RA antibody, such as nemolizumab.
[0221] The amount of cytokine activity may also be comparatively high in a subject with PN relative to an individual or population without PN or in the subject prior to commencing treatment with an anti-IL-31RA antibody, such as nemolizumab. Such cytokine pathways can include, but are not limited to IL-6 and VEGF pathways. In a PN subject that receives treatment with an anti-IL-31RA antibody, such as nemolizumab, the treatment may result in a decrease in IL-6 or VEGF signatures or both relative to a baseline level. The baseline level may be determined relative to (i) a control sample obtained from an individual or individuals (i.e., a population) without PN or (ii) a biological sample obtained from the subject prior to administration of the anti-IL-31RA antibody.
[0222] TGFB1 pathway activity may decrease in a subject with PN that is treated with an anti-IL-31RA antibody, such as nemolizumab, relative to an individual or population without PN or the subject prior to commencing treatment with an anti-IL-31RA antibody, such as nemolizumab.
[0223] For the purposes of the disclosed plasma protein markers, the amount of the disclosed protein markers in the plasma of a subject with PN may be at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9-fold, at least 10-fold, at least 15-fold, at least 20-fold, at least 25-fold, at least 30-fold, at least 35-fold, at least 40-fold, at least 45-fold, or at least 50-fold higher than a baseline level. The baseline level may be determined relative to (i) a control sample obtained from an individual or individuals (i.e., a population) without PN or (ii) a biological sample obtained from the subject prior to administration of the anti-IL-31RA antibody. Similarly, after a subject with PN is treated with an anti-IL-31RA antibody, such as nemolizumab (e.g., 2 weeks, 4 weeks, 6 weeks, 8 weeks, 10 weeks, or 12 weeks after administration of the antibody), the amount of the disclosed plasma protein markers in the subject may decrease at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9-fold, at least 10-fold, at least 15-fold, at least 20-fold, at least 25-fold, at least 30-fold, at least 35-fold, at least 40-fold, at least 45-fold, or at least 50-fold relative to a baseline level. The baseline level may be determined relative to (i) a control sample obtained from an individual or individuals (i.e., a population) without PN or (ii) a biological sample obtained from the subject prior to administration of the anti-IL-31RA antibody.
[0224] Additionally, neuronal ontologies (e.g., CREB signaling in neurons, Synaptogenesis signaling pathway, Cell death of neuroglia and Apoptosis of neuroglia) may be upregulated in subject with PN, and subsequently downregulated in nemolizumab responders subjects.
[0225] In some embodiments of the disclosed methods and uses, treatment or prevention with an anti-IL-31RA antibody, such as nemolizumab or a fragment or variant thereof, leads to decrease in pruritus scoring. The decrease in scoring may be measured by, for example, the peak pruritus numeric rating scale (PP-NRS). See, e.g.,
[0226] C. Doses and Dosing Regimen for the Disclosed Methods and Uses
[0227] An effective amount of an anti-IL-31RA antibody, such as nemolizumab or a fragment or variant thereof, is an amount sufficient to effect beneficial or desired results such as alleviating at least one or more symptom of PN. An effective amount as used herein would also include an amount sufficient to delay or prevent the development pruritus, alter the course of a PN symptom, or reverse a symptom of PN. Thus, it is not possible to specify the exact “effective amount.” However, for any given case, an appropriate “effective amount” can be determined by one of ordinary skill in the art using only routine experimentation.
[0228] An effective amount can be administered in one or more administrations, applications or dosages. Such delivery is dependent on a number of variables including the time period for which the individual dosage unit is to be used, the bioavailability of the therapeutic agent, the route of administration, etc. It is understood, however, that specific dose levels of the therapeutic agents of the present disclosure for any particular subject depends upon a variety of factors including the activity of the specific compound employed, the age, body weight, general health, sex, and diet of the subject, the time of administration, the rate of excretion, the drug combination, and the severity of the particular disorder being treated and form of administration. Treatment and prevention dosages generally may be titrated to optimize safety and efficacy. The dosage can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment. Typically, dosage-effect relationships from in vitro and/or in vivo tests initially can provide useful guidance on the proper doses for patient administration. In general, one will desire to administer an amount of the compound that is effective to achieve a serum level commensurate with the concentrations found to be effective in vitro. Determination of these parameters is well within the skill of the art. These considerations, as well as effective formulations and administration procedures are well known in the art and are described in standard textbooks.
[0229] Dosage regimens for treating or preventing PN may comprise flat dosing (i.e., administering the same dose repeatedly at pre-determined intervals) or comprise a loading dose (i.e., administrating an initial dose that is higher or different than subsequent, serial doses). For the purposes of either type of dosing regimen an effective dose may be administered topically, parenterally, subcutaneously, subdermally, intradermally, or intramuscularly. In preferred embodiments, administration comprises subcutaneous injection.
[0230] In some embodiments, a loading dose and the subsequent serial doses may be administered via the same route (e.g., subcutaneously), while in some embodiments, a loading dose and the subsequent serial doses may be administered via different routes (e.g., parenterally and subcutaneously, respectively). In some embodiments, the loading dose may be about 5 mg, about 10 mg, about 15 mg, about 20 mg, about 25 mg, about 30 mg, about 35 mg, about 40 mg, about 45 mg, about 50 mg, about 55 mg, about 60 mg, about 65 mg, about 70 mg, about 75 mg, about 80 mg, about 85 mg, about 90 mg, about 95 mg, about 100 mg, about 105 mg, about 110 mg, about 115 mg, about 120 mg, or higher. In some embodiments, the loading dose may be 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg, 50 mg, 55 mg, 60 mg, 65 mg, 70 mg, 75 mg, 80 mg, 85 mg, 90 mg, 95 mg, 100 mg, 105 mg, 110 mg, 115 mg, 120 mg, or higher. In some embodiments, the loading dose may be about 0.01 mg/kg, about 0.02 mg/kg, about 0.03 mg/kg, about 0.04 mg/kg, about 0.05 mg/kg, about 0.06 mg/kg, about 0.07 mg/kg, about 0.08 mg/kg, about 0.09 mg/kg, about 0.1 mg/kg, about 0.2 mg/kg, about 0.3 mg/kg, about 0.4 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.7 mg/kg, about 0.8 mg/kg, about 0.9 mg/kg, about 1 mg/kg, about 1.1 mg/kg, about 1.2 mg/kg, about 1.3 mg/kg, about 1.4 mg/kg, about 1.5 mg/kg, about 1.6 mg/kg, about 1.7 mg/kg, about 1.8 mg/kg, about 1.9 mg/kg, about 2 mg/kg, about 2.1 mg/kg, about 2.2 mg/kg, about 2.3 mg/kg, about 2.4 mg/kg, about 2.5 mg/kg, about 2.6 mg/kg, about 2.7 mg/kg, about 2.8 mg/kg, about 2.9 mg/kg, about 3 mg/kg, about 3.5 mg/kg, about 4 mg/kg, about 4.5 mg/kg, about 5 mg/kg, about 6 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, about 10 mg/kg, about 15 mg/kg, about 25 mg/kg, about 50 mg/kg, about 75 mg/kg, about 100 mg/kg, about 500 mg/kg, or about 1,000 mg/kg. In some embodiments, the loading dose may be 0.01 mg/kg, 0.02 mg/kg, 0.03 mg/kg, 0.04 mg/kg, 0.05 mg/kg, 0.06 mg/kg, 0.07 mg/kg, 0.08 mg/kg, 0.09 mg/kg, 0.1 mg/kg, 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, 0.5 mg/kg, 0.6 mg/kg, 0.7 mg/kg, 0.8 mg/kg, 0.9 mg/kg, 1 mg/kg, 1.1 mg/kg, 1.2 mg/kg, 1.3 mg/kg, 1.4 mg/kg, 1.5 mg/kg, 1.6 mg/kg, 1.7 mg/kg, 1.8 mg/kg, 1.9 mg/kg, 2 mg/kg, 2.1 mg/kg, 2.2 mg/kg, 2.3 mg/kg, 2.4 mg/kg, 2.5 mg/kg, 2.6 mg/kg, 2.7 mg/kg, 2.8 mg/kg, 2.9 mg/kg, 3 mg/kg, 3.5 mg/kg, 4 mg/kg, 4.5 mg/kg, 5 mg/kg, 6 mg/kg, 7 mg/kg, 8 mg/kg, 9 mg/kg, 10 mg/kg, 15 mg/kg, 25 mg/kg, 50 mg/kg, 75 mg/kg, 100 mg/kg, 500 mg/kg, or 1,000 mg/kg. In some embodiments, the loading dose is administered as a single injection. In some embodiments, the loading dose is administered as multiple injections, which may be administered at the same time or spaced apart at defined intervals.
[0231] The subsequent serial doses of a loading dose regimen are generally lower than the loading dose. For examples, in some embodiments, the dosing regimen may comprise a loading dose of 60 mg and a serial dose of 30 mg, which may be administered a defined interval of, for example, every 4 weeks. In some embodiments, the serial dose of a dosing regimen may be about 5 mg, about 10 mg, about 15 mg, about 20 mg, about 25 mg, about 30 mg, about 35 mg, about 40 mg, about 45 mg, about 50 mg, about 55 mg, about 60 mg, about 65 mg, about 70 mg, about 75 mg, about 80 mg, about 85 mg, about 90 mg, about 95 mg, about 100 mg, about 105 mg, about 110 mg, about 115 mg, about 120 mg, or higher. In some embodiments, the serial dose may be 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg, 50 mg, 55 mg, 60 mg, 65 mg, 70 mg, 75 mg, 80 mg, 85 mg, 90 mg, 95 mg, 100 mg, 105 mg, 110 mg, 115 mg, 120 mg, or higher. In some embodiments, the serial dose may be about 0.01 mg/kg, about 0.02 mg/kg, about 0.03 mg/kg, about 0.04 mg/kg, about 0.05 mg/kg, about 0.06 mg/kg, about 0.07 mg/kg, about 0.08 mg/kg, about 0.09 mg/kg, about 0.1 mg/kg, about 0.2 mg/kg, about 0.3 mg/kg, about 0.4 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.7 mg/kg, about 0.8 mg/kg, about 0.9 mg/kg, about 1 mg/kg, about 1.1 mg/kg, about 1.2 mg/kg, about 1.3 mg/kg, about 1.4 mg/kg, about 1.5 mg/kg, about 1.6 mg/kg, about 1.7 mg/kg, about 1.8 mg/kg, about 1.9 mg/kg, about 2 mg/kg, about 2.1 mg/kg, about 2.2 mg/kg, about 2.3 mg/kg, about 2.4 mg/kg, about 2.5 mg/kg, about 2.6 mg/kg, about 2.7 mg/kg, about 2.8 mg/kg, about 2.9 mg/kg, about 3 mg/kg, about 3.5 mg/kg, about 4 mg/kg, about 4.5 mg/kg, about 5 mg/kg, about 6 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, about 10 mg/kg, about 15 mg/kg, about 25 mg/kg, about 50 mg/kg, about 75 mg/kg, about 100 mg/kg, about 500 mg/kg, or about 1,000 mg/kg. In some embodiments, the serial dose may be 0.01 mg/kg, 0.02 mg/kg, 0.03 mg/kg, 0.04 mg/kg, 0.05 mg/kg, 0.06 mg/kg, 0.07 mg/kg, 0.08 mg/kg, 0.09 mg/kg, 0.1 mg/kg, 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, 0.5 mg/kg, 0.6 mg/kg, 0.7 mg/kg, 0.8 mg/kg, 0.9 mg/kg, 1 mg/kg, 1.1 mg/kg, 1.2 mg/kg, 1.3 mg/kg, 1.4 mg/kg, 1.5 mg/kg, 1.6 mg/kg, 1.7 mg/kg, 1.8 mg/kg, 1.9 mg/kg, 2 mg/kg, 2.1 mg/kg, 2.2 mg/kg, 2.3 mg/kg, 2.4 mg/kg, 2.5 mg/kg, 2.6 mg/kg, 2.7 mg/kg, 2.8 mg/kg, 2.9 mg/kg, 3 mg/kg, 3.5 mg/kg, 4 mg/kg, 4.5 mg/kg, 5 mg/kg, 6 mg/kg, 7 mg/kg, 8 mg/kg, 9 mg/kg, 10 mg/kg, 15 mg/kg, 25 mg/kg, 50 mg/kg, 75 mg/kg, 100 mg/kg, 500 mg/kg, or 1,000 mg/kg.
[0232] For the purposes of a loading dose regimen, the first serial dose may be administered 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, or 10 weeks after the initial loading dose. In some embodiments, the first serial dose is administered 4 weeks after the initial loading dose. In some embodiments, the subsequent serial doses are administered once every 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, or 10 weeks. In some embodiments, the serial doses are spaced 4 weeks apart (i.e., nemolizumab or a fragment or variant thereof is administered once every 4 weeks).
[0233] In some embodiments, the dose of nemolizumab or a fragment or variant thereof administered to the subject can be within the range of 0.001 to 1,000 mg/kg body weight of the subject. In some embodiments, the dose ranges from about 0.01 to 50 mg/kg, about 0.01 mg/kg to about 0.1 mg/kg, about 0.05 mg/kg to 0.15 mg/kg, about 0.1 mg/kg to about 0.6 mg/kg, about 0.1 mg/kg to about 1 mg/kg, about 0.25 mg/kg to about 0.75 mg/kg, about 0.4 mg/kg to about 0.8 mg/kg, about 0.4 mg/kg to about 1.8 mg/kg, about 0.5 to about 2.5 mg/kg, about 0.8 mg/kg to about 2.2 mg/kg, about 1 mg/kg to about 2.5 mg/kg, about 1 mg/kg to about 3.5 mg/kg, about 1 mg/kg to about 5 mg/kg, about 2 mg/kg to about 4 mg/kg, about 2.5 mg/kg to about 10 mg/kg, about 5 mg/kg to about 10 mg/kg, about 10 mg/kg to about 20 mg/kg, about 10 mg/kg to about 40 mg/kg, about 20 mg/kg to about 50 mg/kg, about 25 mg/kg to about 75 mg/kg, about 50 mg/kg to about 100 mg/kg, or about 100 mg/kg to about 500 mg/kg, or about 100 mg/kg to about 1000 mg/kg body weight of nemolizumab or a fragment or variant thereof. In preferred embodiments, the dose ranges from about 0.01 mg/kg to about 0.1 mg/kg, about 0.1 mg/kg to about 0.5 mg/kg, about 0.5 mg/kg to about 1.5 mg/kg, about 1.5 mg/kg to about 2.5 mg/kg, or about 2.5 mg/kg to about 10 mg/kg. In some embodiments, the dose is about 0.01 mg/kg, about 0.02 mg/kg, about 0.03 mg/kg, about 0.04 mg/kg, about 0.05 mg/kg, about 0.06 mg/kg, about 0.07 mg/kg, about 0.08 mg/kg, about 0.09 mg/kg, about 0.1 mg/kg, about 0.2 mg/kg, about 0.3 mg/kg, about 0.4 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.7 mg/kg, about 0.8 mg/kg, about 0.9 mg/kg, about 1 mg/kg, about 1.1 mg/kg, about 1.2 mg/kg, about 1.3 mg/kg, about 1.4 mg/kg, about 1.5 mg/kg, about 1.6 mg/kg, about 1.7 mg/kg, about 1.8 mg/kg, about 1.9 mg/kg, about 2 mg/kg, about 2.1 mg/kg, about 2.2 mg/kg, about 2.3 mg/kg, about 2.4 mg/kg, about 2.5 mg/kg, about 2.6 mg/kg, about 2.7 mg/kg, about 2.8 mg/kg, about 2.9 mg/kg, about 3 mg/kg, about 3.5 mg/kg, about 4 mg/kg, about 4.5 mg/kg, about 5 mg/kg, about 6 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, about 10 mg/kg, about 15 mg/kg, about 25 mg/kg, about 50 mg/kg, about 75 mg/kg, about 100 mg/kg, about 500 mg/kg, or about 1,000 mg/kg. In particular embodiments, the dose of nemolizumab or a fragment or variant thereof is about 0.1 mg/kg, about 0.5 mg/kg, about 1 mg/kg, about 1.5 mg/kg, about 2 mg/kg, or about 2.5 mg/kg. In a preferred embodiment, the dose is about 0.5 mg/kg.
[0234] In some embodiments, the dose of nemolizumab or a fragment or variant thereof administered to the subject is within the range of 1 to 100 mg, 25 to 75 mg, 30 to 60 mg, 40 to 80 mg, 20 to 80 mg, 1 to 25 mg, 1 to 50 mg, 10 to 90 mg, 15 to 85 mg, or ranges there between. In some embodiments, the dose may be about 5 mg, about 10 mg, about 15 mg, about 20 mg, about 25 mg, about 30 mg, about 35 mg, about 40 mg, about 45 mg, about 50 mg, about 55 mg, about 60 mg, about 65 mg, about 70 mg, about 75 mg, about 80 mg, about 85 mg, about 90 mg, about 95 mg, about 100 mg, about 105 mg, about 110 mg, about 115 mg, about 120 mg, or higher. In some embodiments, the dose may be 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg, 50 mg, 55 mg, 60 mg, 65 mg, 70 mg, 75 mg, 80 mg, 85 mg, 90 mg, 95 mg, 100 mg, 105 mg, 110 mg, 115 mg, 120 mg, or higher.
[0235] In some embodiments of the disclosed methods and uses, a loading dose of about 60 mg of nemolizumab or a fragment or variant thereof may be administered to a subject with PN, followed by subsequent serial doses of nemolizumab of a fragment or variant thereof at about 30 mg once every 4 weeks. In some embodiments of the disclosed methods and uses a first dose of about 60 mg of nemolizumab or a fragment or variant thereof may be administered to a subject with PN, followed by subsequent serial doses of nemolizumab of a fragment or variant thereof at about 60 mg once every 4 weeks (i.e., the dose remains constant or is a “flat” dosing regimen). In some embodiments of the disclosed methods and uses a first dose of about 30 mg of nemolizumab or a fragment or variant thereof may be administered to a subject with PN, followed by subsequent serial doses of nemolizumab of a fragment or variant thereof at about 30 mg once every 4 weeks
[0236] In some embodiments of the disclosed methods and uses, nemolizumab or a fragment or variant thereof is administered by a topical or parenteral route. In some embodiments, nemolizumab or a fragment or variant thereof is administered subcutaneously. In some embodiments, the dose is administered subcutaneously at or proximal to a site of one or more nodules, lesions, or excoriations.
[0237] In some embodiments of the disclosed methods and uses, nemolizumab or a fragment or variant thereof is administered daily, every other day, twice per week, three times per week, four times per week, five times per week, six times per week, once per week, once every two weeks, once every three weeks, once every four weeks, once every five weeks, once every six weeks, once every seven weeks, once every eight weeks, once every nine weeks, once every 10 weeks, once every 11 weeks, once every 12 weeks, twice per year, once per year, and/or as needed based on the appearance of symptoms of PN. In preferred embodiments, nemolizumab or a fragment or variant thereof is administered every four weeks or every eight weeks.
[0238] In some embodiments of the disclosed methods and uses, the duration of treatment or prevention is about one day, about one week, about two weeks, about three weeks, about four weeks, about five weeks, about six weeks, about seven weeks, about eight weeks, about nine weeks, about 10 weeks, about 11 weeks, about 12 weeks, about 13 weeks, about 14 weeks, about 15 weeks, about 16 weeks, about 17 weeks, about 18 weeks, about 19 weeks, about 20 weeks, about 24 weeks, about 30 weeks, about 36 weeks, about 40 weeks, about 48 weeks, about 50 weeks, about one year, about two years, about three years, about four years, about five years, or as needed based on the appearance of symptoms of PN. In preferred embodiments, duration of treatment or prevention is about 12 weeks to about 24 weeks, about 12 to about 36 weeks, about 12 to about 48 weeks, or about 24 to about 36 weeks.
[0239] The present disclosure provides uses of nemolizumab or a fragment or variant thereof in the manufacture of a medicament for the treatment or prevention of PN, for normalizing differentially expressed genes (DEGs) in subjects with PN, for normalizing epidermal hyperproliferation, for normalizing epidermal differentiation, and/or for decreasing inflammatory responses in the skin. All of the disclosed doses, dosing regimens, routes of administrations, biomarkers, and therapeutic endpoints are applicable to these uses as well.
[0240] The following examples are given to illustrate the present disclosure. It should be understood that the invention is not to be limited to the specific conditions or details described in these examples.
Examples
Example 1—Treatment of Prurigo Nodularis with Nemolizumab
[0241] Methods
[0242] Patient Cohort
[0243] The current study was performed in patients with moderate to severe PN. Briefly, 70 patients were randomized 1:1 to placebo (36 patients) or nemolizumab (34 patients), the latter at a dose of 0.5 mg/kg body weight administered at baseline, week 4 and week 8. Peak pruritus score on the numerical rating scale (PP-NRS) was recorded: severity of pruritus on the numerical rating scale ranged from 0 (no itch) to 10 (worst itch imaginable) and the peak pruritus was estimated using the worst scores every 24 hours in a 7-day period, with the highest score recorded as peak score. Primary outcome of the study was percent change from baseline in the PP-NRS at week 4.
[0244] Reconstructed Human Epidermis (RHE) Model
[0245] Three-dimensional RHE models were generated. Briefly, RHE cultures were generated using Normal Human Dermal Fibroblasts (NHDF) and Normal Human Epidermal Keratinocytes (NHEK). RHE cultures used were full thickness, with a dermis and an epidermis, and composed of autologous Fibroblasts and Keratinocytes. They were scaffold-free (no exogenous matrix) allowing self-assembly of the different layers of the skin by the cells and avoiding some potential inhibitors contained in collagen matrix for the RNA extractions. The RHE were cultivated in 12 well plates with insert (1.2 cm.sup.2) for 42 days to obtain a minimum of two layers of dermis and six layers of epidermis. RHE cultures from 6 different donors were left unstimulated or stimulated with 7 different cytokines or cytokine combinations (3 replicates per donor per condition): IL-31, IL-13, IL-17A, IFNg, IL-31+IL-13, IL-31+IL-17A, IL-31+IFNg and IL-13+IL-17A. Concentrations for each of the cytokines used were: IL-31 (500 ng/mL), IL-13 (100 ng/mL), IL-17A (200 ng/mL), IFNg (50 ng/mL). RHE cultures were lysed 72 hours after stimulation, and RNA extraction was performed using MagMAX mirVana Total RNA isolation from Tissue Kit (ThermoFisher Scientific). RNA was purified and concentrated using RNA Clean & Concentrator-5 kit (Zymo Research), according to the protocol, and RNA concentrations ranged from 3 to 380 ng/μL. Total RNA was quantified using the QuantiFluor One RNA kit (Promega) on the GloMax-Multi+ Detection System (Promega). Library preparation was performed using the Illumina® Stranded mRNA Prep Ligation kit (Illumina), according to manufacturer's recommendations.
[0246] Skin Biopsy Processing and RNA Isolation
[0247] Skin biopsies were collected from 16 placebo and 15 nemolizumab-treated subjects. Samples included lesional and non lesional biopsies at baseline as well as lesional samples after 12 weeks of treatment (placebo or nemolizumab). RNA was extracted from skin biopsies using Tripure Isolation Reagent (Sigma-Aldrich) according to manufacturer's instructions. From these RNA samples, a DNase treatment was applied using the RNase-Free DNase kit (Cat No. 79254, Qiagen), followed by the RNeasy® MinElute® Cleanup Kit (Cat No. 74204, Qiagen).
[0248] Total RNA was quantified using the QuantiFluor One RNA kit (Promega). RNA concentration obtained ranging from 4 to 20 ng/μ1. Total RNA was qualified using Fragment Analyzer 5300 (Agilent) with the Agilent HS RNA Fragment kit (Agilent). The RNA Quality Number (RQN) obtained ranging from 1 to 6. Library preparation was performed using the SMARTer Stranded Total RNA-Seq Kit V2—Pico Input Mammalian kit (TaKaRa).
[0249] RNA-Seq
[0250] Libraries were quantified using the QuantiFluor One dsDNA kit (Promega) and library analysis was performed using Fragment Analyzer 5300 (Agilent) with the Agilent HS NGS Fragment kit (Agilent). Following size selection with AMPure XP beads, shotgun libraries were sequenced using NextSeq (Illumina) on an Illumina NextSeq500 sequencer, in 2×75 bp (High Output Kit v2, 150 cycles).
[0251] RNA-Seq Data Processing
[0252] Following adapter trimming, sequence reads for 83 unique samples were aligned to human genome (GRCh37) using STAR. Gene (GENCODE v29) expression levels were then quantified with HTSeq using reads uniquely mapped to one genome location. Two RNA-seq samples were identified as outliers and 81 samples were used in subsequent analysis. Only genes with an average of at least one read per sample were retained. DESeq2 was used for expression normalization, and the negative binomial distribution was used to model the expression level for differential expression analysis. For non-lesional vs lesional and the baseline vs week 12 comparison, individual effect was included as covariate; for the placebo vs nemolizumab comparison, age and gender were controlled. False Discovery Rate (FDR)≤5% and |log.sub.2 Fold Change|>=1 were used as criteria to declare significant differentially expressed genes (DEGs).
[0253] Cytokine, Cell Signature, and Functional Inference Analysis
[0254] The most significant DEGs were compared against the transcripts induced by cytokines in keratinocytes (defined by FDR<=10% and 1.5-Fold Change (FC)). The top 1,000 most significant DEGs from the PN data were used for fair comparison. For the comparison against epidermal compartments gene signature, we conducted scRNA-seq on the epidermal layer of skin biopsy, and identified the top 50 marker genes for the basal, differentiated, and keratinized layers, respectively. The effect size (in log.sub.2 FC) was then investigated for each marker gene in each differential expression comparison. For transcription analysis, promoter region was defined as 5,000 base pairs upstream of the transcription start site, and the MEME suite was used to compute the enrichment statistics for the transcription factor binging.
[0255] Weighted Gene Correlation Network Analysis (WGCNA)
[0256] Gene that were expressed in at least 20% of the samples were used in the dataset for the WGCNA. The “softPower” parameter was picked as the smallest value that achieve at least r2>=0.75. Spearman correlation was used to compute the correlation, and minimum module size was set as 100. Upon the module merging, a height cut of 0.2 was used.
[0257] Results
[0258] Prurigo Nodularis is Characterized by Abnormal Keratinocyte Differentiation and Immune Activation
[0259] After quality control, RNA-sequencing data analysis of biopsy tissue from patients with prurigo nodularis (PN) was performed. There were 31 PN patients with the transcriptomic data in both lesional and non-lesional skin samples. Using false-discovery rate (FDR) of ≤10% and |log.sub.2|≥1 as criteria, 5,943 differentially expressed genes (DEGs) were identified when comparing the uninvolved and lesional skin at baseline, of which 2,060 genes were increased and 3,874 were decreased (
[0260] Functional enrichment analysis was then performed on the DEGs to define the biological processes associated with PN skin. The most prominent gene ontology (GO) terms included: “cornified envelope” (FDR=1.5×10.sup.−12), “epidermal cell differentiation” (FDR=6.4×10.sup.−10), “keratinization” (FDR=1.6×10.sup.−12), “peptidase regulator activity” (FDR=1.1×10.sup.−4), “interleukin-4 and 13 signaling” (FDR=6.8×10.sup.−7), “interferon alpha/beta signaling” and “response to interferon gamma” (FDR=4.1×10.sup.−7, and FDR=4.1×10.sup.−6, respectively), “IL23 pathway” (FDR=2×10.sup.−5), and “mitotic metaphase and anaphase” (FDR=3.8×10.sup.−10) (
[0261] To gain a better understanding of the disease regulatory networks involved in PN skin weighted gene co-expression network analysis (WGCNA) was performed. 20 co-expression modules were identified in non-lesional skin and 10 clusters in lesional PN skin (
[0262] Transcriptomic Changes in PN Lesion are Enriched for Keratinocyte and T-Cell Signatures
[0263] An in silico approach (xCell) was used to infer specific cell-type signatures for each non-lesional and lesional PN skin sample. Enrichment for transcriptomic signatures associated with epithelial cells and keratinocytes was observed (p<0.001 and p<0.0001, respectively) (
[0264] Transcriptomic Changes in PN Skin with the IL31 Receptor Inhibitor Nemolizumab
[0265] Clinical results in patients with PN showed that nemolizumab resulted in a higher percentage of improvement of pruritus and skin lesions with overall good safety profile. At Week 12 the proportion of patients achieving 4-point reduction of weekly average of the PP-NRS was significantly higher in the nemolizumab group compared to placebo (52.9% versus 8.3%, p<0.001). At Week 12 the proportion of subjects achieving IGA Success (Defined as IGA 0 [Clear] or 1 [Almost Clear]) was significantly higher in the nemolizumab group compared to placebo (20.6% versus 2.8%, p=0.02).
[0266] To address the therapeutic effect of the IL-31 receptor (IL-31R) inhibitor nemolizumab, RNA-seq data was performed from PN biopsies prior to and after 12-weeks of treatment, and used placebo controlled in a double-blinded study. At baseline, there were 16 and 15 individuals in the placebo and nemolizumab groups, respectively, and at week 12 lesional samples were obtained from 18 of the patients (11 placebo and 7 nemolizumab). Using principal component analysis (PCA) admixing of samples was observed from patients with PN at baseline between the two treatments groups (placebo vs nemolizumab). After 12 weeks of treatment, there was a trend towards grouping of the nemolizumab, but not the placebo cohort (
[0267] Nemolizumab Response is Accompanied by Decreased IL-31/Th2 Responses in PN Skin
[0268] To address the effect of nemolizumab treatment on inflammatory responses in PN skin, nemolizumab and placebo treatment response was interrogated against cytokine response signatures generated in RHE cultures as well as human epidermal rafts. A consistent decrease in IL-31 responses was observed, either solitary, or in combination with other inflammatory cytokines, including the Th2 cytokine IL-13 or IL-17A (
[0269] To determine the tissue compartment that has the largest contribution to cellular response to anti-IL-31R blockade, the transcriptomic data from placebo and nemolizumab groups was compared against gene signatures for epidermal compartments obtained from single-cell RNA-seq data. The results indicate the basal keratinocyte (KRT14+) signature was elevated in the lesional skin of PN, while this latter was restored in similar degree in both the placebo and the treatment groups, whereas the induction of the spinous layer (KRT10+) signature in the PN lesional skin was only restored by the treatment but not the placebo group (
[0270] Nemolizumab Leads to Decrease in Pruritus Scoring
[0271] Peak pruritus numeric rating scale (PP-NRS), PP-NRS was associated with the transcriptome data (
[0272] Discussion
[0273] The data presented here are the first to provide a comprehensive view of the global transcriptomic changes in PN skin, and to reveal novel and important insights into the mechanism of action and efficacy of the anti-IL-31 receptor inhibitor nemolizumab. Notably, these data reflect on the transcriptomic level many of the hallmark histologic changes observed in PN, including epidermal alteration, inflammatory response (
[0274] Many of changes in gene expression in PN skin are related to abnormal keratinocyte proliferation and differentiation (
[0275] Consistent with PN being a disease process driven by inflammation, immune responses such as Th2 (IL-4/IL-13) response and type I and type II IFN responses were prominent (
[0276] Fibrosis is a feature of PN, most prominent in the papillary dermis, and less commonly in the reticular dermis. Fibrosis in PN is characterized by deposition of vertically oriented collagen fibrils. Modules of genes were found that are involved in extracellular matrix biology to be enriched in PN skin (Table 3), involving both collagen 1 and collagen 3 genes. COL1A1, COL1A2, and COL1A3 mRNA were increased in PN skin at baseline (1.7-, 1.44-, and 1.52-fold respectively, see Table 1) but did not show significant changes with nemolizumab treatment at week 12.
[0277] This data also demonstrates how nemolizumab driven transcriptomic changes in PN correlate with improvement in pruritus. Chronic pruritus is a debilitating symptom of PN and has a profound impact on quality of life. The etiology of pruritus in PN still remains unclear but possible factors include the Th2 cytokines, IL-4 and IL-13, major pruritogens in atopic dermatitis, versus changes in cutaneous innervation, with decreased density of intraepidermal nerve fibers being shown to be reduced in both lesional and non-lesional skin. The data from the nemolizumab treatment is consistent with both of these scenarios contributing to itch. Thus, nemolizumab treatment leads to suppression of Th2 and IL-4/IL-13 responses in PN skin and also leads to decrease in expression of factors such as KLF16, which has been shown to inhibit neurite growth. In addition, nerve growth factor (NGF), which was confirmed to increase in PN skin, is also normalized with nemolizumab treatment at week 12 to a larger extent than in the placebo group (Table 1). No changes were seen for the expression of CGRP or substance P (TAC1). These data are highly suggestive of a broad effect of nemolizumab on pruritus and may account for the long duration of pruritus improvement seen beyond the last dose of nemolizumab (>2 months).
[0278] In summary, PN is a debilitating and a difficult condition to treat, and no therapies are currently approved for its treatment. This work in-depth characterization of the transcriptomic changes in PN skin and demonstrate the broad mechanisms of action of nemolizumab, an anti-IL-31 receptor inhibitor. These data demonstrate the broad therapeutic effect of anti-IL-31 receptor inhibition with nemolizumab on multiple aspects of PN pathogenesis, including epidermal differentiation, inflammatory responses, pruritus and extracellular remodeling, and confirms the upstream role of IL-31 in PN pathogenesis.
Example 2—Plasma Proteomic Analysis of Nemolizumab Treated Moderate-to-Severe Prurigo Nodularis Patients
[0279] This example details a randomized, double-blind, phase 2 trial of the anti-human IL31Ra blocking antibody nemolizumab at a dose of 0.5 mg per kilogram of body weight, administered subcutaneously at baseline, week 4 and week 8, as compared with placebo, in patients with moderate to severe prurigo nodularis. The goal of this study was to characterize the effect of nemolizumab on the entire plasma proteome by using mass spectrometry.
[0280] Materials and Methods
[0281] Patient Dataset
[0282] Nineteen (19) placebo non-responders and nineteen (19) nemolizumab responders were selected on the basis of their change in PP-NRS (Peak Pruritus scores on the Numerical Rating Scale) clinical scores at week 12 (19 placebo patients with PP-NRS change ≥−1.4, 19 and nemolizumab patients with PP-NRS change <−5.4). PP-NRS scores at baseline and PP-NRS after 12 weeks of nemolizumab treatment are shown in
[0283] Protocol
[0284] After plasma gY14-super-depletion, samples were analyzed using the TMT calibrator MS2 workflow at Proteome Science. A pool of heathy skin biopsies was used in order to 1) allow batch correction between each plex, 2) trigger the mass spectrometer to detect skin related peptide in the blood.
[0285] Statistics
[0286] Only peptides which corresponded to a unique protein were used for the statistical analysis. Both baseline corrected, and baseline non-corrected values were used to compute differentially expressed proteins. Three statistical tests were used to compute the list of differentially expressed proteins: 1) least square regression method (with and without including patient ID), 2) robust regression method, 3) generalized regression method. 193 proteins were found differentially expressed (adjusted p-value <0.05). No additional (e.g. log FC filters) filters were applied on this protein list. Enrichment analysis was performed using the 193 proteins found differentially expressed with the use of QIAGEN IPA (QIAGEN Inc., digitalinsights.qiagen.com/IPA)).
[0287] Results
[0288] The list of 193 differentially expressed proteins was then analyzed with the enrichment software IPA. While the p-values indicate the significance of the pathways impacted in the dataset, the z-scores provide insights into the directionality, i.e., how “activated” or “inhibited” are the pathways in the dataset.
[0289] Canonical pathways were either sorted according to z-scores only (
[0290] Upstream regulator analysis allowed for the identification of transcription factors and small molecules whose functions are impacted by disease or treatment depending in the dataset analyzed. Though proteins identified in this analysis may not themselves be differentially expressed in the studied dataset, their activation/inhibition status could explain the expression changes in the dataset. Canonical pathways were either sorted according to z-scores only (
[0291] Biological function analysis of nemolizumab responders revealed downregulated “leukocyte migration” and downregulated “cell movement of leukocytes”. In addition, two terms associated with the neuronal axis were downregulated: “Cell death of neuroglia”, “Apoptosis of neuroglia”, possibly reflecting an improvement pruritus (
[0292] Discussion
[0293] The present Example aimed to perform a broad and exploratory analysis to identify plasma protein biomarkers that could also explain the mechanism of action of nemolizumab treatment.
[0294] To characterize the entire gamut of plasma proteomic changes, pre-selected groups of nemolizumab responders and placebo non-responders were assessed. Due to this pre-selection of patients, the signature described in this Example may not only reflect the changes induced by nemolizumab but also the change due to decreasing PP-NRS.
[0295] The dataset analyzed in this study reveals that nemolizumab responder signature was characterized by an improvement of various aspects of PN pathophysiology including inflammation, neuroimmune function, and tissue remodeling.
[0296] Enrichment analysis reveals that the nemolizumab responder signature was characterized by a decrease of migration and cell movement of leukocytes. The STAT3 pathway, a direct target of IL-31 signaling was also inhibited in nemolizumab responder subjects suggesting target engagement. Nemolizumab responders also displayed downregulation of other pro-inflammatory cytokine pathways including IL-6 and VEGF pathways.
[0297] Pathway analysis also revealed the impact of nemolizumab treatment on neuron-associated processes including “(“CREB signaling in neurons” and “Synaptogenesis signaling pathway”, “Cell death of neuroglia”, “Apoptosis of neuroglia”, in line with the observed clinical impact of nemolizumab on pruritus.
[0298] Finally, the data set showed a decrease in TGFB1 pathway activation suggesting an impact of nemolizumab treatment on tissue remodeling.
[0299] These observations reinforce the understanding that plasma proteomics can effectively capture, at least in part, tissue specific (i.e., skin) effects of nemolizumab in PN.
TABLE-US-00009 Lengthy table referenced here US20220411518A1-20221229-T00001 Please refer to the end of the specification for access instructions.
TABLE-US-00010 Lengthy table referenced here US20220411518A1-20221229-T00002 Please refer to the end of the specification for access instructions.
TABLE-US-00011 Lengthy table referenced here US20220411518A1-20221229-T00003 Please refer to the end of the specification for access instructions.
TABLE-US-00012 Lengthy table referenced here US20220411518A1-20221229-T00004 Please refer to the end of the specification for access instructions.
TABLE-US-00013 Lengthy table referenced here US20220411518A1-20221229-T00005 Please refer to the end of the specification for access instructions.
TABLE-US-LTS-00001 LENGTHY TABLES The patent application contains a lengthy table section. A copy of the table is available in electronic form from the USPTO web site (). An electronic copy of the table will also be available from the USPTO upon request and payment of the fee set forth in 37 CFR 1.19(b)(3).