MODIFIED CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE REGULATOR (CFTR) POLYPEPTIDES WITH INCREASED STABILITY AND USES THEREOF
20190248855 ยท 2019-08-15
Inventors
- John C. Kappes (Homewood, AL, US)
- Zhengrong Yang (Hoover, AL, US)
- Christie G. Brouillette (Birmingham, AL, US)
- Ina L. Urbatsch (Lubbock, TX, US)
Cpc classification
G01N33/6872
PHYSICS
C07K14/705
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention is directed to modified CFTR proteins or fragments thereof that contain single or multiple amino acid mutations to improve the structural stability of such CFTR proteins and/or fragments. Specifically, the modified CFTR proteins or fragment thereof differ from the wild-type human CFTR protein or fragment thereof by the presence of four or more mutations selected from V150D, M470V, S492P, F494N, 5495P, A534P, I539T, G550E, G551D, R553Q, R555K, Q637R, 51255L, K1334G, 51359A, E1371Q, H14025, Q1411D, and any combination thereof, such that the stability of the polypeptide is increased relative to that of the wild-type human CFTR polypeptide or fragment thereof.
Claims
1. A modified human cystic fibrosis transmembrane conductance regulator (CFTR) polypeptide or functional fragment thereof, wherein the polypeptide or functional fragment thereof differs from the wild-type human CFTR protein (SE Q ID NO:1) or fragment thereof by the presence of four or more, mutations selected, from V150D, M470V, S492P, F494N, S495P, A534P, I539T, G550E, G551D, R553Q, R555K, Q637R, S1255L, K1334G, S1359A, E1371Q, H1402S, Q1411D, and any combination thereof, such that the stability of the polypeptide is increased relative to that of the wild-type human CFTR polypeptide or fragment thereof.
2. The modified polypeptide or functional fragment thereof of claim 1 comprising five or more mutations.
3. The modified polypeptide or functional fragment thereof of claim 1 comprising six or more mutations.
4-6. (canceled)
7. The modified polypeptide or functional fragment thereof of claim 1, wherein the four or more mutations are selected from S492P, F494N, S495P, A534P, I5397, G550E, R555K, and any combination thereof.
8-14. (canceled)
15. The modified polypeptide or functional fragment thereof of claim 1, wherein the four or more mutations are selected from M470V, S492P, S495P, A534P, I539T, and any combination thereof.
16. The modified polypeptide or functional fragment thereof of claim 1, wherein the four mutations are S492P, S495P, A534P, and I539T; or M470V, S492P, S495P, and A534P; or S495P, I539T, G550E, and R555K.
17. The modified polypeptide or functional fragment thereof of claim 1, wherein the four or more mutations are selected from M470V, S492P, S495P, A534P, I539T, R555K, and any combination thereof.
18. (canceled)
19. The modified polypeptide or functional fragment thereof of claim 1, wherein the four or more mutations are selected from S492P, S495P, A534P, I539T, R553Q, R555K, and any combination thereof.
20. The modified polypeptide or functional fragment thereof of claim 1, wherein the polypeptide or fragment further comprises a deletion of amino acid residue F508 (F508).
21. The modified CFTR polypeptide or functional fragment thereof of claim 1, wherein the polypeptide or fragment further comprises a deletion of amino acid residues 405-436 (RI) or a deletion of amino acid residues 404-435 (RI).
22. The modified CTFR polypeptide or functional fragment thereof of claim 21, wherein the four or more mutations are: S492P, F494N, S495P, A534P, I539T, G550E, R555K, S1255L, K1334G, S1359A, and Q1411D; or S492P, A534P, I539T, S1255L, K1334G, S1359A, and Q1411; or S492P, F494N, S495P, A534P, I539T, G550E, R555K, and S1359A; or S492P, F494N, S495P, A534P, I539T, G550E, and R555K; or M470V, S492P, S495P, A534P, I539T, and R555K; or M470V, S492P, S495P, A534P, and I539T; or S492P, A534P, I539T, and S1359A.
23-28. (canceled)
29. A modified human cystic fibrosis transmembrane conductance regulator (CFTR) polypeptide or functional fragment thereof, wherein the polypeptide differs from the wild-type human CFTR protein (SEQ ID NO:1) or fragment thereof by the presence of one, two, or three mutations selected from V150D, M470V, S492P, F494N, S495P, I539T, G550E, G551D, R553Q, R555K, Q637R, H1402S, E1371Q, and any combination thereof, such that the stability of the polypeptide is increased relative to that of the wild-type human CFTR polypeptide or fragment thereof.
30-46. (canceled)
47. A modified human CFTR polypeptide or functional fragment thereof, wherein the modified CFTR polypeptide or functional fragment thereof differs from the wild-type human CFTR protein (SEQ ID NO:1) or fragment thereof by the presence of four or more mutations of amino acid residues located in the Helix 1, Q-loop, F508-loop, SDR loop, Helix 5 or any combination thereof of the polypeptide, such that the structural stability of the polypeptide is increased relative to that of the wild-type CFTR protein or fragment thereof.
48-53. (canceled)
54. The modified polypeptide or functional fragment thereof of claim 1, wherein the CFTR fragment is the amino acid sequence of the nuclear binding domain 1 (NBD1).
55. The modified polypeptide or functional fragment thereof of claim 1, further comprising one or more tags, selected from a His.sub.10-purification tag, FLAG epitope, a green fluorescent protein (EGFP), and a SUMO fusion protein epitope.
56. A composition comprising the modified polypeptide, or functional fragment of claim 1.
57. A method of studying CFTR structure and/or function, comprising using the modified polypeptide or functional fragment of claim 1, in the method.
58. A method of screening a compound using the modified polypeptide or functional fragment of claim 1 to identify a compound that modulates one or more biological and/or physical properties of the modified CFTR polypeptide, wherein the modified CFTR polypeptide further comprises one or more destabilizing mutations relative to the wild-type human CFTR protein (SEQ ID NO:1) or fragment thereof.
59. A nucleic acid molecule encoding the modified polypeptide or functional fragment of claim 1.
60. (canceled)
61. A vector comprising, the nucleic acid molecule of claim 58.
62. A cell comprising the modified polypeptide or functional fragment of claim 1.
63. (canceled)
64. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
DETAILED DESCRIPTION
[0028] The present invention will now be described in more detail with reference to the accompanying drawings, in which preferred embodiments of the invention are shown. This invention may, however, be embodied in different forms and should not be construed as limited to the embodiments set forth herein. Rather, these embodiments are provided so that this disclosure will be thorough and complete, and will fully convey the scope of the invention to those skilled in the art. In addition, any references cited herein are incorporated by reference in their entireties.
[0029] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of skill in the art to which this invention belongs. The terminology used in the description of the invention herein is for the purpose of describing particular embodiments only and is not intended to be limiting of the invention. All publications, patent applications, patents, patent publications and other references cited herein are incorporated by reference in their entireties for the teachings relevant to the sentence and/or paragraph in which the reference is presented.
[0030] Amino acids are represented herein in the manner recommended by the IUPAC-IUB Biochemical Nomenclature Commission, or (for amino acids) by either the one-letter code, or the three letter code, both in accordance with 37 C.F.R. 1.822 and established usage.
[0031] Except as otherwise indicated, standard methods known to those skilled in the art may be used for cloning genes, amplifying and detecting nucleic acids, and the like. Such techniques are known to those skilled in the art. See, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual 2nd Ed. (Cold Spring Harbor, N.Y., 1989); Ausubel et al. Current Protocols in Molecular Biology (Green Publishing Associates, Inc. and John Wiley & Sons, Inc., New York).
[0032] Unless the context indicates otherwise, it is specifically intended that the various features of the invention described herein can be used in any combination.
[0033] Moreover, the present invention also contemplates that in some embodiments of the invention, any feature or combination of features set forth herein can be excluded or omitted.
[0034] To illustrate, if the specification states that a complex comprises components A, B and C, it is specifically intended that any of A, B or C, or a combination thereof, can be omitted and disclaimed singularly or in any combination.
[0035] As used in the description of the invention and the appended claims, the singular forms a, an, and the are intended to include the plural forms as well, unless the context clearly indicates otherwise.
[0036] Also as used herein, and/or refers to and encompasses any and all possible combinations of one or more of the associated listed items, as well as the lack of combinations when interpreted in the alternative (or).
[0037] The term about, as used herein when referring to a measurable value such as an amount of polypeptide, dose, time, temperature, enzymatic activity or other biological activity and the like, is meant to encompass variations of 10%, 5%, 1%, 0.5%, or even 0.1% of the specified amount.
[0038] As used herein, the transitional phrase consisting essentially of (and grammatical variants) is to be interpreted as encompassing the recited materials or steps and those that do not materially affect the basic and novel characteristic(s) of the claimed invention. Thus, the term consisting essentially of as used herein should not be interpreted as equivalent to comprising.
[0039] The term consists essentially of (and grammatical variants), as applied to a polypeptide or polynucleotide sequence of this invention, means a polypeptide or polynucleotide that consists of both the recited sequence (e.g., SEQ ID NO) and a total of ten or less (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) additional amino acids on the N-terminal and/or C-terminal ends of the recited sequence or additional nucleotides on the 5 and/or 3 ends of the recited sequence such that the function of the polypeptide or polynucleotide is not materially altered. The total of ten or less additional amino acids or nucleotides includes the total number of additional amino acids or nucleotides on both ends added together. The term materially altered, as applied to polypeptides of the invention, refers to an increase or decrease in biological activities/properties (e.g., ATPase activity, ion channel conductivity, and/or protein folding/stability) of at least about 50% or more as compared to the activity of a polypeptide consisting of the recited sequence.
[0040] The term modulate, modulates, or modulation refers to enhancement (e.g., an increase) or inhibition (e.g., a decrease) in the specified level or activity.
[0041] The term enhance or increase refers to an increase in the specified parameter of at least about 1.25-fold, 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 8-fold, 10-fold, twelve-fold, or even fifteen-fold and/or can be expressed in the enhancement and/or increase of a specified level and/or activity of at least about 1%, 5%, 10%, 15%, 25%, 35%, 40%, 50%, 60%, 75%, 80%, 90%, 95% or more
[0042] The term inhibit or reduce or grammatical variations thereof as used herein refers to a decrease or diminishment in the specified level or activity of at least about 1, 5, 10, 15%, 25%, 35%, 40%, 50%, 60%, 75%, 80%, 90%, 95% or more. In particular embodiments, the inhibition or reduction results in little or essentially no detectible activity (at most, an insignificant amount, e.g., less than about 10% or even 5%).
[0043] The term contact or grammatical variations thereof as used with respect to a polypeptide and a receptor, refers to bringing the polypeptide and the receptor in sufficiently close proximity to each other for one to exert a biological effect on the other. In some embodiments, the term contact means binding of the polypeptide to the receptor.
[0044] The term fragment, as applied to a peptide, will be understood to mean an amino acid sequence of reduced length relative to a reference peptide (e.g., WT CFTR protein) or amino acid sequence (e.g., NBD1 domain) and comprising, consisting essentially of, and/or consisting of an amino acid sequence of contiguous amino acids identical to the reference peptide or amino acid sequence. Such a peptide fragment according to the invention may be, where appropriate, included in a larger polypeptide of which it is a constituent. In some embodiments, such fragments can comprise, consist essentially of, and/or consist of peptides having a length of at least about 5, 10, 15, 20, 25, 30, 35, 46. 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 100 or more consecutive amino acids of a peptide or amino acid sequence according to the invention.
[0045] As used herein, the terms nucleic acid or nucleic acid molecule encompass both RNA and DNA, including cDNA, genomic DNA, synthetic (e.g., chemically synthesized) DNA and chimeras of RNA and DNA. The nucleic acid molecule may be double-stranded or single-stranded. The nucleic acid molecule may be synthesized using nucleotide analogs or derivatives (e.g., inosine or phosphorothioate nucleotides). Such nucleotides can be used, for example, to prepare nucleic acid molecules that have altered base-pairing abilities or increased resistance to nucleases.
[0046] As used herein, the term polypeptide encompasses both peptides and proteins (including fusion proteins), unless indicated otherwise.
[0047] A fusion protein is a polypeptide produced when two heterologous nucleotide sequences or fragments thereof coding for two (or more) different polypeptides not found fused together in nature are fused together in the correct translational reading frame. Illustrative fusion polypeptides include fusions of a peptide of the invention (or a fragment thereof) to all or a portion of glutathione-S-transferase, maltose-binding protein, or a reporter protein (e.g., Green Fluorescent Protein, -glucuronidase, -galactosidase, luciferase, etc.), hemagglutinin, c-myc, FLAG epitope, etc.
[0048] A recombinant nucleic acid, polynucleotide or nucleotide sequence is one produced by genetic engineering techniques.
[0049] A recombinant polypeptide is produced from a recombinant nucleic acid, polypeptide or nucleotide sequence.
[0050] As used herein, a functional polypeptide or functional fragment is one that substantially retains at least one biological activity normally associated with that polypeptide (e.g., WT CFTR protein or fragment thereof). In particular embodiments, the functional polypeptide or functional fragment substantially retains all of the activities possessed by the unmodified polypeptide (e.g., WT CFTR protein or fragment thereof). By substantially retains biological activity, it is meant that the polypeptide retains at least about 20%, 30%, 40%, 50%, 60%, 75%, 85%, 90%, 95%, 97%, 98%, 99%, or more, of the biological activity of the native polypeptide (and can even have a higher level of activity than the native polypeptide). A non-functional polypeptide is one that exhibits little or essentially no detectable biological activity normally associated with the polypeptide (e.g., at most, only an insignificant amount, e.g., less than about 10% or even 5%). Biological activities such as ATPase activity, ion channel conductivity, and/or protein folding can be measured using assays that are well known in the art and as described herein.
[0051] As used herein, the term host cell refers to a cell that is engineered to express the recombinant modified CFTR polypeptide or functional fragment thereof (e.g., full length CFTR protein or a fragment thereof, such as the NBD1 domain). Host cell refers not only to the particular subject cell but to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.
[0052] As used herein, an isolated polynucleotide (e.g., an isolated nucleic acid or an isolated nucleotide sequence) means a polynucleotide at least partially separated from at least some of the other components of the naturally occurring organism or virus, for example, the cell or viral structural components or other polypeptides or nucleic acids commonly found associated with the polynucleotide. Optionally, but not necessarily, the isolated polynucleotide is present at a greater concentration (i.e., is enriched) as compared with the starting material (e.g., at least about a two-fold, three-fold, four-fold, ten-fold, twenty-fold, fifty-fold, one-hundred-fold, five-hundred-fold, one thousand-fold, ten thousand-fold or greater concentration). In representative embodiments, the isolated polynucleotide is at least about 1%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or more pure.
[0053] An isolated polypeptide means a polypeptide that is at least partially separated from at least some of the other components of the naturally occurring organism or virus, for example, the cell or viral structural components or other polypeptides or nucleic acids commonly found associated with the polypeptide. Optionally, but not necessarily, the isolated polypeptide is present at a greater concentration (i.e., is enriched) as compared with the starting material (e.g., at least about a two-fold, three-fold, four-fold, ten-fold, twenty-fold, fifty-fold, one-hundred-fold, five-hundred-fold, one thousand-fold, ten thousand-fold or greater concentration). In representative embodiments, the isolated polypeptide is at least about 1%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or more pure.
[0054] The terms polynucleotide, nucleic acid and oligonucleotide are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides or analogs thereof. Polynucleotides can have any three-dimensional structure and may perform any function, known or unknown. The following are non-limiting examples of polynucleotides: a gene or gene fragment (for example, a probe, primer, EST or SAGE tag), exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes and primers. A polynucleotide can comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure can be imparted before or after assembly of the polynucleotide. The sequence of nucleotides can be interrupted by non-nucleotide components. A polynucleotide can be further modified after polymerization, such as by conjugation with a labeling component. The term also refers to both double- and single-stranded molecules. Unless otherwise specified or required, any embodiment of this invention that is a polynucleotide encompasses both the double-stranded form and each of two complementary single-stranded forms known or predicted to make up the double-stranded form.
[0055] As used herein, expression refers to the process by which polynucleotides are transcribed into mRNA and/or the process by which the transcribed mRNA is subsequently being translated into peptides, polypeptides, or proteins. If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in a eukaryotic cell.
[0056] A polynucleotide or polynucleotide region (or a polypeptide or polypeptide region) having a certain percentage (for example, 80%, 85%, 90%, or 95%) of sequence identity to another sequence means that, when aligned, that percentage of bases (or amino acids) are the same in comparing the two sequences. The alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example, those described in Current Protocols in Molecular Biology (Ausubel et al., eds. 1987) Supplement 30, section 7.7.18, Table 7.7.1. Preferably, default parameters are used for alignment. One alignment program is BLAST, using default parameters. Examples of the programs include BLASTN and BLASTP, using the following default parameters: Genetic code=standard; filter=none; strand=both; cutoff=60; expect=10; Matrix=BLOSUM62; Descriptions=50 sequences; sort by=HIGH SCORE; Databases=non-redundant, GenBank+EMBL+DDBJ+PDB+GenBank CDS translations+SwissProtein+SPupdate+PIR. Details of these programs can be found at the following Internet address: ncbi.nlm.nih.gov/cgi-bin/BLAST.
[0057] The term vector is used to refer to a carrier nucleic acid molecule into which a nucleic acid sequence can be inserted for introduction into a cell where it can be replicated. A nucleic acid sequence can be exogenous, which means that it is foreign to the cell into which the vector is being introduced or that the sequence is homologous to a sequence in the cell but in a position within the host cell nucleic acid in which the sequence is ordinarily not found. Vectors include plasmids, cosmids, and viruses (bacteriophage, animal viruses, and plant viruses)
[0058] The term expression vector refers to a vector containing a nucleic acid sequence coding for at least part of a gene product capable of being transcribed. In some cases, RNA molecules are then translated into a protein, polypeptide, or peptide. In other cases, these sequences are not translated, for example, in the production of antisense molecules or ribozymes. Expression vectors can contain a variety of control sequences, which refer to nucleic acid sequences necessary for the transcription and possibly translation of an operably linked coding sequence in a particular host organism. In addition to control sequences that govern transcription and translation, vectors and expression vectors may contain nucleic acid sequences that serve other functions as well and are described infrHost cells may be derived from prokaryotes or eukaryotes, depending upon whether the desired result is replication of the vector or expression of part or all of the vector-encoded nucleic acid sequences. Prokaryotes include gram negative or positive cells. Numerous cell lines and cultures are available for use as a host cell, and they can be obtained through the American Type Culture Collection (ATCC), which is an organization that serves as an archive for living cultures and genetic materials (www.atcc.org). An appropriate host can be determined by one of skill in the art based on the vector backbone and the desired result. A plasmid or cosmid, for example, can be introduced into a prokaryote host cell for replication of many vectors. Bacterial cells used as host cells for vector replication and/or expression include DH5a, JM109, and KC8, as well as a number of commercially available bacterial hosts such as SURE Competent Cells and SOLOPACK Gold Cells (STRATAGENE, La Jolla). Alternatively, bacterial cells such as E. coli LE392 could be used as host cells for phage viruses.
[0059] CFTR functions as a chloride- and bicarbonate-selective ion channel in the plasma membrane (J. R. Riordan, et al., Science 245 (1989) 1066-1073; D. N. Sheppard, et al., Physiol. Rev. 79 (1999) S23-45; J. R. Riordan, et al., Annu. Rev. Biochem. 77 (2008) 701-726). Genetic defects in CFTR cause cystic fibrosis (CF), a life-threatening disease manifested by dysregulation of epithelial fluid in the lungs, pancreas and other organs. More than 2000 mutations have been reported in the CFTR gene, of which at least 280 mutations are confirmed to cause the disease (P. R. Sosnay, et al., Nat. Genet. 45 (2013) 1160-1167). Depending on location within the CFTR gene, disease-causing mutations vary in severity, and have been categorized into six classes according to their phenotypes in reducing protein expression, function, and/or stability (M. D. Amaral, et al., Curr. Pharm. Des. 19 (2013) 3497-3508; B. S. Quon, et al., BMJ 352 (2016) i859; G. Veit, et al., Mol. Biol. Cell 27 (2016) 424-433).
[0060] Personalized medicine treating a CF patient's underlying defect has become a high priority, and is actively endorsed by the Cystic Fibrosis Foundation (B. S. Quon, et al., Can. Respir. J. 22 (2015) 257-260). A prominent success is the recently FDA-approved channel potentiator ivacaftor (Kalydeco, VX-770), that improves channel activity in G551D and other gating mutations (about 8% of the patient population) (B. S. Quon, et al., BMJ 352 (2016) i859; G. Veit, et al., Mol. Biol. Cell 27 (2016) 424-433; C; Sheridan, et al., Nat. Biotechnol. 29 (2011) 465-466; S. L. Martiniano, et al., Curr. Opin. Pediatr. 28 (3) (2016) 312-317). Yet the majority of patients still have few treatment options. The most prevalent disease-causing mutation is a single amino acid deletion, F508, of which at least one allele is found in 85-90% of CF patients (P. R. Sosnay, et al., Nat. Genet. 45 (2013) 1160-1167). F508 severely compromises CFTR folding, thus resulting in faulty maturation, poor localization to the cell surface, and reduced channel function by the few molecules which do reach the cell surface (G. L. Lukacs, et al., Trends Mol. Med. 18 (2012) 81-91; K. Du, et al., Nat. Struct. Mol. Biol. 12 (2005) 17-25). Recently tested combination therapies for patients with F508-CFTR that target these multiple defects (Orkambi, or three next-generation CFTR modulator therapies with ivacaftor and tezacaftor (VX-661)) improved function by only a modest 3-15% (W. Zhang, et al., Drugs Today (Barc) 52 (2016) 229-237; E. K. Schneider, et al., Clin. Pharmacol. Ther. 101 (2017) 130-141). Thus, there is a pressing need to better understand CFTR folding, structure and function, not only to address how these are affected in patients with CF, but also to comprehend the effects of potential drug candidates.
[0061] CFTR is an atypical ATP-binding cassette (ABC) transporter with two transmembrane domains that harbor the ion channel, and two non-identical nucleotide binding domains (NBD1 and NBD2) that bind and hydrolyze ATP to gate the channel; gating is regulated by phosphorylation of a unique R-region (D. N. Sheppard, et al., Physiol. Rev. 79 (1999) S23-45; J. R. Riordan, et al., Annu. Rev. Biochem. 77 (2008) 701-726; D. C. Gadsby, et al., Nature 440 (2006) 477-483). Complex folding and domain assembly are limiting steps in the biogenesis and trafficking of CFTR (S. J. Kim, et al., Front. Pharmacol. 3 (2012) 201), and these are compromised by many CF-causing mutations such as F508 in NBD1, resulting in protein misfolding and degradation by cellular quality control systems (G. L. Lukacs, et al., Trends Mol. Med. 18 (2012) 81-91). Due to intensive efforts to understand the consequences of F508 deletion, high resolution X-ray structures of bacterially expressed isolated NBD1 domain have been solved for wild-type (WT) and AF508 mutants from human and mouse (H. A. Lewis, et al., EMBO J. 23 (2004) 282-293; H. A. Lewis, et al., J. Biol. Chem. 280 (2005) 1346-1353; S. Atwell, et al., Protein Eng. Des. Sel. 23 (2010) 375-384; H. A. Lewis, et al., J. Mol. Biol. 396 (2010) 406-430). While F508 alters NBD1 structure very little, it severely affects the folding kinetics, biogenesis, and the stability and dynamics of the domain (C. Wang, et al., Protein Sci. 19 (2010) 1932-1947; I. Protasevich, et al., Protein Sci. 19 (2010) 1917-1931; P. H. Thibodeau, et al., J. Biol. Chem. 285 (2010) 35825-35835; R. P. Hudson, et al., J. Biol. Chem. 287 (2012) 28480-28494; M. Zhenin, et al., J. Chem. Inf. Model. 55 (2015) 2349-2364). F508 is situated on the surface of NBD1 near the interface with the intracellular loops (ICLs) that connect to the transmembrane helices. This interfacial position, akin to a ball and socket joint, further complicates the folding and stability of NBD1 when in the context of the full-length protein, and may explain why a single amino acid deletion causes multiple defects that ultimately lead to defective CFTR biogenesis and compromised function at the cell surface (G. L. Lukacs, et al., Trends Mol. Med. 18 (2012) 81-91; S. J. Kim, et al., Front. Pharmacol. 3 (2012) 201; P. H. Thibodeau, et al., J. Biol. Chem. 285 (2010) 35825-35835; J. L. Mendoza, et al., Cell 148 (2012) 164-174; W. M. Rabeh, et al., Cell 148 (2012) 150-163).
[0062] Recently, the first structures of full-length CFTR from human and zebrafish (55% sequence identity to human) in a dephosphorylated, inactive state have been solved by cryoelectron microscopy (cryo-EM) at a nominal resolution of 3.7 to 3.9 (PDB 5uar, 5uak) (Z. Zhang, et al., Cell 167 (2016) 1586-1597 (e1589); F. Liu, et al., Cell 169 (2017) 85-95 (e88)). These structures revealed details of the transmembrane -helical domains and the channel forming pore, with NBD1 and NBD2 widely separated and intercalated by portions of the regulatory R-region; but structures of the NBDs were of low resolution and most of the R-region, the regulatory insertion (RI), the fourth extracellular loop and the C-terminus could not be assigned, perhaps due to their disordered nature. A subsequent 3.4 resolution structure of phosphorylated zebrafish CFTR showed two well-ordered NBDs in an asymmetric sandwich dimer conformation with two bound, non-hydrolyzed ATP molecules, with the channel open to the cytoplasm and the extracellular gate closed (PDB 5W81) (Z. Zhang, et al., Cell 170 (2017) 483-491.e488). The structure revealed insights into the gating mechanism and likely presents a pre-open closed channel state (J. Zhang, et al., J. Gen. Physiol. 149 (2017) 355-372; W. Y. Lin, et al., Mol. Pharmacol. 90 (2016) 275-285). Despite these recent breakthroughs, higher resolution structures of human WT CFTR and of CFTR with at least some of the CF-causing mutations, and in conformationally distinct functional states, are still needed to better reveal the underlying structural defect for the many types of disease-causing mutations, and to advance therapeutic strategies. For such studies, it will be critical to have accompanying biochemical and biophysical evidence of perturbations caused by the different mutant theratypes. A stable and monodisperse protein is the key to higher resolution structures whether by cryo-EM or crystallography, and also for biochemical and biophysical studies to probe the energetics, dynamics and mechanism of action that cannot be revealed by structure alone. However, the low stability of CFTR in detergent solution, and even more so AF508-CFTR and other folding mutations, has impeded progress (X. Meng, et al., Cell. Mol. Life Sci. 74 (2017) 23-38).
[0063] A validated approach to improve CFTR stability comes from the body of literature describing second site mutations of AF508-CFTR (X. Liu, et al., Biochemistry 51 (2012) 5113-5124; L. He, et al., J. Mol. Biol. 427 (2015) 106-120; Z. Xu, et al., J. Physiol. 592 (2014) 1931-1947). Those studies utilized sequence alignments and yeast screens of chimeric ABC transporters to identify mutations in NBD1 that rescued biogenesis of full-length F508-CFTR (J. L. Teem, et al., Receptors Channels 4 (1996) 63-72; J. L. Teem, et al., Cell 73 (1993) 335-346; A. C. DeCarvalho, et al., J. Biol. Chem. 277 (2002) 35896-35905; L. He, et al., FASEB J. 24 (2010) 3103-3112; A. A. Aleksandrov, et al., J. Mol. Biol. 419 (2012) 41-60). Structural and biophysical studies of NBD1 domain constructs containing strategic mutations improved F508- and F508-NBD1 solution properties and thermal stability (H. A. Lewis, et al., J. Biol. Chem. 280 (2005) 1346-1353; S. Atwell, et al., Protein Eng. Des. Sel. 23 (2010) 375-384; H. A. Lewis, et al., J. Mol. Biol. 396 (2010) 406-430). It was further demonstrated that certain of these F508-stabilizing mutations increased biogenesis of WT CFTR in mammalian cells (W. M. Rabeh, et al., Cell 148 (2012) 150-163; L. S. Pissarra, et al., Chem. Biol. 15 (2008) 62-69), and some improved thermal stability of CFTR channel function (L. He, et al., J. Mol. Biol. 427 (2015) 106-120; L. A. Aleksandrov, et al., Protein Expr. Purif. 116 (2015) 159-166). Several recent reports have shown that select mutations which thermostabilized NBD1 also enhanced thermal stability of purified CFTR (L. A. Aleksandrov, et al., Protein Expr. Purif 116 (2015) 159-166; Z. Yang, et al., Pediatr. Pulmonol. 51 (2016) 218; I. L. Urbatsch, et al., Pediatr. Pulmonol. 51 (2016) 197; L. He, et al., Pediatr. Pulmonol. 51 (2016) 197; E. Hildebrandt, et al., Biochim. Biophys. Acta Biomembr. 1859 (2017) 289-293. From these cited studies, a tacit correlation has emerged suggesting that mutations that enhance NBD1 domain structural stability will also improve the structural stability of the full length CFTR.
[0064] In order to broaden the utility of this implicit correlation, the inventors have conducted a systematic analysis of NBD1 stabilization by a panel of mutations, singly or in combinations. The inventors then investigated their consequences on the stability of purified full-length CFTR. Two hypotheses were tested: 1) that specific combinations of single substitutions can be identified which will cumulatively yield an NBD1 domain with highly improved structural stability; and 2) that stabilizing NBD1 in full-length CFTR will enhance structural stability of purified CFTR in detergent solution. The study serves the overarching goal of producing full-length CFTR proteins with highly improved structural stability. Stabilized human CFTR may be valuable for biophysical and structural studies that advance CF drug development, and future mechanistic and structural studies of rare CF-causing mutations.
[0065] Accordingly, one aspect of the invention relates to a modified human CFTR polypeptide or functional fragment thereof, wherein the polypeptide composition from the wild-type human CFTR protein (SEQ ID NO:1) or fragment thereof by the presence of four or more mutations of amino acid residues located in the Helix 1, Q-loop, F508-loop, SDR loop, Helix 5 or a combination thereof of the polypeptide, such that the structural stability of the polypeptide is increased relative to that of the wild-type CFTR protein or fragment thereof. In some embodiments, the four or more mutations of amino acid residues are located in the Helix 1 of the modified CFTR polypeptide. In some embodiments, the four or more mutations of amino acid residues are present in the Q-loop of the modified CFTR polypeptide. In some embodiments, the four or more mutations of amino acid residues are present in the SDR loop of the modified CFTR polypeptide. In some embodiments, the four or more mutations of amino acid residues are present in the F508-loop of the modified CFTR polypeptide. In some embodiments, the four or more mutations of amino acid residues are present in the SDR-loop, Q-loop and the Helix 5 of the modified CFTR polypeptide. In some embodiments, the four or more mutations are present in the SDR loop, Helix 1, and Q-loop of the modified CFTR polypeptide.
[0066] Accordingly, another aspect of the invention relates to mutations of one or more specific amino acid residues in these named locations of the modified CFTR polypeptide or functional fragment thereof. Thus, some embodiments of the invention relate to a modified CFTR polypeptide or functional fragment thereof of a wild-type CFTR protein (SEQ ID NO:1) or fragment thereof, wherein the polypeptide or functional fragment thereof differs from the wild-type CFTR protein (SEQ ID NO:1) or fragment thereof by the presence of four or more mutations selected from V150D, M470V, S492P, F494N, S495P, A534P, I539T, G550E, G551D, R553Q, R555K, Q637R, S1255L, K1334G, S1359A, E1371Q, H1402S, Q1411D, and any combination thereof, such that the stability of the polypeptide is increased relative to that of the wild-type human CFTR polypeptide or fragment thereof. In some embodiments, the polypeptide or functional fragment of the invention comprises five or more mutations. In some embodiments, the polypeptide or functional fragment of the invention comprises six or more mutations. In some embodiments, the polypeptide or functional fragment of the invention comprises seven or more mutations. In some embodiments, the four or more mutations are selected from S492P, F494N, S495P, A534P, I539T, G550E, R555K, S1255L, K1334G, S1359A, Q1411D and any combination thereof. In some embodiments, the four or more mutations are selected from S492P, F494N, S495P, A534P, I539T, G550E, R555K, S1359A, and any combination thereof. In some embodiments, the four or more mutations are selected from S492P, F494N, S495P, A534P, I539T, G550E, R555K, and any combination thereof. In some embodiments, the four or more mutations are selected from S492P, F494N, S495P, I539T, G550E, R555K, and any combination thereof. In some embodiments, the four mutations are S495P, I539T, G550E, and R555K.
[0067] In some embodiments, the four or more mutations are selected from S492P A534P, I539T, S1255L, K1334G, S1359A, Q1411D, and any combination thereof. In some embodiments, the four mutations are S492P A534P, I539T, S1359A. In some embodiments, the four or more mutations are selected from M470V, S492P, S495P, A534P, I539T, R555K, E1371Q, H1402S, and any combination thereof. In some embodiments, the four or more mutations are selected from M470V, S492P, S495P, A534P, I539T, R555K, H1402S, and any combination thereof. In some embodiments, the four or more mutations are selected from M470V, S492P, S495P, A534P, I539T, R555K, E1371Q, and any combination thereof. In some embodiments, the four or more mutations are selected from M470V, S492P, S495P, A534P, I539T, and any combination thereof. In some embodiments, the four mutations are S492P, S495P, A534P, and I539T.
[0068] In some embodiments, the four or more mutations are selected from M470V, S492P, S495P, A534P, I539T, R555K, and any combination thereof. In some embodiments, the four mutations are M470V, S492P, I539T, and A534P.
[0069] In some embodiments, the four or more mutations are selected from S492P, S495P, A534P, I539T, R555K, R553Q and any combination thereof
[0070] In some embodiments, the four or more mutations are selected from S492, A534P, I539T, G550E, R555K, and any combination thereof.
[0071] In some embodiments, four or more mutations are S492P, F494N, S495P, A534P, I539T, G550E, R555K, S1255L, K1334G, S1359A, and Q1411D. In some embodiments, the four or more mutations are S492P, A534P, I539T, S1255L, K1334G, S1359A, and Q1411. In some embodiments, the four or more mutations are S492P, F494N, S495P, A534P, I539T, G550E, R555K, and S1359A. In some embodiments, the four or more mutations are S492P, F494N, S495P, A534P, I539T, G550E, R555K, and S1359A. In some embodiments, the four or more mutations are S492P, F494N, S495P, A534P, I539T, G550E, and R555K. In some embodiments, the four or more mutations are S492P, F494N, S495P, A534P, I539T, G550E, and R555K. In some embodiments, four or more mutations are M470V, S492P, S495P, A534P, I539T, and R555K. In some embodiments, the four or more mutations are M470V, S492P, S495P, A534P, and I539T. In some embodiments, four or more mutations are S492P, A534P, I539T, and S1359A.
[0072] Another aspect of the invention relates to a modified human cystic fibrosis transmembrane conductance regulator (CFTR) polypeptide or functional fragment thereof, wherein the polypeptide differs from the wild-type human CFTR protein (SEQ ID NO:1) or fragment thereof by the presence of one, two, or three mutations selected from V150D, M470V, S492P, F494N, S495P, I539T, G550E, G551D, R553Q, R555K, Q637R, H1402S, E1371Q, and any combination thereof, such that the stability of the polypeptide is increased relative to that of the wild-type human CFTR polypeptide or fragment thereof.
[0073] In some embodiments, the one, two, or three mutations are selected from S495P, G550E, R555K, and any combination thereof. In some embodiments, the one or two mutations are selected from G550E, R555K, and any combination thereof. In some embodiments, the one or two mutations are selected from S492P, I539T, and any combination thereof. In some embodiments, the one or two mutations are selected from S495P, I539T, and any combination thereof. In some embodiments, the one or two mutations are selected from S495P, S492P, and any combination thereof In some embodiments, the one or two mutations are selected from F494N, Q637R and any combination thereof.
[0074] In some embodiments, the one, two or three mutations selected from V150D, M470V, F494N, S495P, I539T, G550E, G551D, R553Q, R555K, Q637R, H1402S, E1371Q, and any combination thereof are further combined with mutation A534P. In some embodiments, the one mutation is I539T.
[0075] In some embodiments, the one, two, or three mutations selected from V150D, M470V, S492P, F494N, S495P, G550E, G551D, R553Q, R555K, Q637R, H1402S, E1371Q, and any combination thereof are further combined with mutation A534P. In some embodiments, the mutation is G550E. In some embodiments, the mutation is S495P. In some embodiments, the mutation is S492P. In some embodiments, the mutation is M470V. In some embodiments, the mutation is V150D. In some embodiments, the mutation is G551D.
[0076] In some embodiments, the polypeptide or functional fragment of the invention further comprises a deletion of amino acid residue F508 (F508). In some embodiments, the polypeptide or functional fragment further comprises a deletion of amino acid residues 405-436 (RI) or a deletion of amino acid residues 404-435(RI). In some embodiments, a functional fragment of the invention is the amino acid sequence of the nuclear binding domain 1 (NBD1). In some embodiments, the polypeptide has increased stability relative to a CFTR polypeptide comprising a deletion of amino acid residue F508 (F508) and/or comprising a deletion of amino acid residues 405-436 (ART) and/or comprising a deletion of amino acid residues 404-435 (RI).
[0077] The modified CFTR polypeptide or functional fragment thereof of the invention is a modified human wild-type CFTR protein comprising the following amino acid sequence:
TABLE-US-00001 (SEQIDNO:1) MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRE 60 LASKKNPKLINALRRCFFWRFMFYGIFLYLGEVTKAVQPLLLGRIIASYDPDNKEERSIA 120 IYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYKKTLKLSSRVLDKISIGQL 180 VSLLSNNLNKFDEGLALAHFVWIAPLQVALLMGLIWELLQASAFCGLGFLIVLALFQAGL 240 GRMMMKYRDQRAGKISERLVITSEMIENIQSVKAYCWEEAMEKMIENLRQTELKLTRKAA 300 YVRYFNSSAFFFSGFFVVFLSVLPYALIKGIILRKIFTTISFCIVLRMAVTRQFPWAVQT 360 WYDSLGAINKIQDFLQKQEYKTLEYNLTTTEVVMENVTAFWEEGFGELFEKAKQNNNNRK 420 TSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEG 480 KIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIV 540 LGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTR 600 ILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNS 660 ILTETLHRFSLEGDAPVSWTETKKQSFKQTGEFGEKRKNSILNPINSIRKFSIVQKTPLQ 720 MNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVLNLMTHSVNQG 780 QNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDLKECFFDDMESI 840 PAVTTWNTYLRYITVHKSLIFVLIWCLVIFLAEVAASLVVLWLLGNTPLQDKGNSTHSRN 900 NSYAVIITSTSSYYVFYIYVGVADTLLAMGFFRGLPLVHTLITVSKILHHKMLHSVLQAP 960 MSTLNTLKAGGILNRFSKDIAILDDLLPLTIFDFIQLLLIVIGAIAVVAVLQPYIFVATV 1020 PVIVAFIMLRAYFLQTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHK 1080 ALNLHTANWFLYLSTLRWFQMRIEMIFVIFFIAVTFISILTTGEGEGRVGIILTLAMNIM 1140 STLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEGKPTKSTKPYKNGQLSKVMIIENSHVKK 1200 DDIWPSGGQMTVKDLTAKYTEGGNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRL 1260 LNTEGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVAD 1320 EVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPVT 1380 YQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLVIEENKVRQYDSIQKLLNERSLFRQA 1440 ISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRL 1480
[0078] In some embodiments, the modified polypeptide or functional fragment of a wild-type CFTR protein from which the modified CFTR polypeptide or functional fragment thereof of the invention is derived from comprises, consists essentially of, or consists of the amino acid sequence of the nuclear binding domain (NBD1) or a portion thereof. In some embodiments, the NBD1 of a human wild-type CFTR from which the modified CFTR polypeptide or functional fragment thereof is derived from comprises amino acid residues ranging from about amino acid residues 433 to about 584 of the wild-type CFTR protein. In some embodiments, the modified CFTR polypeptide or functional fragment thereof of the invention comprises the entire amino acid sequence of the nuclear binding domain (NBD1) of the wild-type CFTR protein. In some embodiments, the modified CFTR polypeptide or functional fragment thereof comprises only a portion of the amino acid sequence of the NBD1 of the wild-type CFTR protein. In some embodiments, the functional CFTR fragment of the invention comprises an amino acid sequence ranging from about amino acid residues 458 to about 557 of the wild-type CFTR protein.
[0079] In some embodiments the modified CFTR polypeptide or functional fragment thereof is modified with one or more tags and/or fusion proteins. In some, embodiments, the polypeptide or functional fragment thereof of the invention may further comprise one or more tags selected from a His.sub.10-purification tag, FLAG epitope, a green fluorescent protein (EGFP), and a SUMO fusion protein epitope
[0080] In some embodiments, wild-type CFTR protein or fragment thereof from which the modified CFTR polypeptide or functional fragment thereof is derived from comprises, consists essentially of, or consists of one or more deletion(s) of amino acid residues. In some embodiments, the wild-type CFTR protein or fragment thereof from which the modified CFTR polypeptide or functional fragment thereof is derived from comprises a deletion of amino acid residue F508 (F508) and/or a deletion of amino acid residues 405-436 (RI) and/or a deletion of amino acid residues 404-435(RI).
[0081] Another aspect of the inventions relates to the protein structural stability of the modified CFTR polypeptide or functional fragment thereof of the invention. Structural protein stability describes the stability of the protein's native three-dimensional structure of folded conformation relative to its denatured or unfolded state and is expressed as a function of temperature (i.e., T.sub.m; unfolding temperature). In some embodiments, the protein stability of the modified. CFTR polypeptide or functional fragment thereof is higher (i.e., more stable) than the protein stability of the wild-type CFTR protein or fragment thereof. The increase may be in structural stability (T.sub.m, T.sub.m.sup.cal) and/or thermal stability (T.sub.m.sup.trp) and/or functional stability (T.sub.m.sup.func)
[0082] In some embodiments, the structural stability of the modified CFTR polypeptide or functional fragment thereof is increased by an amount of T.sub.m.sup.cal ranging from about 1% to about 40%, from about 3% to about 38%, from about 5% to about 35%, from about 10% to about 30%, from about 15% to about 25% compared to that of the wild-type CFTR protein or fragment thereof.
[0083] In some embodiments, the structural protein stability of the modified CFTR polypeptide or functional fragment thereof is increased by at least an amount of about 3%, about 4%, about 5%, about 6%, about 7%, about 8%, about 9%, about 10% about 11%, about 12%, about 13%, about 14%, about 15%, about 16%, about 17%, about 18%, about 19%, about 20%, about 21%, about 22%, about 23%, about 24%, about 25%, about 26%, about 27%, about 28%, about 29%, about 30%, about 31%, about 32%, about 33%, about 34%, about 35%, about 36%, about 37%, about 38%, or at least about 39% compared to the wild-type CFTR protein or fragment thereof.
[0084] In some embodiments, the T.sub.m of the modified CFTR polypeptide or functional fragment thereof ranges from about 57 C. to about 80 C., from about 60 C. to about 75 C., from about 65 C. to about 75 C., or from about 70 C. to about 75 C. In some embodiments, the T.sub.m of the modified CFTR polypeptide or functional fragment thereof is at least about 57 C., about 58 C., about 59 C., about 60 C., about 61 C., about 62 C., about 63 C., about 64 C., about 65 C., about 66 C., about 67 C., about 68 C., about 69 C., about 70 C., about 71 C., about 72 C., about 73 C., about 74 C., about 75 C., about 76 C., about 77, about 78 C., or at least about 79 C.
[0085] Another aspect of the invention relates to the ion channel conductivity activity of the modified CFTR polypeptide or functional fragment thereof of the invention, wherein the ion channel conductivity measures the ability and/or efficiency of transporting ions across a membrane. In some embodiments, the ion channel conductivity of the modified CFTR polypeptide or functional fragment thereof is higher than the ion channel conductivity of the wild-type CFTR protein or fragment thereof. In some embodiments, the modified CFTR polypeptide or functional fragment thereof exhibits an ion channel conductivity of at least about 0.1%, about 0.2%, about 0.3%, about 0.4%, about 0.5%, about 0.6%, about 0.7%, about 0.8%, about 0.9%, about 1.0%, about 1.1%, or about 1.2% higher compared to the conductivity of the wild-type CFTR protein or fragment thereof.
[0086] In some embodiments, the modified CFTR polypeptide or functional fragment thereof exhibits an ion channel conductivity of at least about 0.1 pS, about 0.2 pS, about 0.3 pS, about 0.4 pS about 0.5 pS, about 1.0 pS, about 1.5 pS, about 2.0 pS, about 2.5 pS, about 3.0 pS, about 3.5 pS, about 4.0 pS, or at least about 4.5 pS higher compared to the ion channel conductivity of the wild-type CFTR protein or fragment thereof. In some embodiments, ion channel conductivity of the modified CFTR polypeptide or functional fragment thereof ranges from about 12 pS to about 16 pS, or from about 12.5 pS to about 14 pS. In some embodiments, the conductance is at least about 12 pS, about 12.5 pS, about 13 pS, about 13.5 pS, about 14 pS, about 14.5 pS, about 15 pS, or about 15.5 pS.
[0087] In some embodiments, the increased ion channel conductivity of the modified CFTR polypeptide or functional fragment thereof compared to the ion channel conductivity of the wild-type CFTR protein or fragment thereof is temperature dependent. In some embodiments, the modified CFTR polypeptide or functional fragment thereof exhibits a higher ion channel conductivity compared to the wild type CFTR protein or fragment therefor at temperatures ranging from 33 C. to about 60 C., from about 34 C. to about 50 C., or from about 38 C. to about 48 C. In some embodiments, the temperature is at least about 33 C., about 34 C., about 35 C., about 36 C., about 37 C., about 38 C., about 39 C., about 40 C., about 41 C., about 42 C., about 43 C., about 44 C., or at least about 45 C.
[0088] Another aspect of the invention relates of the ATPase activity of the modified CFTR polypeptide or functional fragment thereof of the invention, wherein the ATPase activity is measured as a function of ATP hydrolysis to produce energy for the cell. In some embodiments, the ATPase activity of a modified CFTR polypeptide or functional fragment thereof having no more than five mutations and comprising a deletion of amino acid residues 405-436 (RI) is higher compared to the ATPase activity of the wild-type CFTR peptide or fragment thereof. In some embodiments, the ATPase activity of such modified CFTR polypeptide or functional fragment thereof is increased by and amount ranging from about 1.5-fold, about 1.8-fold, 2-fold, 2.5-fold, 3.0-fold, 3.5-fold, 4.0-fold, 4.5-fold, 5.0-fold, 5.5-fold, or about 6.0 fold compared to the ATPase activity of the wild-type CFTR protein.
[0089] In some embodiments, the ATPase activity of the modified CFTR polypeptide or functional fragment thereof ranges from about 5 nmol/h/g to about 35 nmol/h/g, from about 10 nmol/h/g to about 25 nmol/h/g, or from about 15 to about 20 nmol/h/g. In some embodiments, the ATPase activity of the modified CFTR polypeptide or functional fragment thereof is at least about 7 nmol/h/g, about 8 nmol/h/g, about 9 nmol/h/g, about 10 nmol/h/g, about 11 nmol/h/g, about 12 nmol/h/g, about 13 nmol/h/g, about 14 nmol/h/g, about 15 nmol/h/g, about 16 nmol/h/g, about 17 nmol/h/g, about 18 nmol/h/g, about 19 nmol/h/g, about 20 nmol/h/g, about 21 nmol/h/g, about 22 nmol/h/g, about 23 nmol/h/g, about 24 nmol/h/g, about 25 nmol/h/g, about 26 nmol/h/g, about 27 nmol/h/g, about 28 nmol/h/g, about 29 nmol/h/g, about 30 nmol/h/g, about 31 nmol/h/g, about 32 nmol/h/g, about 33 nmol/h/g, about 34 nmol/h/g, or at least about 35 nmol/h/g.
[0090] Another aspect of the invention relates to a composition comprising the modified CFTR polypeptide of functional fragment thereof of the invention. In some embodiments, the composition may comprise one or more suitable carriers for the polypeptide. In some embodiments, the composition comprising the modified CFTR polypeptide of functional fragment thereof of the invention is a liquid.
[0091] The present invention additionally provides a nucleic acid molecule encoding the modified CFTR polypeptide or functional fragment thereof of the invention. In some embodiments, the nucleic acid molecule of the invention is a modified from the human wild-type CFTR nucleotide sequence (SEQ ID NO:2):
TABLE-US-00002 1 aattggaagcaaatgacatcacagcaggtcagagaaaaagggttgagcggcaggcaccca 61 gagtagtaggtctttggcattaggagcttgagcccagacggccctagcagggaccccagc 121 gcccgagagaccatgcagaggtcgcctctggaaaaggccagcgttgtctccaaacttttt 181 ttcagctggaccagaccaattttgaggaaaggatacagacagcgcctggaattgtcagac 241 atataccaaatcccttctgttgattctgctgacaatctatctgaaaaattggaaagagaa 301 tgggatagagagctggcttcaaagaaaaatcctaaactcattaatgcccttcggcgatgt 361 tttttctggagatttatgttctatggaatctttttatatttaggggaagtcaccaaagca 421 gtacagcctctcttactgggaagaatcatagcttcctatgacccggataacaaggaggaa 481 cgctctatcgcgatttatctaggcataggcttatgccttctctttattgtgaggacactg 541 ctcctacacccagccatttttggccttcatcacattggaatgcagatgagaatagctatg 601 tttagtttgatttataagaagactttaaagctgtcaagccgtgttctagataaaataagt 661 attggacaacttgttagtctcctttccaacaacctgaacaaatttgatgaaggacttgca 721 ttggcacatttcgtgtggatcgctcctttgcaagtggcactcctcatggggctaatctgg 781 gagttgttacaggcgtctgccttctgtggacttggtttcctgatagtccttgcccttttt 841 caggctgggctagggagaatgatgatgaagtacagagatcagagagctgggaagatcagt 901 gaaagacttgtgattacctcagaaatgattgaaaatatccaatctgttaaggcatactgc 961 tgggaagaagcaatggaaaaaatgattgaaaacttaagacaaacagaactgaaactgact 1021 cggaaggcagcctatgtgagatacttcaatagctcagccttcttcttctcagggttcttt 1081 gtggtgtttttatctgtgcttccctatgcactaatcaaaggaatcatcctccggaaaata 1141 ttcaccaccatctcattctgcattgttctgcgcatggcggtcactcggcaatttccctgg 1201 gctgtacaaacatggtatgactctcttggagcaataaacaaaatacaggatttcttacaa 1261 aagcaagaatataagacattggaatataacttaacgactacagaagtagtgatggagaat 1321 gtaacagccttctgggaggagggatttggggaattatttgagaaagcaaaacaaaacaat 1381 aacaatagaaaaacttctaatggtgatgacagcctcttcttcagtaatttctcacttctt 1441 ggtactcctgtcctgaaagatattaatttcaagatagaaagaggacagttgttggcggtt 1501 gctggatccactggagcaggcaagacttcacttctaatggtgattatgggagaactggag 1561 ccttcagagggtaaaattaagcacagtggaagaatttcattctgttctcagttttcctgg 1621 attatgcctggcaccattaaagaaaatatcatctttggtgtttcctatgatgaatataga 1681 tacagaagcgtcatcaaagcatgccaactagaagaggacatctccaagtttgcagagaaa 1741 gacaatatagttcttggagaaggtggaatcacactgagtggaggtcaacgagcaagaatt 1801 tctttagcaagagcagtatacaaagatgctgatttgtatttattagactctccttttgga 1861 tacctagatgttttaacagaaaaagaaatatttgaaagctgtgtctgtaaactgatggct 1921 aacaaaactaggattttggtcacttctaaaatggaacatttaaagaaagctgacaaaata 1981 ttaattttgcatgaaggtagcagctatttttatgggacattttcagaactccaaaatcta 2041 cagccagactttagctcaaaactcatgggatgtgattctttcgaccaatttagtgcagaa 2101 agaagaaattcaatcctaactgagaccttacaccgtttctcattagaaggagatgctcct 2161 gtctcctggacagaaacaaaaaaacaatcttttaaacagactggagagtttggggaaaaa 2221 aggaagaattctattctcaatccaatcaactctatacgaaaattttccattgtgcaaaag 2281 actcccttacaaatgaatggcatcgaagaggattctgatgagcctttagagagaaggctg 2341 tccttagtaccagattctgagcagggagaggcgatactgcctcgcatcagcgtgatcagc 2401 actggccccacgcttcaggcacgaaggaggcagtctgtcctgaacctgatgacacactca 2461 gttaaccaaggtcagaacattcaccgaaagacaacagcatccacacgaaaagtgtcactg 2521 gcccctcaggcaaacttgactgaactggatatatattcaagaaggttatctcaagaaact 2581 ggcttggaaataagtgaagaaattaacgaagaagacttaaaggagtgcttttttgatgat 2641 atggagagcataccagcagtgactacatggaacacataccttcgatatattactgtccac 2701 aagagcttaatttttgtgctaatttggtgcttagtaatttttctggcagaggtggctgct 2761 tctttggttgtgctgtggctccttggaaacactcctcttcaagacaaagggaatagtact 2821 catagtagaaataacagctatgcagtgattatcaccagcaccagttcgtattatgtgttt 2881 tacatttacgtgggagtagccgacactttgcttgctatgggattcttcagaggtctacca 2941 ctggtgcatactctaatcacagtgtcgaaaattttacaccacaaaatgttacattctgtt 3001 cttcaagcacctatgtcaaccctcaacacgttgaaagcaggtgggattcttaatagattc 3061 tccaaagatatagcaattttggatgaccttctgcctcttaccatatttgacttcatccag 3121 ttgttattaattgtgattggagctatagcagttgtcgcagttttacaaccctacatcttt 3181 gttgcaacagtgccagtgatagtggcttttattatgttgagagcatatttcctccaaacc 3241 tcacagcaactcaaacaactggaatctgaaggcaggagtccaattttcactcatcttgtt 3301 acaagcttaaaaggactatggacacttcgtgccttcggacggcagccttactttgaaact 3361 ctgttccacaaagctctgaatttacatactgccaactggttcttgtacctgtcaacactg 3421 cgctggttccaaatgagaatagaaatgatttttgtcatcttcttcattgctgttaccttc 3481 atttccattttaacaacaggagaaggagaaggaagagttggtattatcctgactttagcc 3541 atgaatatcatgagtacattgcagtgggctgtaaactccagcatagatgtggatagcttg 3601 atgcgatctgtgagccgagtctttaagttcattgacatgccaacagaaggtaaacctacc 3661 aagtcaaccaaaccatacaagaatggccaactctcgaaagttatgattattgagaattca 3721 cacgtgaagaaagatgacatctggccctcagggggccaaatgactgtcaaagatctcaca 3781 gcaaaatacacagaaggtggaaatgccatattagagaacatttccttctcaataagtcct 3841 ggccagagggtgggcctcttgggaagaactggatcagggaagagtactttgttatcagct 3901 tttttgagactactgaacactgaaggagaaatccagatcgatggtgtgtcttgggattca 3961 ataactttgcaacagtggaggaaagcctttggagtgataccacagaaagtatttattttt 4021 tctggaacatttagaaaaaacttggatccctatgaacagtggagtgatcaagaaatatgg 4081 aaagttgcagatgaggttgggctcagatctgtgatagaacagtttcctgggaagcttgac 4141 tttgtccttgtggatgggggctgtgtcctaagccatggccacaagcagttgatgtgcttg 4201 gctagatctgttctcagtaaggcgaagatcttgctgcttgatgaacccagtgctcatttg 4261 gatccagtaacataccaaataattagaagaactctaaaacaagcatttgctgattgcaca 4321 gtaattctctgtgaacacaggatagaagcaatgctggaatgccaacaatttttggtcata 4381 gaagagaacaaagtgcggcagtacgattccatccagaaactgctgaacgagaggagcctc 4441 ttccggcaagccatcagcccctccgacagggtgaagctctttccccaccggaactcaagc 4501 aagtgcaagtctaagccccagattgctgctctgaaagaggagacagaagaagaggtgcaa 4561 gatacaaggctttagagagcagcataaatgttgacatgggacatttgctcatggaattgg 4621 agctcgtgggacagtcacctcatggaattggagctcgtggaacagttacctctgcctcag 4681 aaaacaaggatgaattaagtttttttttaaaaaagaaacatttggtaaggggaattgagg 4741 acactgatatgggtcttgataaatggcttcctggcaatagtcaaattgtgtgaaaggtac 4801 ttcaaatccttgaagatttaccacttgtgttttgcaagccagattttcctgaaaaccctt 4861 gccatgtgctagtaattggaaaggcagctctaaatgtcaatcagcctagttgatcagctt 4921 attgtctagtgaaactcgttaatttgtagtgttggagaagaactgaaatcatacttctta 4981 gggttatgattaagtaatgataactggaaacttcagcggtttatataagcttgtattcct 5041 ttttctctcctctccccatgatgtttagaaacacaactatattgtttgctaagcattcca 5101 actatctcatttccaagcaagtattagaataccacaggaaccacaagactgcacatcaaa 5161 atatgccccattcaacatctagtgagcagtcaggaaagagaacttccagatcctggaaat 5221 cagggttagtattgtccaggtctaccaaaaatctcaatatttcagataatcacaatacat 5281 cccttacctgggaaagggctgttataatctttcacaggggacaggatggttcccttgatg 5341 aagaagttgatatgccttttcccaactccagaaagtgacaagctcacagacctttgaact 5401 agagtttagctggaaaagtatgttagtgcaaattgtcacaggacagcccttctttccaca 5461 gaagctccaggtagagggtgtgtaagtagataggccatgggcactgtgggtagacacaca 5521 tgaagtccaagcatttagatgtataggttgatggtggtatgttttcaggctagatgtatg 5581 tacttcatgctgtctacactaagagagaatgagagacacactgaagaagcaccaatcatg 5641 aattagttttatatgcttctgttttataattttgtgaagcaaaattttttctctaggaaa 5701 tatttattttaataatgtttcaaacatatataacaatgctgtattttaaaagaatgatta 5761 tgaattacatttgtataaaataatttttatatttgaaatattgactttttatggcactag 5821 tatttctatgaaatattatgttaaaactgggacaggggagaacctagggtgatattaacc 5881 aggggccatgaatcaccttttggtctggagggaagccttggggctgatgcagttgttgcc 5941 cacagctgtatgattcccagccagcacagcctcttagatgcagttctgaagaagatggta 6001 ccaccagtctgactgtttccatcaagggtacactgccttctcaactccaaactgactctt 6061 aagaagactgcattatatttattactgtaagaaaatatcacttgtcaataaaatccatac 6121 atttgtgtgaaa
or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identify thereto.
[0092] Another aspect of the invention relates to an expression vector comprising the nucleic acid molecule (i.e., polynucleotide) of the invention. Suitable expression vectors include, without limitation, plasmids and viral vectors. For purposes of the invention, the regulatory regions (i.e., promoters, transcriptional regulatory regions, and translational termination regions) in the expression vector can be native/analogous to the organism or cell and/or the regulatory regions can be native/analogous to the other regulatory regions. Alternatively, the regulatory regions may be heterologous to the organism or cell and/or to each other (i.e., the regulatory regions). Thus, for example, a promoter can be heterologous when it is operably linked to a polynucleotide from a species different from the species from which the polynucleotide was derived. Alternatively, a promoter can also be heterologous to a selected nucleotide sequence if the promoter is from the same/analogous species from which the polynucleotide is derived, but one or both (i.e., promoter and polynucleotide) are substantially modified from their original form and/or genomic locus, or the promoter is not the native promoter for the operably linked polynucleotide.
[0093] In addition to the promoters described above, the expression vector also can include other regulatory sequences. As used herein, regulatory sequences means nucleotide sequences located upstream (5 non-coding sequences), within or downstream (3 non-coding sequences) of a coding sequence, and which influence the transcription, RNA processing or stability, or translation of the associated coding sequence. Regulatory sequences include, but are not limited to, enhancers, introns, translation leader sequences and polyadenylation signal sequences.
[0094] The expression vector also can optionally include a transcriptional and/or translational termination region (i.e., termination region) that is functional in the organism. A variety of transcriptional terminators is available for use in expression vectors and is responsible for the termination of transcription beyond the transgene and correct mRNA polyadenylation. The termination region may be native to the transcriptional initiation region, may be native to the operably linked nucleotide sequence of interest, may be native to the host, or may be derived from another source (i.e., foreign or heterologous to the promoter, the nucleotide sequence of interest, the host, or any combination thereof).
[0095] Regardless of the type of regulatory sequence(s) used, they can be operably linked to the nucleotide sequence of the polynucleotide of the invention. As used herein, operably linked means that elements of a nucleic acid construct such as an expression cassette are configured so as to perform their usual function. Thus, regulatory or control sequences (e.g., promoters) operably linked to a nucleotide sequence of interest are capable of effecting expression of the nucleotide sequence of interest. The control sequences need not be contiguous with the nucleotide sequence of interest, so long as they function to direct the expression thereof. Thus, for example, intervening untranslated, yet transcribed, sequences can be present between a promoter and a coding sequence, and the promoter sequence can still be considered operably linked to the coding sequence. A nucleotide sequence of the present invention can be operably linked to a regulatory sequence, thereby allowing its expression in a cell and/or subject.
[0096] The expression vector also can include a nucleotide sequence for a selectable marker, which can be used to select a transformed organism or cell. As used herein, selectable marker means a nucleic acid that when expressed imparts a distinct phenotype to the organism or cell expressing the marker and thus allows such transformed organisms or cells to be distinguished from those that do not have the marker. Such a nucleic acid may encode either a selectable or screenable marker, depending on whether the marker confers a trait that can be selected for by chemical means, such as by using a selective agent (e.g., an antibiotic or the like), or on whether the marker is simply a trait that one can identify through observation or testing, such as by screening. Of course, many examples of suitable selectable markers are known in the art and can be used in the expression vectors described herein.
[0097] In some embodiments, the expression vector of the invention includes, but is not limited to, a lentiviral vector, e.g., a lentiviral vector comprising, consisting essentially of, or consisting of a promoter (e.g., TRE promoter), a modified wild-type CFTR sequence optionally tagged (e.g., a FLAG epitope, a His.sub.10-tag) attached to the modified CFTR sequence (e.g., in the fourth intracellular loop), and a SUMO region and/or an enhanced green fluorescent protein region (EGFP) (Hildebrandt E. et al., Mol Biotechnol (2015), 57(5), 391-405;
[0098] Another aspect of the invention relates to a host cell comprising the nucleic acid molecule (i.e., polynucleotide) or the expression vector of the invention. When a nucleic acid is inserted into a suitable host cell, e.g., a prokaryotic or a eukaryotic cell and the host cell replicates, the protein can be recombinantly produced. Suitable host cells will depend on the vector and can include mammalian cells, animal cells, human cells, simian cells, insect cells, yeast cells, plant cells, and bacterial cells as described above and constructed using well known methods. Examples of eukaryotic host cells for replication and/or expression of a vector include, but should not be limited to, C. elegans, HeLa, NIH3T3, Jurkat, 293, Cos, CHO, Saos, yeast, nematodes, insect cells, and PC12. Many host cells from various cell types and organisms are available and would be known to one of skill in the art. Examples of useful mammalian host cell lines include, but should not be limited to, VERO and HeLa cells, Chinese hamster ovary (CHO) cell lines, W138, BHK, COS-7, 293, HepG2, 3T3, RIN, Human embryonic kidney cell lines (HEK), and MDCK cell lines. Other Examples include cell lines such as D165, D421, D359, D727, D851, D1012, D1013, D744, D869, D872, D1028, D$05, D804, D742, D743, D507 D1044, D992, D727, D994, D851, and/or D1022. In addition, a host cell strain may be chosen that modulates the expression of the inserted sequences, or modifies and processes the gene product in the specific fashion desired. Such modifications (e.g., glycosylation) and processing (e.g., cleavage) of protein products may be important for the function of the protein. Examples of prokaryotic hosts include, but should not be limited to E. coli strains; bacilli such as Bacillus subtilis; and other enterobacteriaceae such as Salmonella typhimurium, Serratia marcescens, and various Pseudomonas species. In addition to the use of viral vector for insertion of exogenous nucleic acid into cells, the nucleic acid can be inserted into the host cell by methods well known in the art such as transformation for bacterial cells; transfection using calcium phosphate precipitation for mammalian cells; DEAE-dextran; electroporation; or microinjection.
[0099] In one aspect, this invention is directed to a method for producing the recombinant modified CFTR polypeptide or functional fragment thereof as described herein, the method comprising: introducing an expression vector comprising a nucleotide sequence coding for the recombinant modified CFTR polypeptide or functional fragment thereof into a host cell to provide a recombinant cell; and culturing the cell in cell culture medium under conditions such that the recombinant modified CFTR polypeptide or functional fragment thereof is expressed by the recombinant cell. In some embodiments, the method further comprises collecting the cells, lysing the cells, centrifugation of the lysed cells to collect/isolate the membranes containing the recombinant modified CFTR polypeptide or functional fragment thereof. In some embodiments, the method further comprises isolating or purifying the recombinant modified CFTR polypeptide or functional fragment thereof from the collected/isolated membranes (e.g., by solubilizing the membranes and/or chromatography (e.g., affinity and/or size exclusion)).
[0100] The recombinant nucleic acid molecule (i.e., polypeptides) of the invention are expected to have some or all of the biological activities of wild-type modified CFTR polypeptide or functional fragment thereof (i.e., CFTR protein or fragment thereof) and may have one or more enhanced biological activities relative to wild-type modified CFTR polypeptide or functional fragment thereof. Thus, the modified CFTR polypeptide or functional fragment thereof of the invention may be used in the same manner as the wild-type CFTR protein as is known in the art.
[0101] Another aspect of this invention relates to the use of modified CFTR polypeptide or functional fragment thereof of the invention as a research tool to investigate the factors that modulate structural stability and/or folding properties of the wild-type CFTR protein and fragments thereof. Employing modified polypeptides of the invention in methods directed to studying CFTR structure and/or function and/or optimizing the same, e.g., protein stability and folding properties, allows for the identification of important amino acid residues and regions within the CFTR protein and fragments thereof that govern such structure and/or function. Employing modified polypeptides of the invention also allows for studying their effects on biological activities such as ion channel conductivity and/or ATPase activity. Stabilized wild-type CFTR proteins and fragments thereof may be a valuable tool for biophysical and structural studies that advance CF drug development and allows for the mechanistic and structural studies of CF-causing mutations. All this information can then be used in the development of therapies involving the CFTR protein to treat CF and related diseases.
[0102] For instance, stabilizing mutations (such as mutations in this invention) of the CFTR polypeptide provides the ability to obtain an atomic resolution structure of the CFTR polypeptide. This structural information provides the basis for designing drugs, e.g., using rational structure-based drug design. These drugs are designed, for example, to target specific regions in the CFTR polypeptide to correct functional defects that cause the disease. Current drugs modulating CFTR polypeptides can be effective for treating some mutant/variant forms of functionally defective CFTR but not all mutant/variant forms. Thus, information obtained from studies using the CFTR polypeptides of the present invention can be used in the discovery of new and effective treatments that currently have no treatment options.
[0103] For example, in some embodiments, these disease variants are due to a premature translational stop codon (PTC) that in certain individuals exist within the CFTR nucleotide sequence. For example, some of the PTC mutations are near the end of the CFTR sequence (i.e., W1282X) and while these mutant forms of the CFTR polypeptide are partially defective, they are expressed and do function, albeit not normally. Therefore, any results of studies obtained using the modified CFTR polypeptides of the invention, in particular structural/folding protein studies, will allow for the determination and/or identification of important structural features in the W1282X mutant (and other PTC mutants) that can be used in designing drugs to correct the defect. In addition, there are also currently drugs in development that can suppress the PTC, but this type of treatment is only partially effective because the wild-type amino acid is not inserted in place of the PTC, and consequently the aberrant amino acid is itself a mutation (called a missense mutation) that can cause CFTR dysfunction and disease. Here too, information obtained from studies using the modified CFTR polypeptide of the invention has utility since one can determine the defect in the structure of the missense CFTR and then design drugs to correct the defect.
[0104] Thus, one aspect of the invention relates to a method of screening a compound using a modified CFTR polypeptide of the invention to identify a compound that modulates one or more biological and/or physical properties (e.g., ATPase activity, ion channel conductivity properties, structural stability and/or folding properties) of the modified CFTR polypeptide, wherein the modified CFTR polypeptide further comprises one or more destabilizing mutations relative to the wild-type human CFTR protein (SEQ ID NO:1) or fragment thereof. In some embodiments, the modified CFTR polypeptide comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 destabilizing mutations. The term destabilizing is intended to refer to amino acid mutations of the wild-type human CFTR polypeptide that decrease and/or diminish any biological and/or physical property of the wild-type human CFTR polypeptide. In some embodiments, the modified CFTR polypeptide comprises more than 10 destabilizing mutations. In some embodiments, the destabilizing mutations are related to a disease state. The term modulate is intended to refer to compounds that enhance (e.g., increase, restore, improve) or inhibit (e.g., reduce) the biological and/or physical activities of the modified CFTR polypeptide (or functional fragment). For example, the interaction of the modified CFTR polypeptide or functional fragment with a binding partner can be evaluated. As another alternative, physical methods, such as NMR, can be used to assess biological function. Activity of the modified CFTR polypeptides or functional fragment can be evaluated by any method known in the art, including the methods disclosed herein. In some embodiments, the structural stability and/or biological activity of the modified CFTR polypeptide is restored and/or improved in the presence of the compound. In some embodiments, the ATPase activity of the modified CFTR polypeptide is restored and/or improved in the presence of the compound. In some embodiments, the ion channel conductivity of the modified CFTR polypeptide is restored and/or improved in the presence of the compound. In some embodiments, one or more of each of these biological and/or physical properties of the modified CFTR polypeptide is restored individually by at least about 1%, 2%, 3%, 4%, 5%,6% ,7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or 50%.
[0105] Any compound of interest can be screened according to the present invention. Suitable test compounds include organic and inorganic molecules. Suitable organic molecules can include but are not limited to small molecules (compounds less than about 1000 Daltons), polypeptides (including enzymes, antibodies, and Fab' fragments), carbohydrates, and/or lipids. In some embodiments, each test compound is screened in the method of the invention individually. In some embodiments, the methods of the invention can be practiced to screen a compound library, e.g., a small molecule library, a combinatorial chemical compound library, a polypeptide library, a cDNA library, a library of antisense nucleic acids, and the like, or an arrayed collection of compounds such as polypeptide and nucleic acid arrays.
[0106] In some embodiment, the invention provides methods of screening test compounds to identify a test compound that binds to specific target region of the modified CFTR polypeptide or functional fragment. Compounds that are identified as binding to the modified CFTR polypeptide or functional fragment can be subject to further screening using methods and/or other suitable techniques known in the art.
[0107] In some embodiments, the method of the invention comprises contacting a the modified CFTR polypeptide or functional fragment thereof with a test compound; and detecting whether the test compound binds to the modified CFTR polypeptide or functional fragment and/or modulates the activity of the modified CFTR polypeptide (or fragment). In another exemplary embodiment, the method comprises introducing a test compound into a cell that comprises the modified CFTR polypeptide or functional fragment; and detecting whether the compound binds to the modified CFTR polypeptide or functional fragment and/or modulates the activity of the modified CFTR polypeptide or functional fragment in the cell. The modified CFTR polypeptide can be endogenously produced in the cell. Alternatively or additionally, the cell can be modified to comprise an isolated modified CFTR polynucleotide encoding, and optionally overexpressing, the modified CFTR polypeptide or functional fragment thereof. Compounds that are identified as modulators of activity can optionally be further screened using the methods described herein (e.g., structural stability, ATPase activity, ion channel conductivity, and the like).
[0108] In some embodiments, the screening assay can be a cell-based or cell-free assay. In some embodiments, the modified CFTR polypeptide (or functional fragment thereof) or modified CFTR polynucleotide can be free in solution, affixed to a solid support, expressed on a cell surface, or located within a cell. With respect to cell-based assays, any suitable cell can be used, including bacteria, yeast, insect cells (e.g., with a baculovirus expression system), avian cells, or mammalian cells.
[0109] In some embodiments, the screening assays can also be carried out in vivo in animals. Thus, as still a further aspect, the invention provides a transgenic non-human animal comprising an isolated modified CFTR polynucleotide encoding a modified CFTR polypeptide or functional fragment thereof, which can be produced according to methods well-known in the art. The transgenic non-human animal can be from any species, including avians and non-human mammals. According to this aspect of the invention, suitable non-human mammals include mice, rats, rabbits, guinea pigs, goats, sheep, pigs, and cattle. Suitable avians include chickens, ducks, geese, quail, turkeys, and pheasants.
[0110] The modified CFTR polynucleotide encoding the modified CFTR polypeptide or functional fragment can be stably incorporated into cells within the transgenic animal (typically, by stable integration into the genome or by stably maintained episomal constructs). It is not necessary that every cell contain the transgene, and the animal can be a chimera of modified and unmodified cells, as long as a sufficient number of cells comprise and express the polynucleotide encoding the polypeptide or functional fragment so that the animal is a useful screening tool. Exemplary methods of using the transgenic non-human animals of the invention for in vivo screening of compounds comprise administering a test compound to a transgenic non-human animal (e.g., a mammal such as a mouse) comprising an isolated modified CFTR polynucleotide encoding a modified CFTR polypeptide or functional fragment thereof stably incorporated into the genome and detecting whether the test compound modulates the modified CFTR polypeptide biological activity and/or physical properties. It is known in the art how to measure these responses in vivo.
[0111] Having described the present invention, the same will be explained in greater detail in the following examples, which are included herein for illustration purposes only, and which are not intended to be limiting to the invention.
Example 1: Various Studies of NBD1 and Full Length CFTR
[0112] NBD1 purification. CFTR NBD1 (residues 387-646, 1405-436D containing the wild type sequence with the M470 polymorphism, referred herein as RI-NBD1, was expressed in E. coli, and the protein purified in 150 mM NaCl, 20 mM HEPES pH 7.5, 10% glycerol, 10% ethylene glycol, 1 mM tris-(2-carboxymethyl) phosphine, 2 mM ATP, 3 mM MgCl.sub.2 as previously described (S. Atwell, et al., Protein Eng. Des Sel, 23 (2010) 375-384; C. Wang, et al., Protein Sci, 19 (2010) 1932-1947; I. Protasevich, et al., Protein Sci, 19 (2010) 1917-1931; Z. Yang, et al., Protein Sci, 23 (2014) 769-789). Proteins were >98% pure as judged by Coomassie Blue staining of SDS-PAGE gels (
[0113] Differential scanning calorimetry (DSC) was carried out on the VP-Capillary DSC System (MicroCal, Malvern Instruments), in 0.13 mL cells with 0.5 mg/ml proteins, at a heating rate of 2 C./min, and an external pressure of 2.0 atm to prevent possible solution degassing upon heating. DSC data were analyzed with the MicroCal Origin 7.0 software (Originlab Corp.), from which the unfolding temperature (T.sub.m.sup.cal) was obtained. The average T.sub.m.sup.cal of RI-NBD1 was 56.70.3 C. from 22 DSC runs, a stabilized T.sub.m approximately 14 degrees higher than that of native NBD1 containing the RI sequence. We previously showed that introducing stabilizing mutations (or the destabilizing F508) into different isolated NBD1 backgrounds (RI, or with RI) affected the T.sub.m.sup.cal to a similar degree (C. Wang, et al., Protein Sci, 19 (2010) 1932-1947; I. Protasevich, et al., Protein Sci, 19 (2010) 1917-1931). DSC for each mutant was repeated 2-3 times, with T.sub.m.sup.cal ranges among replicates 0.6 C. A heating rate of 1 C./min gave slightly lower T.sub.m values by about 2 C., i.e. the RI-NBD1 unfolded at 54.40.1 C., while the 6SS-NBD1 unfolded at 71.90.1 C.; nevertheless the nominal difference Tm was the same.
[0114] Expression of full-length CFTR. We previously described the D165 HEK293 cell line for protein expression, wherein human CFTR was modified with His.sub.10-SUMOstar and .sup.901Flag affinity purification tags and C-terminally fused with the enhanced green fluorescent protein (EGFP) in a lentiviral vector (E. Hildebrandt, et al., Mol Biotechnol, 57 (2015) 391-405). The recombinant CFTR protein with a molecular mass of 212 kDa is referred to herein as WT. We had also generated a similar CFTR construct with the stabilizing mutations RI/2PT (L. A. Aleksandrov, et al., Protein expression and purification, 116 (2015) 159-166; A. A. Aleksandrov, et al., J Mol. Biol, 401 (2010) 194-210) containing a deletion in RI encoding residues 404-435, and the NBD1 mutations S492P, A534P, and 1539T (2PT) (E. Hildebrandt, et al., Biochimica Et Biophysica Acta-Biomembranes, 1859 (2017) 289-293). Building on this RI/2PT construct, single substitutions M470V, S495P, or combinations such as the 7SS variant (RI/2PT/F494N/S495P/G550E/R555K) were added by PCR mutagenesis using 05 polymerase (New England Biolabs). We also generated RI-CFTR matching the RI-NBD1 deletion 405-436 (one amino acid difference), and added the 2PT mutations to build RI/2PT. The latter served to build the 5SS (RI/2PT/S495P/M470V) and 6SS (RI/2PT/S495P/M470V/R555K) constructs. The open reading frames were placed under transcriptional control of either the tetracycline response element TRE-tight (TRE.t) or TRE second generation (TRE.2), as specified in Table 3. As previously described (E. P. Go, et al., J Virol, 89 (2015) 8245-8257) the vectors were packaged, pseudo typed with vesicular stomatitis virus G protein, and used to transduce CHO-S cells (Invitrogen) that had been modified to constitutively express the conventional reverse tet transactivator (rtTA) or 3G-matched rtTA, as specified in Table 3 (S. Urlinger, et al., Proc Natl Acad Sci USA, 97 (2000) 7963-7968). Transduced cells were adapted to suspension culture, and CFTR expression was induced with 1 g/ml doxycycline at 37 C.
[0115] To assess CFTR expression at the cell surface, the cells were live-stained 24 h after induction using mouse anti Flag monoclonal antibody (Sigma F3165). Surface CFTR staining was quantified by flow cytometric analysis of at least 5,000 cells. All CFTR-expressing cell lines were analyzed in parallel, and the experiment was repeated at least four times. LinearFiow fluorescently labeled polystyrene beads (Molecular Probes) was included in each experiment to ensure identical conditions for flow cytometry data collection. For each experiment, median fluorescent intensity (MFI) of the anti-Flag-stained cell population was determined using FlowJo software (FlowJo, LLC).
[0116] Purification of CFTR. Microsomal membrane fractions were prepared from doxycyclin-induced cells expressing recombinant CFTR constructs described above. For ATPase assays, proteins were PKA-phosphorylated and purified to homogeneity using affinity chromatography on Ni-NTA and anti-Flag resins in the presence of 0.05% decyl maltose neopentyl glycol (MNG10) as described (E. Hildebrandt, et al., Biochim Biophys Acta, 1838 (2014) 2825-2837). Purified mutant proteins were resolved on 8% polyacrylamide SDS-gels and quantitated by densitometry of in-gel EGFP fluorescence with bracketing amounts of P-glycoprotein-EGFP as external standard (D. Drew, et al., Nat Methods, 3 (2006) 303-313). Examples of human WT CFTR purified from HEK or CHO are shown in
[0117] ATPase activity. Purified CFTR was supplemented with 0.4 mg/ml phospholipid (POPE/brain S/egg PC/cholesterol 5:3:1:1 w/w, and destabilized with 1/4.sup.th wt. C.sub.12E.sub.8), and ATP hydrolysis was measured with 0.3 mM -[.sup.32P]-ATP, 1.5 mM MgCl.sub.2, pH 7.5, at 33 C. for 2 h using thin-layer chromatography for detection of hydrolyzed ADP as described (E. Hildebrandt, Q. et al., Biochim Biophys Acta, 1838 (2014) 2825-2837). Background measured with reagent blanks containing all components except CFTR was subtracted. Mutant combinations with H1402S lacked detectable ATPase activity and served as negative controls, confirming that the assay detects CFTR-dependent ATP hydrolysis activity.
[0118] Functional Tm, the threshold temperature for inactivation of ATP hydrolysis The approach has been previously described (E. Hildebrandt, et al., Biochimica Et Biophysica Acta-Biomembranes, 1859 (2017) 289-293). Briefly, aliquots of CFTR (about 0.1 g in 20 L) were pretreated 30 min at varying temperatures, then supplemented with phospholipid and assayed for ATPase activity remaining at 33 C. under the conditions stated above. Results for enzymatic activity remaining vs. pretreatment temperature were fit to a three-parameter sigmoidal equation in Sigma Plot. The derived inflection point gives T.sub.m.sup.func. Values were compared using Student's two-tailed t-test.
[0119] Protein unfolding monitored by intrinsic fluorescence. Effects of mutations on thermal stability of full-length CFTR were compared using Trp fluorescence, which required much less protein than DSC. T.sub.m.sup.Trp was determined with 30 l of 1-2 mg/ml protein in 50 mM Tris HCl pH 7.5, 150 mM NaCl, 1 mM dithiothreitol, 10% glycerol, 3 mM MgCl.sub.2, 2 mM ATP, and 0.05% w/v FA-4, in a PolarStar Optima fluorescence plate reader (BMG Labtech, USA), in 30 I volumes overlaid with pure mineral oil (Fisher Scientific) in a 384 well plate. Samples were heated at 1 C./min using an in-house fabricated heating block while monitoring fluorescence at ex=2905 nm, em=3305 nm. CFTR unfolding was irreversible as indicated by the lack of an unfolding transition in rescans of the samples. T.sub.m.sup.Trp is defined as the temperature corresponding to 50% maximal change in fluorescence. Each mutant was determined 2-3 times, and replicates varied within 1 C. The minimum protein concentration required to detect the transition was 1 mg/ml. The purification tags, SUMO* and GFP, by themselves did not exhibited an unfolding transition when heated in the same temperature range. Therefore, the observed changes in fluorescence were attributed to CFTR Trps.
[0120] Single-Channel analysis. Microsomal membrane fraction, prepared from CHO cells expressing the stabilized CFTR variants, were fused to planar lipid bilayers, and single-channel currents were recorded following published procedures (L. A. Aleksandrov, et al., Protein expression and purification, 116 (2015) 159-166; E. Hildebrandt, et al., Mol Biotechnol, 57 (2015) 391-405; A. A. Aleksandrov, et al., J Physiol, 587 (2009) 2875-2886; A. A. Aleksandrov, et al., FEBS Lett, 431 (1998) 97-101). Briefly, planar lipid bilayers were formed with a 3:1 mixture of 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine and 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoserine (Avanti Polar Lipids). The lipid bilayer separated 1.0 ml of solution (cis side) from 5 ml solution (trans side). Both chambers were magnetically stirred and thermally insulated. CFTR ion channels were transferred into the preformed lipid bilayer by spontaneous fusion of membrane vesicles containing naturally folded CFTR constructs. To maintain uniform orientation and functional activity of CFTR channels transferred into the bilayer, MgATP and Protein Kinase A were added in the cis compartment only. Single channel currents were measured at 75 mV in symmetrical salt solution (300 mM Tris-HCl, pH 7.2, 3 mM MgCl.sub.2 and 1 mM EGTA) under voltage-clamp conditions using an Axopatch 200B amplifier (Molecular Devices). The membrane voltage potential of 75 mV is the difference between cis and trans (ground) compartments. The output signal was filtered with an 8-pole Bessel low-pass filter LPBF-48DG (NPI Electronic) with cut-off frequency of 50 Hz to eliminate all closures lasting less than 20 ms including intraburst closings with characteristic life-time less than 5 ms. For kinetic analysis, the signal was digitized by Digidata 1322 (Molecular Device) with a sampling rate of 500 Hz and analyzed using pCLAMP 9.2 (Molecular Device) software. Dwell-time histograms for the open and closed states were plotted in the logarithmic binning mode and fitted by a single exponential function. The validity of the reduced two states kinetic model is evident from the single exponential fit seen for both closed and open dwell time histograms. Origin Pro 7.5 (Originlab) software was used to fit all-points histograms by multi-peak Gaussians. Single-channel current was defined as the distance between peaks on the fitting curve and used for the calculation of the single-channel conductance (D). The probability of the single channel being open (Po) was calculated as a ratio of the area under the peak for the open state to the total area under both peaks on the fitting curve.
[0121] Thermal stability of the channels was measured at 45 C.; temperatures above 50 C. affect the fluidity of the lipids used and compromise the integrity of the planar bilayer (L. A. Aleksandrov, et al., Protein expression and purification, 116 (2015) 159-166). Heating and temperature control were established by a temperature control system TC2BIP (Cell Micro Controls, Norfolk, Va., USA) with heating element covering the trans compartment outer side surfaces and bottom surface. Because of the bulky trans compartment it takes about 2-3 minutes to achieve a uniform temperature distribution across all compartments after the first indication of the expected temperature by the local temperature sensor in the chamber. We consider the thermal stability of the CFTR constructs in terms of its ability to support single channel function with stable open state conductance for the next 5 minutes after initial 5 minute incubation at the temperature of interest (L. A. Aleksandrov, et al., Protein expression and purification, 116 (2015) 159-166).
[0122] Replica-exchange molecular dynamics. REMD simulations were performed for human 6SS-NBD1 starting from the X-ray structure of RI (RI-NBD1 comprising residues 387-646 excluding a deletion of residues 405-436; PDB code 2PZE). Importantly, this is the same contract as used for the experimental work. Results for the WT construct were taken from (M. Zhenin, et al., J Chem Inf Model, 55 (2015) 2349-2364), and the same simulation protocol was followed. Prior to simulation, the 6SS mutations were introduced into WT-NBD1 using the mutation and the side-chain refinement protocols as implemented in Discovery Studio (Dassault Systemes BIOVIA, Discovery studio modeling environment, Release 4.5, San Diego, 2015) and the resulting construct was processed by the Prepare Protein protocol as implemented in Discovery Studio to set the correct protonation states for all residues at pH=7.0. All simulations were performed using the Gromacs Molecular Dynamics package version 4.5.5 (H. J. C. Berendsen, et al., Computer Physics Communications, 91 (1995) 43-56; B. Hess, et al., J Chem Theory Comput, 4 (2008), 435-447) with the OPLS/AA force field (G. A. Kaminski, et al., The Journal of Physical Chemistry B, 105 (2001) 6474-6487). Each REMD simulation consisted of 32 replicas with each replica running for 10 ns, so that the construct was simulated for a total of 960 ns (32 replicas10 ns3 times). Simulations covered a temperature range of 300 to 349.38 K (26.85 to 76.23 C.), a range selected to give the same acceptance probability between all adjacent pairs over the entire temperature range based on known energy distributions of solvated proteins (A. Patriksson, D. van der Spoel, Phys Chem Chem Phys, 10 (2008) 2073-2077).
Example 2: NBD1 Stabilization by Mutagenesis
[0123]
Example 3: Single NBD1 Mutations Increase Calorimetric Tm
[0124] We have previously applied DSC to investigate the thermodynamics and kinetics of unfolding of isolated NBD1 proteins (I. Protasevich, et al., Protein Sci, 19 (2010) 1917-1931; Z. Yang, et al., Protein Sci, 23 (2014) 769-789; Z. Yang, et al., Methods Enzymol, 567 (2016) 319-358). Here we have determined the calorimetric unfolding temperature (T.sub.m.sup.cal) of individual mutations in the isolated NBD1 domain, then assessed the effects of multiple NBD1 mutations (
Example 4: T.SUB.m..SUP.cal .of Combinations of Known NBD1 Mutations
[0125] A limited number of mutation combinations were previously shown to increase thermal stability of NBD1 in an additive manner, and to improve biogenesis of full-length F508-CFTR (L. He, et al., J Mol Biol, 427 (2015) 106-120). For example, combining the three mutations S492P/A534P/1539T (2PT) with G550E/R553M/R555K (Teem), restored maturation of F508-CFTR to 90% of the WT. The T.sub.m.sup.cal of RI-NBD1 containing these 6 mutations was +8.0 C. higher than RI-NBD1 (T.sub.m.sup.cal of 64.70.3 C., 2PT/Teem,
Example 5: Maximizing Thermal Stability of NBD1 by Strategic Combinations of Mutations
[0126] Building on the success of RI/2PT/Teem, we attempted to generate a super-stabilized NBD by adding two other Q-loop mutations, F494N and S495P, and omitting the ineffective R553M (7SS with a total of seven mutations,
Example 6: Mammalian Cells Produce Mature Full-Length CFTR Variants with Stabilizing Mutations
[0127] Based on previous studies (L. He, et al., J Mol Biol, 427 (2015) 106-120; L. A. Aleksandrov, et al., Protein expression and purification, 116 (2015) 159-166), the stabilized NBD1 variants identified above may be expected to favor folding and trafficking of full-length CFTR to the plasma membrane in a mammalian expression system. We introduced a series of mutation combinations shown to increase NBD1 stability into a previously described human CFTR construct, His.sub.10-Sumo*-CFTR.sup.FLAG-EGFP (E. Hildebrandt, et al., Mol Biotechnol, 57 (2015) 391-405), and also deleted RI (405-436). Positioning the FLAG epitope into the fourth extracellular loop of CFTR enabled reliable cell-surface compartmentalization by flow cytometry. The RI deletion is known to rescue maturation, stability and function of full-length F508-CFTR, and to enhance channel activity of CFTR at the cell membrane (A. A. Aleksandrov, et al., J Mol Biol, 419 (2012) 41-60). All combination mutations that were expressed in full-length CFTR are summarized in Table 1, together with their short name and cell line designation. Comparisons of expressions levels among cell lines suggested that surface CFTR expression increased in the RI-CFTR and RI/2PT-CFTR mutations (cell lines D992 and D994,
Example 7: Stabilized CFTR Variants Retain ATPase Function
[0128] We previously demonstrated that phosphorylated, highly purified CFTR from HEK or CHO cells and supplemented with phosphatidylserine hydrolyzes ATP at rates comparable to other ABC transporters (E. Hildebrandt, et al., Biochimica Et Biophysica Acta-Biomembranes, 1859 (2017) 289-293; E. Hildebrandt, et al., Biochim Biophys Acta, 1838 (2014) 2825-2837). Not unexpectedly, rates of ATP hydrolysis were altered when multiple NBD1 mutations were introduced (
Example 8: NBD1-Stabilizing Mutations also Thermally Stabilize Full-Length CFTR
[0129] Tryptophan (Trp) fluorescence is sensitive to environment, and protein unfolding can often be monitored by changes in fluorescence intensity and sometimes changes in the emission maximum wavelength (.sub.max) (Z. Yang, et al., Methods Enzymol, 567 (2016) 319-358). In the folded state at 10 C., CFTR showed a of 334 nm (data not shown), consistent with the majority of detected Trps being in a hydrophobic environment. A representative trace of intrinsic fluorescence vs. temperature is shown in
[0130] For CFTR mutants containing only the NBD1-stabilizing mutations, T.sub.m.sup.trp of full length CFTR correlated strongly with the T.sub.m.sup.cal of isolated NBD1 obtained by DSC (
Example 9: Stabilized CFTR Variants Retain Channel Function
[0131] CFTR is an ATP-gated anion channel whose function is to transport chloride and bicarbonate across the membrane (J. R. Riordan, et al., Annu Rev Biochem, 77 (2008) 701-726). Thus, the most decisive functional assessment is anion transport (A. A. Aleksandrov, et al., J Physiol, 587 (2009) 2875-2886; L. Cui, et al., J Physiol, 572 (2006) 347-358). To analyze whether and how the properties of the stabilized CFTR channels might have been altered, we recorded single channels in planar lipid bilayers (A. A. Aleksandrov, et al., FEBS Lett, 431 (1998) 97-101). Recordings of selected CFTR variants, driven by the same concentration of 0.3 mM ATP and at a temperature of 33 C. comparable to conditions of the ATPase assays, and ion channels parameters are shown on
TABLE-US-00003 TABLE 2 Single channel conductance parameters Conductance P o c o + c P (pSi) Po n value (ms) (ms) (ms) value WT CFTR 12.5 0.3 0.29 0.05 6 162 11 365 23 527 25 RI/2PT/M470V 12.7 0.4 0.34 0.08 5 ns 114 10 172 21 286 23 <0.0001 6SS-CFTR 12.6 0.4 0.27 0.03 4 ns 318 32 709 47 1027 57 <0.0001
[0132] To assess the thermal sensitivity, single channels were recorded at 45 C., a temperature at which we previously demonstrated that WT CFTR was rapidly inactivated within 2 to 3 min, the time required to reach uniform temperature across all compartments of the bilayer apparatus as previously described (L. A. Aleksandrov, et al., Protein expression and purification, 116 (2015) 159-166). The top panel in
TABLE-US-00004 TABLE 1 Mutations that improve NBD1 stability also improve thermal stability of the ATPase activity. Cell T.sub.m.sup.Trp ( C.) T.sub.m.sup.func ( C.) P value .sup.3) short name line .sup.1) mean range n mean sd n vs WT vs 2PT vs 7SS WT (HEK) D165 .sup.2) 21.55 0.53 3 ns WT (CHO) D421 22.23 0.55 3 NBD1 mutations: RI (HEK) D359 24.64 1.34 3 0.0449 0.0311 RI/S492P/A534P/I539T (CHO) 2PT D727 53.2 0.2 2 27.41 0.61 3 0.0004 RI/2PT/M470V (CHO) D851 56.1 0.4 2 28.27 1.17 3 0.0013 ns RI/2PT/M470V/S495P (CHO) 5SS D1012 66.0 1.3 3 33.50 1.23 4 <.0001 0.0006 0.0369 RI/2PT/M470V/S495P/R555K (CHO) 6SS D1013 67.4 0.7 3 35.72 0.75 3 <.0001 0.0001 ns RI/2PT/F494N/S495P/G550E/R555K 7SS D744 62.8 0.6 4 35.65 0.46 3 <.0001 <.0001 NBD2 mutations: RI/2PT/H1402S (CHO) D869 58.2 0.1 2 Inactive .sup.4) RI/2PT/M470V/H1402S (CHO) D872 61.3 1.6 8 Inactive .sup.4) RI/6SS/H1402S (CHO) 6SS/ D1028 72.2 1.1 3 inactive .sup.4) H1402S RI/2PT/S1359A (CHO) D805 52.5 1.2 3 27.24 0.10 3 0.0001 ns <.0001 RI/7SS/S1359A (CHO) D804 31.32 1.00 3 0.0002 0.0044 0.0024 RI/2PT/S1255L/K1334G/S1359A/ 2PT/quad D742 53.0 1.1 3 28.07 0.18 3 <.0001 ns Q1411D (CHO) RI/7SS/S1255L/K1334G/S1359A/ 7SS/quad D743 low activity Q1411D (CHO) .sup.1) Cell line designation is given to facilitate future sample distribution. .sup.2) D165 is the HEK cell line expressing WT CFTR. .sup.3) T.sub.m.sup.func values were compared using the two-tailed student T-test. ns: P > 0.05 .sup.4) H1402S variants showed less than 2% of WT CFTR activity
Example 10: Select NBD2-Stabilizing Mutations did not Stabilize Full-Length CFTR
[0133] We also explored mutations in NBD2 (S1359A, and the quadruplet mutations S1255LIK1334G/S1359A/Q14110 that were recently discovered to significantly improve NBD2 thermal stability. Introducing these NBD2-stabilizing mutations into either RI/2PT (cell line D805, D742) or the 7SS (D804, D743) had no effect on T.sub.m.sup.trp (
Example 11: Molecular Dynamics Simulations Suggest Lower Fluctuations in the Stabilized 6SS-NBD1
[0134] Four of the NBD1 residues mutated in this study are located in structured positions (alpha-helices, turns, and beta-sheets), and seven are in less structured positions (e.g. coil regions) (
Example 12: Expression Platform Strategies to Enhance CFTR Production
[0135] To evaluate whether CFTR expression could be increased in this expression system by other strategies, we analyzed different TRE promotors and reverse tet transcription activators (
Example 13: Thermal Unfolding of Full-Length CFTR
[0136] The fluorescence data were normalized with respect to the pre- and post-transition baselines based on the following formula: fraction of unfolding=(fluorescence signal at temperature Tsignal of native state at T)/(signal of unfolded state at Tsignal of native state at T), where the signal of native state was extrapolated from the linear fit of the pre-transition baseline, and the signal of unfolded state was extrapolated from the linear fit of the post-transition baseline. The T.sub.m.sup.Trp of RI-NBD1 in the DSC buffer was identical to its T.sub.m.sup.Cal determined by DSC (
Example 14: Structure-Based Computations to Correlate NBD1 T.SUB.m..SUP.cal.-Shifts with Structural Parameters
[0137] FoldX (J. Schymkowitz, Nucleic Acids Res, 33 (2005) W382-388) was applied to predict thermodynamic stability of the mutations considered in this work. FoldX calculates G values between a mutant and WI protein through an empirical force field approach using summation over energy terms (e.g., van der Waals interactions, hydrogen bonding, electrostatics, solvation, and entropy estimation), each weighted by an empirically determined factor. Predictions have been validated using experimentally determined G values for a large set of mutations taken from multiple proteins (R. Guerois, et al., J Mol Biol, 320 (2002) 369-387; J. W. Schymkowitz, et al., Proc Natl Acad Sci USA, 102 (2005) 10147-10152.
[0138] FoldX computation of G values- CFTR NBD1 structure (2PZE) including ATP and a Mg.sup.2+ ion was prepared by the Prepare Protein protocol as implemented in Discovery Studio (BIOVIA Discovery Studio Modeling Environment, Release 2016, San Diego, 2016). Incomplete residues were fixed, missing loop regions were modeled, and the protonated states of titratable residues were set based on predicted pK.sub.a values. The structure was then optimized using the repair function of FoldX to remove any steric clashes. Mutations were introduced by the BuildModel function. We performed 10 runs for each mutation to ensure that the algorithm had indeed achieved convergence, even for large residues with many rotamers. Thus, each mutation was characterized by an average G value across all runs.
[0139] Other computation methods-B-factors were obtained from PDB file 2PZE. SASA were calculated from the PDB file using NACCESS (S. Hubbard, et al., University College London, 1993).
[0140] Results-No clear correlation was observed between T.sub.m.sup.cal-shifts (T.sub.m.sup.cal) and G, B-factors, or solvent accessible surface areas (SASA). Still, six of the nine most stabilizing individual mutations considered in this work (T.sub.m.sup.Cal>1 C.) demonstrated negative G FoldX values. Lack of correlation with FoldX results could be attributed to two main reasons: (1) the FoldX force field was primarily developed based on destabilizing mutations and (2) the T.sub.m range of the stabilizing mutations is small (6 C.). In agreement with this proposition, adding to the analysis a set of DSC-derived T.sub.m.sup.cal values for destabilizing NBD1 mutations has provided a G vs. T correlation coefficient>0.6 and a quantitative success rate of 83% in predicting stabilizing/destabilizing mutations.
Example 15: REMD Protocol
[0141] REMD simulations were performed for human 6SS RI-NBD1 (comprising residues 387-646 and excluding residues 405-436 with no additional solubilizing mutations, PDB entry 2PZE). This structure was solved in the presence of TP and a Mg.sup.+2 ion at 1.7 resolution. Prior to simulations, the protein was prepared using the Prepare Protein protocol in Discovery studio (BIOVIA, Dassault Systmes: Discovery studio modeling environment, Release 4.5, San Diego, (2015)). This protocol inserts missing atoms in incomplete residues, models missing loop regions (in this case the Q637-P638 loop) and sets the protonation state of titratable residues based on predicted pKa values. ATP parameters for the OPLS/AA force field were parsed from the OPLS/AA 2001 force field parameters in Schrodinger (Schrodinger, Maestro: Schrodinger, LLC, New York, N.Y., (Release 2016)). The parameters for the Mg.sup.+2 ion are included in the GROMACS implementation of this force field. The 6SS mutations were introduced into the WT background by mutating the relevant residues in 2PZE using Discovery Studio. Mutated residues and their five neighboring residues were optimized using the side-chain refinement protocol in Discovery Studio.
[0142] REMD simulations were performed with the Gromacs Molecular Dynamics package version 4.5.5 (B. Hess, et al., J Chem Theory Comput, 4 (2008) 435-447; H. J. C. Berendsen, et al., Computer Physics Communications, 91 (1995) 43-56) using the OPLS/AA force field (G. A. Kaminski, et al., The Journal of Physical Chemistry B, 105 (2001) 6474-6487) The protein was submerged in TIP4P water in a rhombic dodecahedral box with an additional 10 extension along each axis of the protein. Ions (150 mM NaCl) were added to the solution to make the system electrically neutral. Structures were energy-minimized with the steepest descent algorithm until the convergence criterion of a maximum force smaller than 10.0 kJ/mol/nm was met. Following minimization, each replica (see below for description of the replicas) was equilibrated for 100 ps under NVT conditions. At this stage the solvent and the solute were independently coupled to a bath of the respective replica's temperature with relaxation time of 0.1 ps by means of the V-rescale algorithm (H. J. C. Berendsen, et al., The Journal of Chemical Physics, 81 (1984) 3684-3690). Next, each replica was equilibrated for an additional 100 ps under NPT conditions using the Brendsen pressure coupling with a coupling time of 1.0 ps and a compressibility constant of 4.5*10.sup.5 bar.sup.1. Finally, REMD production phase simulations were carried out under NPT conditions with the leap-frog algorithm (R. W. Hockney, et al., Journal of Computational Physics, 14 (1974) 148-158) using a 2 fs timestep. Long-range electrostatic interactions were computed using Particle Mesh Ewald (PME) electrostatics (T. Darden, et al., The Journal of Chemical Physics, 103 (1995) 8577-8593). Cutoffs for van der Waals and Coulomb interactions were set to 10 . Periodic boundary conditions were applied. The LINCS algorithm was used to constrain bond lengths.
[0143] As per GROMACS defaults, exchanges between the different replicas were attempted every 10 ps. Given an average acceptance rate of 24% (Table 4) succesfull exchanges were made every 40 ps. This timespan is about four times larger than the autocorelation time of the potential energy which was found to be 10 ps. These numbers are in general agrement with those recommended by Abraham and Gready (M. J. Abraham, et al., Journal of Chemical Theory and Computation, 4 (2008) 1119-1128).
[0144]
[0145] Protein stability, or the lack thereof, represents a substantial challenge to biochemical and biophysical analyses of many proteins, especially membrane proteins that require solubilization in detergents that may destabilize extra- as well as intramembranous domains (Z. Yang, C. Wang, Q. Zhou, J. An, E. Hildebrandt, L. A. Aleksandrov, J. C. Kappes, L. J. DeLucas, J. R. Riordan, I. L. Urbatsch, J. F. Hunt, C. G. Brouillette, Protein Sci, 23 (2014) 769-789; D. V. Tulumello, C. M. Deber, Biochim Biophys Acta, 1818 (2012) 1351-1358). The multidomain complexity and highly dynamic nature of the channel, together with CFTR's intrinsic instability, particularly in detergents, make its study especially challenging (X. Meng, et al., Protein expression and purification, 116 (2015) 159-166; Z. Yang, et al., Protein Sci, 23 (2014) 769-789; E. Hildebrandt, et al., Biochim Biophys Acta, 1838 (2014) 2825-2837).
TABLE-US-00005 TABLE 4 Acceptance exchange rates between neighboring replicas for 6SS-NBD1. Replica 0-1 1-2 2-3 3-4 4-5 5-6 6-7 7-8 8-9 9-10 Exchange rate 0.23 0.22 0.26 0.23 0.23 0.23 0.25 0.25 0.24 0.2 Replica 10-12 11-12 12-13 13-14 14-15 15-16 16-17 17-18 18-19 19-20 Exchange rate 0.25 0.23 0.23 0.24 0.24 0.24 0.25 0.23 0.24 0.24 Replica 20-21 21-22 22-23 23-24 24-25 25-26 26-27 27-28 29-30 30-31 Exchange rate 0.23 0.24 0.25 0.25 0.25 0.24 0.25 0.26 0.26 0.25
[0146] Recent work applying similar approaches to unfolding of CFTR domains (C. Wang, et al., Protein Sci, 19 (2010) 1932-1947; I. Protasevich, et al., Protein Sci, 19 (2010) 1917-1931; L. He, et al., J Mol Biol, 427 (2015) 106-120; Z. Yang, et al., Methods Enzymol, 567 (2016) 319-358; R. M. Vernon, et al., J Biol Chem, (2017)) significantly advanced our mechanistic understanding of the disease-causing defect of F508. In the current study, we used DSC to
TABLE-US-00006 TABLE 3 CFTR content in membrane preparations expression system transactivator, CFTR in membrane Cell response parent cell (g/billion cells) .sup.2) Mutations short name line .sup.1) element line mean sd n WT (CHO) D421 TRE.2 rtTA, D389 .sup.3) 166 1 WT (CHO) D507.c TRE.2 rtTA, D389 WT (CHO) D1044 TRE.2 3G, D896 30 1 NBD1 mutations RI (CHO) .sup.4) D992 TRE.2 3G, D896 RI/S492P/A534P/I539T (CHO) 2PT D727 TRE.t rtTA, D389 279 171 5 RI/S492P/A534P/I539T (CHO) 2PT D727.1 TRE.t 3G, D896 RI/S492P/A534P/I539T (CHO) 2PT D994 TRE.2 3G, D896 RI/2PT/M470V (CHO) D851 TRE.t rtTA, D389 175 112 5 RI/2PT/M470V (CHO) D1022 TRE.t 3G, D896 655 166 3 RI/2PT/M470V/S495P (CHO) 5SS D1012 TRE.2 3G, D896 1254 1 RI/2PT/M470V/S495P/R555K (CHO) 6SS D1013 TRE.2 3G, D896 870 259 6 RI/2PT/F494N/S495P/G550E/R555K 7SS D744 TRE.t rtTA, D389 287 197 4 NBD2 mutations RI/2PT/H1402S D869 TRE.t rtTA, D389 385 314 8 RI/2PT/H1402S D917.c TRE.t rtTA, D389 277 1 RI/2PT/M470V/H1402S D872 TRE.t rtTA, D389 460 193 4 RI/2PT/M470V/H1402S D928.c TRE.t rtTA, D389 406 103 3 RI/2PT/M470V/H1402A D873 TRE.t rtTA, D389 375 1 RI/2PT/M470V/H1402A D930.c TRE.t rtTA, D389 356 138 4 RI/2PT/M470V/S495P/R555K/H1402S 6SS/ D1028.c TRE.2 3G, D896 1130 315 7 H1402S RI/2PT/S1255L/K1334G/S1359A/ 2PT/quad D742 TRE.t rtTA, D389 525 1 Q1411D .sup.1) Cell line designation is given to facilitate future sample distribution. CFTR mutations were expressed in CHO cells as detailed in methods. Clonal cell lines have the .c suffix. .sup.2) CFTR-GFP content (total complex glycosylated band C and core glycosylated band B) in microsomal membranes, prepared from three to five billion cells, was quantitated using in-gel GFP fluorescence and P-glycoprotein-EGFP as described previously. .sup.3) The response element and transactivator expression strategies are described in FIG. 10. CFTR content in membranes was affected by the expression platform strategy, with the highest yields obtained from 5SS-, 6SS- and 6SS/H1402S-CFTR expressing cells (bold numbers). .sup.4) RI-NBD1 has the 405-436 deletion previously used in NBD1 studies. RI with 404-435, differing by one amino acid, was studied previously.
analyze in detail the ability of site-specific substitutions to increase thermal stability (T.sub.m.sup.cal) of RI-NBD1. We systematically and iteratively combined mutations to demonstrate progressive stabilization of RI/2PT by introducing M470V, S495P and R555K mutations, to ultimately yield an NBD1 domain with highly improved stability.
[0147] Indeed, the most stable combinations 6SS-NBD1 and 7SS-NBD1 exhibited T.sub.m.sup.cal values of 74 C. and 71 C., respectively, representing an increase of more than 15 C. over RI-NBD1, and outperforming previously published RI/2PT/Teem NBD1 (L. He, et al., J Mol Biol, 427 (2015) 106-120; A. A. Aleksandrov, et al., J Mol Biol, 419 (2012) 41-60) by 7 to 10 C. (
[0148] For the set of single site stabilizing mutations considered in this work, we did not observe a strong correlation between the experimental T.sub.m.sup.cal values and either local structural parameters (B-factors, or solvent accessible surface areas) or Fold X-calculated G values. On the other hand, REMD simulations suggested reduced fluctuations at specific positions in the more flexible regions of stabilized 6SS-NBD1, providing a strategy to engineer further mutations in CFTR to generate a protein with even greater stability and potentially paving the way towards NBD1 (and consequently CFTR) stabilization via drug like molecules. Of note, MD simulations have recently been used to probe the unfolding of four NBD1 constructs pointing to several residues (e.g., S492, Q493, T465, A554-Y563, L571, S573, P574, F575, K584, 1586) whose mutation was suggested to enhance the folding efficiency of F508-NBD1 (S. G. Estacio, et al., Mol Biosyst, 12 (2016) 2834-2848). Of these, the S492P and R555K as well as the close-by F494N and S495P mutations were shown in the present work to stabilize the WT domain.
[0149] Several earlier studies have suggested that NBD1 structural stability is one of the determining factors in CFTR stability (G. L. Lukacs, et al., Trends Mol Med, 18 (2012) 81-91; S. J. Kim, et al., Frontiers in pharmacology, 3 (2012) 20; C. Wang, et al., Protein Sci, 19 (2010) 1932-1947; I. Protasevich, et al., Protein Sci, 19 (2010) 1917-1931; P. H. Thibodeau, et al., J Biol Chem, 285 (2010) 35825-35835; J. L. Mendoza, et al., Cell, 148 (2012) 164-174. 29; W. M. Rabeh, et al., Cell, 148 (2012) 150-163; L. He, et al., J Mol Biol, 427 (2015) 106-120; Z. Yang, et al., Protein Sci, 23 (2014) 769-789). In particular, the work by Mendoza et al. and Rabeh et al. recognized the correlation of NBD1 in vitro stabilization with the improved de novo folding efficiency and expression of the full length CFTR (J. L. Mendoza, et al., Cell, 148 (2012) 164-174; W. M. Rabeh, et al., Cell, 148 (2012) 150-163). Results with the current, more extensive panel of CFTR mutants fully support this idea. Increased thermal stability of the NBD1 domain (T.sub.m.sup.cal) correlated directly with improved thermal (T.sub.m.sup.trp) and functional (T.sub.m.sup.func) stability of full length CFTR (
[0150] In a typical ABC transporter, ATP binding induces NBD dimerization, while ATP hydrolysis is thought to dissociate the dimer (D. N. Sheppard, et al., Physiol Rev, 79 (1999) S23-45; J. R. Riordan, et al., Annu Rev Biochem, 77 (2008) 701-726; D. C. Gadsby, et al., Nature, 440 (2006) 477-483). A current view is that NBD dimerization and dissociation transmit conformational changes via the ICLs to the transmembrane domains to gate the channel (Z. Zhang, et al., Cell, 170 (2017) 483-491.e488; J. Zhang, et al., J Gen Physiol, 149 (20H) 355-372; W. Y. Lin, et al., Mol Pharmacal, 90 (2016), 275-285; H. I. Yeh, et al., J Gen Physiol, 145 (2015) 47-60). Interestingly, we observed large effects on T.sub.m.sup.func and T.sub.m.sup.trp by mutations in the Q-loop (S492P, S495P) thought to transmit signals to the transmembrane domains (for example SSS, Table 1) (P. Linsdell, Adv Exp Med Biol, 925 (2017), 13-32). Potentially, structural stabilization of NBD1 may also enhance these connections to the ICLs and so contribute to stabilization of the full-length CFTR protein. Thus, T.sub.m.sup.func may not only track the stability of the NBDs but also the ICL connections. Importantly, the thermally stabilized 6SS-CFTR channel was active at 33 C., and remained active for prolonged times at elevated temperatures as high as 45 C. where WT CFTR rapidly lost function.
[0151] Conformational state is an additional component of structural stability. T.sub.m.sup.trp detected the stabilizing effect of the switch histidine mutation H1402S, which abolished ATP hydrolysis and would be presumed, as in other ABC transporters, to trap non-hydrolyzed ATP in an NBD1-NBD2 dimer conformation (J. Zaitseva, et al., Embo J, 24 (2005),1901-1910), and to render an open channel conformation (L. A. Aleksandrov, et al., Protein expression and purification, 116 (2015) 159-166). A similar +5 C. shift in T.sub.m.sup.trp due to H1402S was consistently observed in RI/2PT/H1402S, RI/2PT/M470V/H1402S, and 6SS/H1402S, suggesting that the shift in conformational population enhanced structural stability of the protein. Indeed, a similar stabilizing effect was observed in P-glycoprotein with equivalent mutations that promoted the occluded NBD dimer conformation with trapped MgATP (G. Tombline et al., J Biol Chern, 279 (2004) 31212-31220; Z. Yang, et al., Biochim Biophys Acta, 1859 (2017) 48-60). A large body of literature reports on conformational stabilization due to specific mutations and combinations of mutations in G-protein coupled receptors (GPCRs). In those cases, conformational stabilization was essential to obtain crystal structures in different states (M. J. Serrano-Vega, et al., Proc Natl Acad Sci USA, 105 (2008) 877-882;Y. Shibata, et al., Biochim Biophys Acta, 1828 (2013) 1293-1301; F. M. Heydenreich, et al., Frontiers in pharmacology, 6 (2015) 82; N. Vaidehi, et al., Trends Pharmacal Sci, 37 (2016) 37-46). Thermal unfolding studies with P-glycoprotein and other membrane proteins have shown that unfolding of a-helical transmembrane domains is unlikely to be detected by Trp fluorescence over the temperature range of the present study (Z. Yang, et al., Methods Enzymol, 567 (2016) 319-358; Z. Yang, et al., Biochim Biophys Acta, 1859 (2017) 48-60; T. Haltia, et al., Biochim Biophys Acta, 1241 (1995) 295-322; A. M. Pawl, et al., Biochim Biophys Acta, 1818 (2012) 889-895). In CFTR, 11 of the 23 intrinsic Trp residues are situated in transmembrane domains. However, several Trps in NBD1 (W496, W401) and it's connecting ICL4 loop (W1063), as well as in NBD2 (W1274, W1282, W1310, W1316) and its connecting ICL2 loop (W278) are buried within the domains or at the domain interface and eligible to report tertiary unfolding of these cytoplasmic domains (C. A. Royer, Chem Rev, 106 (2006) 1769-1784; K. Stankova, et al., Biochem J, 443 (2012) 701-709). Because fluorescence emission is an average of all Trps in different local environments, the detected single transition for CFTR suggests that unfolding of these domains is highly cooperative. We feel the most straight forward interpretation of the Trp fluorescence data for CFTR is that it represents unfolding of cytosplasmic portions of the protein in a way that is responsive to protein conformational state.
[0152] In mammalian cells, the new stabilized variants of CFTR all exhibited strong localization of mature glycosylated protein to the cell surface, were purifiable under mild conditions, and demonstrated significantly improved stability. In conclusion, CFTR variants with a highly stabilized NBD1 domain, imparting greatly enhanced structural and functional stability, together with conformational stabilization by the H1402S mutation, will facilitate future biochemical and biophysical studies, and may open the door to higher resolution structures by Cryo-EM or crystallography. The stabilized CFTR variants may enable structural studies of folding mutations like b.F508, for which protein production and purification have been problematic. They might also facilitate other ongoing lines of investigation, such as domain assembly, the mechanisms of gating and channel regulation, and insights into the natural mutations that cause cystic fibrosis.
[0153] The present invention may be embodied in other specific forms without departing from its spirit or essential characteristics. The described embodiments are to be considered in all respects only as illustrative and not restrictive. The scope of the invention is, therefore, indicated by the appended claims rather than by the foregoing description. While certain embodiments and details have been included herein and in the attached invention disclosure for purposes of illustrating the invention, it will be apparent to those skilled in the art that various changes in the methods and apparatus disclosed herein may be made without departing from the scope of the invention, which is defined in the appended claims. All changes which come within the meaning and range of equivalency of the claims are to be embraced within their scope.