Recombinant microorganism and method for producing a substance using the same

10377993 ยท 2019-08-13

Assignee

Inventors

Cpc classification

International classification

Abstract

This invention provides a recombinant microorganism into which an acyl-CoA reductase exhibiting excellent activity in a reduction reaction using acyl-CoA as a substrate has been introduced. Such recombinant microorganism comprises a nucleic acid encoding an acyl-CoA reductase comprising any of characteristic Common sequences 1 to 3 introduced into a host microorganism.

Claims

1. A recombinant microorganism comprising a nucleic acid encoding an acyl-CoA reductase, wherein the acyl-CoA reductase is selected from (a) or (b) below: (a) a protein comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 14, 16, 18, 20, 22, 24, 26, 28, 30, 32 and 34; or (b) an amino acid sequence having 80% or higher identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 14, 16, 18, 20, 22, 24, 26, 28, 30, 32 and 34, and having acyl-CoA reductase activity, wherein said recombinant microorganism further comprises aldehyde decarbonylase activity for synthesizing a hydrocarbon using an aldehyde as a substrate.

2. The recombinant microorganism according to claim 1, wherein the acyl-CoA reductase is the protein (a) or (b) below: (a) a protein comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 14, 16, and 18; or (b) a protein comprising an amino acid sequence having 80% or higher identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 14, 16, and 18, and having acyl-CoA reductase activity.

3. The recombinant microorganism according to claim 1, wherein the host microorganism is selected from the group consisting of Escherichia coli, Corynebacterium, and yeast.

4. The recombinant microorganism according to claim 1, which produces a hydrocarbon comprising a carbon chain of 13 to 15 carbon atoms.

5. A recombinant microorganism comprising a nucleic acid encoding an acyl-CoA reductase, wherein the acyl-CoA reductase is selected from (a) or (b) below: (a) a protein comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 14, 16, 18, 20, 22, 24, 26, 28, 30, 32 and 34; or (b) an amino acid sequence having 80% or higher identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 14, 16, 18, 20, 22, 24, 26, 28, 30, 32 and 34, and having acyl-CoA reductase activity, wherein said recombinant microorganism further comprises a nucleic acid encoding an aldehyde decarbonylase that synthesizes a hydrocarbon using an aldehyde as a substrate.

6. A recombinant microorganism comprising a nucleic acid encoding the protein (a) or (b) below introduced into a host microorganism: (a) a protein comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 14, 16, 18, 20, 22, 24, 26, 28, 30, 32 and 34; or (b) a protein comprising an amino acid sequence having 80% or higher identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 14, 16, 18, 20, 22, 24, 26, 28, 30, 32 and 34, and having acyl-CoA reductase activity, wherein said recombinant microorganism further comprises aldehyde decarbonylase activity for synthesizing a hydrocarbon using an aldehyde as a substrate.

7. The recombinant microorganism according to claim 6, wherein the host microorganism is selected from the group consisting of Escherichia coli, Corynebacterium, and yeast.

8. The recombinant microorganism according to claim 6, which produces a hydrocarbon comprising a carbon chain of 13 to 15 carbon atoms.

9. A recombinant microorganism comprising a nucleic acid encoding the protein (a) or (b) below introduced into a host microorganism: (a) a protein comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 14, 16, 18, 20, 22, 24, 26, 28, 30, 32 and 34; or (b) a protein comprising an amino acid sequence having 80% or higher identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 14, 16, 18, 20, 22, 24, 26, 28, 30, 32 and 34, and having acyl-CoA reductase activity, wherein said recombinant microorganism further comprises a nucleic acid encoding an aldehyde decarbonylase that synthesizes a hydrocarbon using an aldehyde as a substrate.

10. A method for producing a substance comprising a step of culturing the recombinant microorganism according to claim 1 in a medium containing a carbon source and a step of recovering a target substance from the cultured recombinant microorganism.

11. The method for producing a substance according to claim 10, wherein the target substance is at least one member selected from the group consisting of an aliphatic aldehyde, an aliphatic alcohol, and a hydrocarbon.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 shows a dendrogram prepared using ClustalW on the basis of amino acid sequence information regarding an acyl-CoA reductase with high-level activity for synthesizing an aldehyde using acyl-CoA as a substrate.

(2) FIG. 2-1 shows the results of multiple alignment analysis of the proteins included in the dendrogram shown in FIG. 1 (Gene ID No. 100245182 is SEQ ID NO: 24; Gene ID No. 100776505 is SEQ ID NO: 14; Gene ID No. 100801815 is SEQ ID NO: 16; Gene ID No. 100845156 is SEQ ID NO: 30; Gene ID No. 101212401 is SEQ ID NO: 28; Gene ID No. 101262598 is SEQ ID NO: 26; Gene ID No. 101311020 is SEQ ID NO: 20; Gene ID No. 101510781 is SEQ ID NO: 18; Gene ID No. 101779750 is SEQ ID NO: 32; Gene ID No. Os03t0167600-01 is SEQ ID NO: 36; Gene ID No. POPTR_576417 is SEQ ID NO: 22; Gene ID No. SORBI_01g046030 is SEQ ID NO: 34).

(3) FIG. 2-2 is a continuation of FIG. 2-1, which shows the results of multiple alignment analysis of the proteins included in the dendrogram shown in FIG. 1.

(4) FIG. 2-3 is a continuation of FIG. 2-2, which shows the results of multiple alignment analysis of the proteins included in the dendrogram shown in FIG. 1.

(5) FIG. 3 shows the results of multiple alignment analysis of a protein having superior acyl-CoA reductase activity among the proteins included in the dendrogram shown in FIG. 1 (Gene ID No. 100776505 is SEQ ID NO: 14; Gene ID No. 100801815 is SEQ ID NO: 16; Gene ID No. 101510781 is SEQ ID NO: 18).

(6) FIG. 4 schematically shows an expression vector containing the acyl-CoA reductase gene and an expression vector containing the aldehyde decarbonylase gene.

(7) FIG. 5 shows a characteristic diagram showing the results of quantitative GC/MS analysis of tridecane and pentadecane of the recombinant Escherichia coli strains prepared in the example.

(8) FIG. 6 shows a characteristic diagram showing the results of quantitative GC/MS analysis of tetradecanol and hexadecanol of the recombinant Escherichia coli strains prepared in the example.

(9) FIG. 7 shows a characteristic diagram showing a chart demonstrating the results of GC/MS analysis of the recombinant Escherichia coli strains prepared in the example (i.e., the Gm2 strain).

EMBODIMENTS FOR CARRYING OUT THE INVENTION

(10) Hereafter, the present invention is described in more detail with reference to the drawings and the examples.

(11) The recombinant microorganism according to the present invention comprises a nucleic acid encoding an acyl-CoA reductase having particular common sequences introduced thereinto. The recombinant microorganism according to the present invention expresses the acyl-CoA reductase to thereby reduce acyl-CoA (it is occasionally referred to as aliphatic acyl-CoA), which is a thioester compound of an aliphatic acid with CoA, and produce an aldehyde compound with high efficiency. The aldehyde compound produced is oxidized in the metabolic reaction within the microorganism and converted into an alcohol, or it is used as a substrate for hydrocarbon synthesis by an enzyme having hydrocarbon-synthesizing activity. Thus, the recombinant microorganism according to the present invention is not only capable of producing an aldehyde with high efficiency, but it is also capable of producing an alcohol and/or hydrocarbon from such aldehyde compound with high efficiency, through expression of the acyl-CoA reductase.

(12) The term nucleic acid refers to a nucleic acid existing in nature, such as DNA or RNA, or an artificial nucleic acid, such as a nucleic acid molecule resulting from chemical modification to PNA (peptide nucleic acid), a nucleotide, a sugar, or a diester phosphate moiety. The term a nucleic acid encoding an acyl-CoA reductase refers both to a region comprising an expression regulatory region and a coding region in the genome and a region consisting of a coding region in the genome.

(13) Acyl-CoA is synthesized from a sugar as a result of the metabolic reaction in a host microorganism. A sugar is a substance represented by a chemical formula C.sub.n(H.sub.2O).sub.m. Examples thereof include an aldehyde of a polyhydric alcohol, a ketone derivative of a polyhydric alcohol, and derivatives and condensates of substances related thereto, and specific examples include polysaccharides, oligosaccharides, disaccharides, and monosaccharides. Specific examples of monosaccharides include glucose, fructose, galactose, mannose, xylose, xylulose, ribose, erythrose, threose, erythrulose, glyceraldehyde, and dihydroxyacetone. Specific examples of disaccharides include sucrose (saccharose), lactose, maltose, trehalose, and cellobiose.

(14) [Acyl-CoA Reductase]

(15) An example of a common sequence in the acyl-CoA reductase described above is the amino acid sequence shown below:

(16) TABLE-US-00001 GxGxxxFLxxKxxxxxGxTGFLxKVxIEKILRTxPxVxKxxxxIKAxxxx xAxxRLxxxxxxxxxFxxLxxxxGxxYxxFxxxKLxPxxGxxxxxxxGxx xxxxxxxAxxVDxxxNSAANTTFxERYDxAxxxNTxGxxxxMxxAxxxxx LKLFLxxSTAYVNGQxQGxxxExPF(26-57aa)GLxRAxxxGWQDTYVF TKAMGEMxxxxxRxxxPVxxxRPSVIESTxxxPFPGWMEGxRMMDPxxLx YGKGQLxGFxxDPxGVxDVVPADMVVNATLAxxAxHG(9-18aa)YxxxS SxxNPLxFxxLxxxxxxHxxxxPxxDxxGxPIxVxxM(39-48aa)VxQx xxLxxIYxPYTFxxGRFDNxNxxxLxxxMxxxExxxFxFDVxxxxWxDYI xNVHIPGLxxxVxKG(Commonsequence1).

(17) In the amino acid sequence above, x represents an arbitrary amino acid residue. In the amino acid sequence above, a notation composed of two numbers separated by a hyphen (-) and aa indicates a region comprising an arbitrary number of intervening amino acid residues between two such numbers. In this description, amino acid sequences are represented in the manner described above.

(18) In other words, the amino acid sequence of Common sequence 1 comprises the amino acid sequence of SEQ ID NO: 1, a region of 26 to 57 arbitrary amino acid residues, the amino acid sequence of SEQ ID NO: 2, a region of 9 to 18 arbitrary amino acid residues, the amino acid sequence of SEQ ID NO: 3, a region of 39 to 48 arbitrary amino acid residues, and the amino acid sequence of SEQ ID NO: 4 linked in that order from the N terminus to the C terminus.

(19) Common sequence 1 is determined in the manner described below. That is, an acyl-CoA reductase having high-level activity for synthesizing an aldehyde compound using acyl-CoA as a substrate is identified from among various types of acyl-CoA reductases, a dendrogram is prepared using ClustalW on the basis of amino acid sequence information regarding the identified group of acyl-CoA reductases (FIG. 1), a multiple alignment is prepared (FIG. 2-1 to FIG. 2-3), and Common sequence 1 is then determined on the basis of the dendrogram and the multiple alignment prepared.

(20) Specifically, Common sequence 1 is an amino acid sequence that characterizes a group of acyl-CoA reductases having high-level activity for synthesizing an aldehyde compound using acyl-CoA as a substrate among various types of acyl-CoA reductases. In other words, an acyl-CoA reductase that comprises Common sequence 1 has higher activity for synthesizing an aldehyde compound using acyl-CoA as a substrate than an acyl-CoA reductase that does not comprise Common sequence 1. Common sequence 1 can serve as an apparent standard for distinguishing a group of acyl-CoA reductases having high-level activity for synthesizing an aldehyde compound using acyl-CoA as a substrate from acyl-CoA reductases having no or low-level activity for synthesizing an aldehyde compound using acyl-CoA as a substrate.

(21) Specific examples of acyl-CoA reductases each comprising Common sequence 1 include the 12 types of acyl-CoA reductases shown in Table 1.

(22) TABLE-US-00002 TABLE 1 Nucleotide Amino acid Gene ID Gene origin sequence sequence 101311020 Fragaria vesca (woodland strawberry) SEQ ID NO: 20 100776505 Glycine max (soybean) SEQ ID NO: 13 SEQ ID NO: 14 100801815 SEQ ID NO: 15 SEQ ID NO: 16 POPTR_576417 Populus trichocarpa (black cottonwood) SEQ ID NO: 21 SEQ ID NO: 22 100245182 Vitis vinifera (wine grape) SEQ ID NO: 23 SEQ ID NO: 24 101510781 Cicer arietinum (chickpea) SEQ ID NO: 17 SEQ ID NO: 18 101262598 Solanum lycopersicum (tomato) SEQ ID NO: 25 SEQ ID NO: 26 101212401 Cucumis sativus (cucumber) SEQ ID NO: 27 SEQ ID NO: 28 100845156 Brachypodium distachyon SEQ ID NO: 29 SEQ ID NO: 30 101779750 Setaria italica (foxtail millet) SEQ ID NO: 31 SEQ ID NO: 32 SORBI_01g046030 Sorghum bicolor (sorghum) SEQ ID NO: 33 SEQ ID NO: 34 Os03t0167600-01 Oryza sativa japonica (Japanese rice) SEQ ID NO: 35 SEQ ID NO: 36

(23) Specific examples of nucleic acids encoding acyl-CoA reductases comprising Common sequence 1 include the gene identified with Gene ID: 101311020 derived from Fragaria vesca (woodland strawberry), the gene identified with Gene ID: 100776505 derived from Glycine max (soybean), the gene identified with Gene ID: 100801815 derived from Glycine max (soybean), the gene identified with Gene ID: POPTR_576417 derived from Populus trichocarpa (black cottonwood), the gene identified with Gene ID: 100245182 derived from Vitis vinifera (wine grape), the gene identified with Gene ID: 101510781 derived from Cicer arietinum (chickpea), the gene identified with Gene ID: 101262598 derived from Solanum lycopersicum (tomato), the gene identified with Gene ID: 101212401 derived from Cucumis sativus (cucumber), the gene identified with Gene ID: 100845156 derived from Brachypodium distachyon, the gene identified with Gene ID: 101779750 derived from Setaria italica (foxtail millet), the gene identified with Gene ID: SORBI_01g046030 derived from Sorghum bicolor (sorghum), and the gene identified with Gene ID: Os03t0167600-01 derived from Oryza sativa japonica (Japanese rice).

(24) FIGS. 2-1 to 2-3 show the results of alignment analysis of amino acid sequences of acyl-CoA reductases derived from various plant species shown in Table 1 using the ClustalW multiple sequence alignment program, which is available on the DDBJ of the National Institute of Genetics. Versions and various parameters employed for analysis are described below.

(25) ClustalW Version, 2.1

(26) Pairwise Alignment Parameters Alignment Type, Slow Slow Pairwise Alignment Options Protein Weight Matrix, Gonnet Gap Open, 10 Gap Extension, 0.1
Multiple Sequence Alignment Parameters Protein Weight Matrix, Gonnet Gap Open, 10 Gap Extension, 0.20 Gap Distances, 5 No End Gaps, no Iteration, none Numiter, 1 Clustering, NJ
Output Options Format, Aln w/numbers Order, Aligned

(27) As is apparent from FIGS. 2-1 to 2-3, the acyl-CoA reductases shown in Table 1 comprise Common sequence 1 described above. As shown in FIGS. 2-1 to 2-3, Common sequence 1 is determined by extracting amino acid residues that are perfectly consistent among the amino acid sequences of the plurality of acyl-CoA reductases shown in Table 1 and substituting other amino acid residues with arbitrary amino acids (denoted as X).

(28) As shown in FIGS. 2-1 to 2-3, also, the amino acid sequences of the plurality of acyl-CoA reductases shown in Table 1 comprise amino acid residues that are not perfectly consistent with each other, but are similar to each other. Thus, Common sequence 2 comprising such similar amino acid residues instead of Common sequence 1 can be defined. Specifically, Common sequence 2, which is among the plurality of acyl-CoA reductases shown in Table 1, is an amino acid sequence comprising amino acid residues that are perfectly consistent among the plurality of acyl-CoA reductases shown in Table 1 and amino acid residues that are not perfectly consistent but are similar to each other.

(29) Specifically, the amino acid sequence of Common sequence 2 is as shown below.

(30) TABLE-US-00003 Commonsequence2: G(I/L)G(I/V)xxFLx(G/A)Kx(F/L)x(I/V)(T/S)G(A/G)TGFL (A/G)KV(L/F)IEKILRTxP(D/N)V(G/N)K(I/M)(Y/F)x(L/V)I KA(K/E)xx(E/Q/D)(A/V)AxxRLx(N/I/K)(E/D)(I/V)(I/V/ L)(N/D)(A/T)(E/Q/D)(V/L/I)Fx(O/G/R)L(Q/R/K)x(A/I/ V/T)(Y/H)G(K/N/E)(S/D/Y/G)Y(Q/H/M/S/D)xF(M/V/I/A) (L/A/I)(S/A/R/N/K)KL(V/I)P(V/I)(A/L/V)Gx(V/I)(C/R) (G/E/D)x(S/N/D)(L/I/V)Gxxx(D/G/E)x(A/S)xx(I/M)Ax (E/R/D/Q)VD(V/I)(I/F/V)(V/I)NSAANTTF(D/H)ERYD(I/ T/V)Ax(D/N)(I/V)NTxG(P/T)x(H/R/N)(L/I)Mx(F/I)A(K/ H/Q)x(C/F)x(K/R/N)LKLFL(Q/H)(V/I)STAYVNGQ(R/K/T)QG (R/V/L)(I/V)(M/L)E(K/R)PFxx(G/E)(D/E/L)x(I/V)(A/R/ E/I)x(E/D)(17-48aa)GL(E/Q)RAxxxGWQDTYVFTKAMGEM(V/ M)(I/V)(D/N)x(M/L)R(G/D)(E/D)(I/L/V)PV(V/A)x(I/M) RPSVIESTxx(E/D)PFPGWMEG(N/S)RMMDP(I/V)(V/I)L(Y/O/ W)YGKGQL(T/S)GF(V/L)(A/V)DP(N/Y/E/D)GV(L/I)DVVPAD MVVNATLA(A/S)(M/I)A(R/K/W)HG(8-17aa)(V/I)Y(Q/H)x (A/T/S)SS(V/T/A)(V/A)NPL(I/V/D/A)Fx(D/R/E)Lx(S/R/ D/K/T)(H/L/M/F)(F/L)xxHxx(S/R/G)(S/O)PxxDxxG(N/R/ Q/T)PIxV(P/S)xM(K/R/S)(L/F)(F/L)x(S/T)(T/I/M/V/S) (E/D)x(F/L)(S/A)x(H/Y)(L/V/I)(W/E)(R/I)(D/Y)(A/V) xx(R/K)(S/R/C/A)(18-26aa)(K/R)(S/T)V(K/E)Q(A/T/L) (K/T/V)(Y/H)L(A/G)xIYxPYTF(Y/F)(G/P/N)GRFDN(S/G)N (T/V)(Q/E)xL(M/L/I/F)xxM(O/S/T)(E/A/K/V/P)(E/K/A/ N)E(K/R)xxFxFDVx(S/N/G)(I/L/V)(D/E)WxDYI(S/T)NVHI PGL(R/K)(R/K)(H/Y)V(M/L)KG

(31) In the amino acid sequences described herein, a notation composed of a plurality of amino acids separated by slashes I in parentheses indicates that the position represented thereby is any of such plurality of amino acids.

(32) In other words, the amino acid sequence of Common sequence 2 comprises the amino acid sequence of SEQ ID NO: 5, a region of 17 to 48 arbitrary amino acid residues, the amino acid sequence of SEQ ID NO: 6, a region of 8 to 17 arbitrary amino acid residues, the amino acid sequence of SEQ ID NO: 7, a region of 18 to 26 arbitrary amino acid residues, and the amino acid sequence of SEQ ID NO: 8 linked in that order from the N terminus to the C terminus.

(33) The amino acid sequence of Common sequence 2 allows an acyl-CoA reductase having high-level activity for synthesizing an aldehyde compound using acyl-CoA as a substrate to be more precisely distinguished from an acyl-CoA reductase having no or low-level activity for synthesizing an aldehyde compound using acyl-CoA as a substrate among various types of acyl-CoA reductases.

(34) Amino acid residues that can be present at given positions in Common sequence 2 vary for the following reasons. As described in Reference Document (1) (McKee Biochemistry, Third Edition, Chapter 5: Amino acids, Peptides, and Proteins, 5.1: Amino acids, Atsushi Ichikawa (supervising editor), Shinichi Fukuoka (supervising translator), Ryosuke Sone (publisher), Kagaku-Dojin Publishing Company, Inc., ISBN4-7598-0944-9), it is well known that amino acids are classified in accordance with side chains having similar properties (chemical properties or physical sizes). Also, it is well known that molecular evolutionary substitutions frequently occur between amino acid residues classified as members of a given group while maintaining protein activity. On the basis thereof, the amino acid substitution scoring matrix (BLOSUM) shown in FIG. 2 in Reference Document (2): Henikoff S., Henikoff J. G., Amino-acid substitution matrices from protein blocks, Proc. Natl. Acad. Sci. U.S.A., 89, 10915-10919, 1992 was proposed, and such technique has been extensively employed. Reference Document (2) is based on the finding such that substitution between amino acids having similar side-chain chemical properties would reduce changes in structures and functions occurring throughout a protein. According to Reference Documents (1) and (2), a group of side-chain amino acids to be taken into consideration for multiple alignment can be based on indicators such as chemical properties and physical sizes. According to the scoring matrix (BLOSUM) disclosed in Reference Document (2), such group of side-chain amino acids is indicated as a group of amino acids having a score of 0 or more, and preferably of 1 or more. Examples of representative groups include the 8 groups described below. Amino acids can be classified into more specific groups: for example, a group of amino acids having a score of 0 or more; a group of amino acids having a score of 1 or more; and a group of amino acids having a score of 2 or more.

(35) 1) Group of Aliphatic Hydrophobic Amino Acids (ILMV Group)

(36) This group consists of amino acids comprising aliphatic hydrophobic side chains among the neutral non-polar amino acids described in Reference Document (1); i.e., V (Val, valine), L (Leu, leucine), I (Ile, isoleucine), and M (Met, methionine). Among the amino acids that are classified as the neutral non-polar amino acids according to Reference Document (1), FGACWP are not included in the group of hydrophobic aliphatic amino acids for the following reasons. That is, the size of G (Gly, glycine) or A (Ala, alanine) is less than or equal to that of a methyl group, and the effects of non-polar amino acids are weak. Also, C (Cys, cysteine) occasionally plays a key role in SS bonding, and it forms a hydrogen bond with an oxygen or nitrogen atom. In addition, the side chain molecular weights of F (Phe, phenylalanine) and W (Trp, tryptophane) are particularly high, and the effects of aromatic amino acids are strong. Further, P (Pro, proline) fixes the angle of the polypeptide main chain because of its strong imino acid effects.

(37) 2) Group of Amino Acids Having Hydroxymethylene Groups (ST Group)

(38) This group consists of amino acids having hydroxymethylene groups in the side chains among the neutral polar amino acids; i.e., S (Ser, serine) and T (Thr, threonine). Since sugars bind at the sites of hydroxyl groups existing in the S and T side chains, such sites of hydroxyl groups are often important for a given type of polypeptide (protein) to have particular activity.

(39) 3) Group of Acidic Amino Acids (DE Group)

(40) This group consists of amino acids having acidic carboxyl groups in the side chains; i.e., D (Asp, aspartic acid) and E (Glu, glutamic acid).

(41) 4) Group of Basic Amino Acids (KR Group)

(42) This group consists of basic amino acids; i.e., K (Lys, lysine) and R (Arg, arginine). K and R are positively charged over an extensive pH range and they have basic properties. In contrast, H (His, histidine), classified as a basic amino acid, is not substantially ionized at pH 7, and it is accordingly not classified as a member of this group.

(43) 5) Group of Amino Acids Comprising Methylene Group=Polar Group (DHN Group)

(44) All amino acids classified as members of this group comprise methylene groups bound as side chains to carbon atoms at position a and polar groups at sites closer to the ends thereof. The amino acids of this group are very similar in terms of physical sizes of non-polar methylene groups, and the group consists of N (Asn, asparagine, with the polar group being an amide group), D (Asp, aspartic acid, with the polar group being a carboxyl group), and H (His, histidine, with the polar group being an imidazole group).

(45) 6) Group of Amino Acids Comprising Dimethylene Group=Polar Group (EKQR Group)

(46) All amino acids classified as members of this group comprise linear hydrocarbons equal to or larger than dimethylene groups bound as side chains to carbon atoms at position a and polar groups at sites closer to the ends thereof. The amino acids of this group are very similar in terms of physical sizes of non-polar dimethylene groups, and the group consists of E (Glu, glutamic acid, with the polar group being a carboxyl group), K (Lys, lysine, with the polar group being an amino group), Q (Gln, glutamine, with the polar group being an amide group), and R (Arg, arginine, with the polar groups being imino and amino groups).

(47) 7) Group of Aromatic Amino Acids (FYW Group)

(48) This group consists of aromatic amino acids comprising benzene nuclei in the side chains and having chemical properties peculiar to aromatic amino acids: i.e., F (Phe, phenylalanine), Y (Tyr, tyrosine), and W (Trp, tryptophane).

(49) 8) Group of Cyclic Polar Amino Acids (HY Group)

(50) This group consists of amino acids having both cyclic structures and polar groups in the side chains; i.e., H (H, histidine, with both the cyclic structure and the polar group being imidazole groups) and Y (Tyr, tyrosine, with the cyclic structure being a benzene nucleus and the polar group being a hydroxyl group).

(51) On the basis of the groups of amino acids described above, it can be easily deduced that novel proteins having the same functions are obtained by substituting an amino acid residue in the amino acid sequence of a protein having a given function with another amino acid residue of the same group. On the basis of 1) Group of aliphatic hydrophobic amino acids (ILMV group) above, for example, it can be easily deduced that novel proteins having the same functions are obtained even if an isoleucine residue in the amino acid sequence of a protein having a particular function is substituted with a leucine residue. When there are a plurality of proteins having particular functions, amino acid sequences are occasionally described as consensus sequences. Even in such cases, it can be easily deduced that novel proteins having the same functions are obtained by substituting a particular amino acid residue with another amino acid residue of the same group. When there are a plurality of proteins having particular functions and the amino acid residue in the consensus sequence determined based thereon is isoleucine or leucine (L/I), for example, it can be easily deduced that novel proteins having the same functions are obtained even if the isoleucine or leucine residue is substituted with a methionine or valine residue on the basis of 1) Group of aliphatic hydrophobic amino acids (ILMV group).

(52) Among the acyl-CoA reductase genes shown in Table 1, the gene identified with Gene ID: 100776505 derived from Glycine max (soybean), the gene identified with Gene ID: 100801815 derived from Glycine max (soybean), and the gene identified with Gene ID: 101510781 derived from Cicer arietinum (chickpea) encode acyl-CoA reductases having significantly higher activity for synthesizing an aldehyde compound using acyl-CoA as a substrate than that of other acyl-CoA reductases. FIG. 3 shows the results of alignment analysis of three acyl-CoA reductases encoded by the gene identified with Gene ID: 100776505 derived from Glycine max (soybean), the gene identified with Gene ID: 100801815 derived from Glycine max (soybean), and the gene identified with Gene ID: 101510781 derived from Cicer arietinum (chickpea) using the ClustalW multiple sequence alignment program, which is available on the DDBJ of the National Institute of Genetics (the versions and various parameters employed for analysis are as described above).

(53) As shown in FIG. 3, these 3 highly active acyl-CoA reductases have very similar amino acid sequences. Common sequence 3 can be defined as an amino acid sequence that characterizes such 3 acyl-CoA reductases.

(54) TABLE-US-00004 Commonsequence3: MDAGSLVLSQNGKSQA(E/D)I(L/V)VKDLVPY(D/G)G(P/T)T(0- 2aa)TLIG(V/L)ED(0-1aa)GIGIVKFL(G/R)GKKFFITGATGFLA KV(F/L)IEKILRTEPDVGKMY(L/I)LIKAKN(K/N)Q(A/V)AMERL Q(N/K)EIINT(E/Q)LFRCL(Q/R)(E/Q)IHGKSYQAFMLSKLVP (V/I)VG(N/D)ICE(H/T)NLGLDE(G/D)(I/L)S(D/N)VIA(E/ D)EVDV(I/F)VNSAANTTFDERYDTAININT(I/R)GP(O/S)RLM (N/A)IAKKCKKLKLFLHVSTAYVNGQ(R/K)QGRIMERPFSIG(E/D) CIAREK(YL)IS(E/G)V(S/P)PKYLPTLDIE(G/N)EIN(L/M)V (S/L)(N/K)(Y/N)KG(D/N)(0-1aa)IE(D/E)NLL(A/T)QKM (K/R)E(I/M)GLERA(R/K)RYGWQDTYVFTKAMGEMMIDKLR(G/D) DIPVV(V/I)(M/I)RPSVIEST(F/L)SEPFPGWMEGNRMMDP(I/V) VL(C/W)YGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMA(R/K)HG (V/M)(S/N/I)QK(P/A)DINVYQIASSVVNPL(V/A)FQDL(A/T) RLLYEHYSSSP(C/F)IDS(K/M)GRPIQVP(L/I)MK(L/F)FSS(T/ S)EEFSGHLWRD(A/V)I(Q/N)K(R/S)G(L/I)T(A/S)(V/M)ASS K(G/A)KMSQKLEN(M/I)CRKSVEQAKYLA(N/K)IVEPYTFYGGRFD NSNTQRLME(S/I)MSE(K/E)EK(R/T)EF(G/D)FDVK(S/G)IDW (N/T)DYITNVHIPGLRR(H/Y)VMKGRGM(G/S)(S/N)Q

(55) The amino acid sequence of Common sequence 3 is represented in the same manner as in the cases of Common sequences 1 and 2. In other words, the amino acid sequence of Common sequence 3 comprises the amino acid sequence of SEQ ID NO: 9, a region of 0 to 2 arbitrary amino acid residues, the amino acid sequence of SEQ ID NO: 10, a region of 0 or 1 arbitrary amino acid residues, the amino acid sequence of SEQ ID NO: 11, a region of 0 or 1 arbitrary amino acid residues, and the amino acid sequence of SEQ ID NO: 12 linked in that order from the N terminus to the C terminus.

(56) The amino acid sequence of Common sequence 3 allows an acyl-CoA reductase having particularly high-level activity for synthesizing an aldehyde compound using acyl-CoA as a substrate to be distinguished from an acyl-CoA reductase having no or low-level activity for synthesizing an aldehyde compound using acyl-CoA as a substrate among various types of acyl-CoA reductases.

(57) When an acyl-CoA reductase comprising Common sequence 3 is expressed in a host microorganism, specifically, it reduces acyl-CoA to produce an aldehyde compound with higher efficiency. Thus, an alcohol and/or hydrocarbon can be produced from the aldehyde compound with higher efficiency.

(58) As described above, a nucleic acid encoding an acyl-CoA reductase that can be used in the present invention is not particularly limited, provided that it encodes an acyl-CoA reductase comprising Common sequence 1, 2, or 3. In other words, such nucleic acid is not limited to the acyl-CoA reductase genes specifically exemplified in Table 1, and nucleic acids encoding acyl-CoA reductases derived from plant species that differ from those exemplified in Table 1 are also within the scope of such nucleic acid. For example, a nucleic acid encoding an acyl-CoA reductase derived from a plant species with sequence information that is not stored in GenBank or other databases and comprising Common sequence 1, 2, or 3 can be used.

(59) Specific examples of acyl-CoA reductases that can be used in the present invention include proteins comprising amino acid sequences as shown in any of SEQ ID NOs: 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, and 36 shown in Table 1. A protein comprising an amino acid sequence as shown in any of SEQ ID NO: 14, 16, or 18 is particularly preferable as an acyl-CoA reductase.

(60) Nucleic acids encoding acyl-CoA reductases that can be used in the present invention are not limited to the nucleic acids encoding acyl-CoA reductases identified with particular sequence identification numbers, as described above. Any nucleic acid can be used, provided that it encodes an acyl-CoA reductase comprising Common sequence 1, 2, or 3. A nucleic acid encoding an acyl-CoA reductase has activity such that a protein encoded thereby reduces acyl-CoA and generates an aldehyde compound.

(61) Whether or not an acyl-CoA reductase that can be used in the present invention comprises Common sequence 1, 2, or 3 and whether or not a nucleic acid encoding such protein encodes a protein comprising Common sequence 1, 2, or 3 can be easily determined by comparing the amino acid sequence of the protein of interest or an amino acid sequence encoded by the nucleic acid with the amino acid sequence of Common sequence 1, 2, or 3.

(62) For example, an acyl-CoA reductase comprising an amino acid sequence that is different from the amino acid sequence as shown in any of SEQ ID NOs: 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, and 36 and comprising Common sequence 1, 2, or 3 may encode a protein comprising an amino acid sequence derived from the amino acid sequence as shown in any of SEQ ID NOs: 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, and 36 by deletion, substitution, addition, or insertion of 1 or a plurality of amino acids and comprising Common sequence 1, 2, or 3 and having activity of an acyl-CoA reductase. A plurality of amino acids is, for example, 1 to 20, preferably 1 to 10, more preferably 1 to 7, further preferably 1 to 5, and particularly preferably 1 to 3 amino acids. Amino acid deletion, substitution, or addition can be performed by modifying the nucleotide sequence of the nucleic acid encoding the acyl-CoA reductase in accordance with a technique known in the art. A mutation can be introduced into a nucleotide sequence by conventional techniques, such as the Kunkel method or the Gapped duplex method, or a technique in accordance therewith. For example, a site-directed mutagenesis kit (e.g., Mutant-K or Mutant-G (trade names); manufactured by TAKARA Bio) may be used. Alternatively, a mutation may be introduced using the LA PCR in vitro Mutagenesis Series Kit (trade name: manufactured by TAKARA Bio). Further, mutagenesis may be carried out with the use of a chemical mutagen. Representative examples of chemical mutagens include EMS (ethylmethane sulfonate), 5-bromouracil, 2-aminopurine, hydroxylamine, N-methyl-N-nitro-N-nitrosoguanidine, and other carcinogenic compounds. Also, it may be carried out by radiation application and ultraviolet processing with the use of x rays, rays, rays, rays, or ion beams.

(63) For example, an acyl-CoA reductase comprising an amino acid sequence that is different from the amino acid sequence as shown in any of SEQ ID NOs: 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, and 36 and comprising Common sequence 1, 2, or 3 may encode a protein comprising an amino acid sequence having 70% or higher, preferably 80% or higher, more preferably 90% or higher, and most preferably 95% or higher similarity or identity to the amino acid sequence as shown in any of SEQ ID NOs: 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, and 36 and comprising Common sequence 1, 2, or 3 and having activity of an acyl-CoA reductase. The degree of similarity or identity is determined using a computer program equipped with the basic local alignment search tool (BLAST) program and a database storing gene sequence information by default.

(64) A nucleic acid comprising an amino acid sequence that is different from the amino acid sequence as shown in any of SEQ ID NOs: 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, and 36 and encoding an acyl-CoA reductase comprising Common sequence 1, 2, or 3 can be identified by extracting nucleic acids from a target plant and isolating a nucleic acid hybridizing under stringent conditions to a nucleic acid encoding the amino acid sequence as shown in any of SEQ ID NOs: 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, and 36, when plant genome information is not apparent. Under stringent conditions, namely, a specific hybrid is formed, but a non-specific hybrid is not formed. For example, such conditions comprise hybridization at 45 C. with 6SSC (sodium chloride/sodium citrate), followed by washing at 50 C. to 65 C. with 0.2 to 1SSC and 0.1% SDS. Alternatively, such conditions comprise hybridization at 65 C. to 70 C. with 1SSC, followed by washing at 65 C. to 70 C. with 0.3SSC. Hybridization can be carried out by a conventional technique, such as the method described in J. Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor Laboratory, 1989.

(65) Thus, the acyl-CoA reductase used in the present invention was defined as comprising Common sequence 1, 2, or 3, although it is not limited to a protein comprising Common sequence 1, 2, or 3.

(66) Specifically, an acyl-CoA reductase used in the present invention may encode a protein comprising an amino acid sequence derived from the amino acid sequence as shown in any of SEQ ID NOs: 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, and 36 by deletion, substitution, addition, or insertion of one or a plurality of amino acids and having activity of an acyl-CoA reductase. A plurality of amino acids is, for example, 1 to 20, preferably 1 to 10, more preferably 1 to 7, further preferably 1 to 5, and particularly preferably 1 to 3 amino acids. Amino acid deletion, substitution, or addition can be performed by modifying the nucleotide sequence of the nucleic acid encoding the acyl-CoA reductase in accordance with a technique known in the art. A mutation can be introduced into a nucleotide sequence by the method described above.

(67) An acyl-CoA reductase may encode, for example, a protein comprising an amino acid sequence having 70% or higher, preferably 80% or higher, more preferably 90% or higher, and most preferably 95% or higher similarity or identity to the amino acid sequence as shown in any of SEQ ID NOs: 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, and 36 and having activity of an acyl-CoA reductase. The degree of similarity or identity can be determined by the method described above.

(68) Further, an acyl-CoA reductase may encode a protein encoded by a nucleic acid hybridizing under stringent conditions to, for example, a nucleic acid encoding the amino acid sequence as shown in any of SEQ ID NOs: 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, and 36 and having acyl-CoA reductase. Stringent conditions are as described above.

(69) Whether or not a nucleic acid comprising a particular nucleotide sequence encodes the acyl-CoA reductase can be determined by preparing an expression vector comprising the nucleic acid incorporated into a site between an adequate promoter and a terminator, transforming an adequate host using the prepared expression vector, and assaying the acyl-CoA reductase activity of the protein expressed. Acyl-CoA reductase activity can be assayed by culturing the transformant in a medium containing a carbon source and analyzing the synthesized aldehyde compound or an alcohol derived from the aldehyde compound via gas chromatography, mass analysis, or other means. When culturing the transformant, acyl-CoA may be added to the medium.

(70) [Expression Vector and Host Microorganism]

(71) The nucleic acid encoding the acyl-CoA reductase described above is incorporated into an adequate expression vector and it is then introduced into a host microorganism. A host microorganism is not particularly limited, provided that it is capable of expressing an acyl-CoA reductase. Examples of host microorganisms include: bacteria of Escherichia such as Escherichia coli, Corynebacterium such as Corynebacterium glutamicum, Bacillus such as Bacillus subtilis, Pseudomonas such as Pseudomonas putida, and Rhizobium such as Rhizobium meliloti; and fungi including yeast and filamentous fungi, such as Saccharomyces cerevisiae, Schizosaccharomyces pombe, and Pichia pastoris.

(72) When bacteria such as Escherichia coli are used for host microorganisms, it is preferable that an expression vector be capable of autonomous replication in such bacteria and be composed of a promoter, a ribosome binding sequence, the gene(s) described above, and a transcription terminator sequence. Also, an expression vector may comprise a gene that regulates promoter activity.

(73) Any Escherichia coli strains that have heretofore been known can be used, and examples thereof include the Escherichia coli BL21 (DE3) strain, K12 strain, DH1 strain, and JM109 strain. As Escherichia coli strains, in particular, the K12 strains and strains prepared therefromthat is, so-called K strainscan be used. An example of the Bacillus subtilis strain is the Bacillus subtilis 168 strain.

(74) Any promoter can be used, provided that it allows a gene of interest to be expressed in a host such as Escherichia coli. Examples thereof include Escherichia coli-derived promoters, such as trp promoters, lac promoters, PL promoters, and PR promoters, and phage-derived promoters, such as T7 promoters. Artificially designed and/or modified promoters, such as tac promoters, may also be used.

(75) An expression vector can be introduced by any method, provided that such method is intended to introduce DNA into bacteria. Examples thereof include a method involving the use of calcium ions (Cohen, S. N. et al., Proc. Natl. Acad. Sci., U.S.A., 69: 2110-2114, 1972) and electroporation.

(76) Examples of yeast strains that can be used for host microorganisms include, but are not particularly limited to, Candida yeast strains, such as Candida Shehatae, Pichia yeast strains, such as Pichia stipites, Pachysolen yeast strains, such as Pachysolen tannophilus, Saccharomyces yeast strains, such as Saccharomyces cerevisiae, and Schizosaccharomyces yeast strains, such as Schizosaccharomyces pombe, with Saccharomyces cerevisiae being particularly preferable.

(77) When the expression level of the acyl-CoA reductase is to be enhanced, an adequate promoter with high transcriptional activity is used. Examples of promoters that can be used include, but are not particularly limited to, glyceraldehyde-3-phosphate dehydrogenase gene (TDH3) promoters, 3-phosphoglycerate kinase gene (PGK1) promoters, and hyperosmolarity-responsive 7 gene (HOR7) promoters. Pyruvate decarboxylase gene (PDC1) promoters are particularly preferable because of their high capacity for enhancing the expression level of the target downstream genes. Also, gall promoters, gal10 promoters, heat shock protein promoters, MF1 promoters, PHO5 promoters, GAP promoters, ADH promoters, or AOX1 promoters may be used, so that the expression level of the downstream genes can be enhanced.

(78) As methods for introducing the genes described above, any conventional techniques that are known as yeast transformation techniques can be employed. Specific examples include, but are not limited to, the electroporation method (Meth. Enzym., 194, p. 182, 1990), the spheroplast method (Proc. Natl. Acad. Sci., U.S.A., 75, p. 1929, 1978), the lithium acetate method (J. Bacteriology, 153, p. 163, 1983), and methods described in Proc. Natl. Acad. Sci., U.S.A., 75, p. 1929, 1978 and Methods in Yeast Genetics, 2000 Edition: A Cold Spring Harbor Laboratory Course Manual.

(79) The nucleic acid encoding the acyl-CoA reductase is preferably introduced into a microorganism capable of hydrocarbon synthesis with the use of an aldehyde compound as a substrate. In such a case, a recombinant microorganism expressing the acyl-CoA reductase can produce a hydrocarbon from an aldehyde compound with high efficiency. For example, a nucleic acid encoding an enzyme having decarbonylase activity (i.e., a decarbonylase) may be introduced into the microorganism, and a recombinant microorganism capable of hydrocarbon synthesis from an aldehyde compound can then be produced. The recombinant microorganism thus obtained or a microorganism that inherently has decarbonylase activity may be used as a host, the acyl-CoA reductase may be introduced into such host, and hydrocarbon synthesis can then be carried out with very high efficiency.

(80) Enzymes having decarbonylase activity are not particularly limited, and conventional enzymes can be used. For example, WO 2006/109558 discloses a method in which novel microalgae, Pseudochoricystis ellipsoidea, capable of hydrocarbon production or microalgae of Pseudochoricystis or Choricystis capable of hydrocarbon production are cultured and a hydrocarbon is collected from the culture product. A nucleic acid encoding an enzyme having decarbonylase activity can be isolated from such an organism and used. Also, the gene converting an aldehyde into an alkane disclosed in JP 2010-528627 A and the alkane synthase gene or the aldehyde synthase gene derived from Synechococcus elongatus disclosed in JP 2011-520455 A can be used. In addition, a gene encoding a protein involved with aliphatic aldehyde decarbonylase activity derived from Arabidopsis thaliana disclosed in JP H09-322780 A (1997) can be used.

(81) Further, WO 2013/129393 discloses a hydrocarbon synthase gene encoding an enzyme comprising a given motif sequence and having decarbonylase activity. With the use of the hydrocarbon synthase gene disclosed in WO 2013/129393, hydrocarbons as described above can be produced with high efficiency.

(82) A recombinant microorganism that comprises an introduced nucleic acid encoding decarbonylase (e.g., recombinant Escherichia coli or recombinant yeast) would be capable of synthesizing a hydrocarbon from an aldehyde compound in the presence of an aldehyde compound and a coenzyme, such as NADH, through the expression of the decarbonylase.

(83) Examples of hydrocarbons that can be synthesized include a hydrocarbon having a chain structure (i.e., a chain hydrocarbon) and a hydrocarbon having a cyclic structure (i.e., a cyclic hydrocarbon). A chain hydrocarbon may have one or more branches. Examples of branches include alkyl groups, such as methyl, ethyl, propyl, and butyl (including tert-butyl) groups, alkynyl groups, and alkenyl groups. Further examples of branches include chloromethyl, acetyl, 2-pyridyl, hydroxyphenyl, aminoacetyl, methoxy, phenoxy, methylthio, and phenylthio groups. Also, hydrocarbons to be synthesized may be saturated hydrocarbons (alkane) or unsaturated hydrocarbons (alkene and alkyne).

(84) It is preferable that a hydrocarbon to be synthesized have about 5 to 20 carbon atoms, which is liquid at room temperature, although the number of carbon atoms is not limited thereto. A hydrocarbon to be synthesized is preferably a saturated hydrocarbon having 10 to 20 carbon atoms, more preferably 12 to 14 carbon atoms, and most preferably 13 carbon atoms, from the viewpoint of the application thereof for a diesel fuel. Specific examples of hydrocarbons to be synthesized include dodecane having 12 carbon atoms, tridecane having 13 carbon atoms, and tetradecane having 14 carbon atoms.

(85) [Method for Substance Production]

(86) As described above, the recombinant microorganism according to the present invention has excellent activity for synthesizing an aldehyde compound using acyl-CoA as a substrate. With the use of the recombinant microorganism according to the present invention, therefore, at least one compound selected from the group consisting of an aldehyde compound and an alcohol and a hydrocarbon synthesized from an aldehyde compound can be produced.

(87) For example, the recombinant microorganism according to the present invention is cultured in a medium containing a carbon source, such as glucose, fructose, galactose, mannose, xylose, xylulose, ribose, erythrose, threose, erythrulose, glyceraldehyde, dihydroxyacetone, sucrose (saccharose), lactose, maltose, trehalose, or cellobiose. Thus, a target substance, such as the aldehyde compound, alcohol, or hydrocarbon as described above, can be produced.

(88) The recombinant microorganism according to the present invention can also be used for a method for producing a target substance in vitro. For example, the recombinant microorganism according to the present invention is ground, the resulting solution containing the ground microorganism is used, and a target substance can then be synthesized in vitro. Specifically, acyl-CoA (a coenzyme such as NADH, if necessary) is added as a substrate to the solution, and a target substance can then be synthesized in vitro.

(89) A target substance, such as a synthesized hydrocarbon, can be isolated in accordance with a conventional technique. For example, the recombinant yeast is cultured in a medium to produce a hydrocarbon. Since a hydrocarbon is synthesized in a medium, strains are separated from the medium via centrifugation or other means, and the target substance can then be isolated from the supernatant fraction. A hydrocarbon can be isolated from the supernatant fraction by, for example, adding an organic solvent, such as ethyl acetate or methanol, to the supernatant fraction and thoroughly agitating the solution. The aqueous phase is separated from the solvent phase, and a hydrocarbon can be extracted from the solvent phase.

EXAMPLES

(90) Hereafter, the present invention is described in greater detail with reference to examples, although the technical scope of the present invention is not limited to these examples.

Example 1

(91) In this example, an expression vector comprising the aldehyde decarbonylase gene (Gene ID: Npun R1711) derived from Nostoc punctiform and expression vectors comprising acyl-CoA reductase genes derived from various plant species were introduced into Escherichia coli strains, and the alkane productivity of the resulting recombinant Escherichia coli strains was evaluated. Table 2 shows the acyl-CoA reductase genes used in this example.

(92) TABLE-US-00005 TABLE 2 Nucleotide Amino acid No. Gene ID Gene origin sequence sequence Transformant 1 AT4G33790 Arabidopsis thaliana SEQ ID NO: 37 SEQ ID NO: 38 At1 strain 2 AT3G56700 SEQ ID NO: 39 SEQ ID NO: 40 At2 strain 3 AT3G44560 SEQ ID NO: 41 SEQ ID NO: 42 At3 strain 4 101311020 Fragaria vesca (woodland strawberry) SEQ ID NO: 20 Fv1 strain 5 101314821 SEQ ID NO: 43 SEQ ID NO: 44 Fv2 strain 6 101314535 SEQ ID NO: 45 SEQ ID NO: 46 Fv3 strain 7 100776505 Glycine max (soybean) SEQ ID NO: 13 SEQ ID NO: 14 Gm1 strain 8 100801815 SEQ ID NO: 15 SEQ ID NO: 16 Gm2 strain 9 POPTR_576417 Populus trichocarpa (black cottonwood) SEQ ID NO: 21 SEQ ID NO: 22 Pt1 strain 10 101250126 Solanum lycopersicum (tomato) SEQ ID NO: 47 SEQ ID NO: 48 Sl1 strain 11 101255461 SEQ ID NO: 49 SEQ ID NO: 50 Sl2 strain 12 RCOM_0791890 Ricinus communis (castor bean) SEQ ID NO: 51 SEQ ID NO: 52 Rc1 strain 13 RCOM_1279610 SEQ ID NO: 53 SEQ ID NO: 54 Rc2 strain 14 100245182 Vitis vinifera (wine grape) SEQ ID NO: 23 SEQ ID NO: 24 Vv1 strain 15 100242978 SEQ ID NO: 55 SEQ ID NO: 56 Vv2 strain 16 100265271 SEQ ID NO: 57 SEQ ID NO: 58 Vv3 strain 17 100259719 SEQ ID NO: 59 SEQ ID NO: 60 Vv4 strain 18 100254606 SEQ ID NO: 61 SEQ ID NO: 62 Vv5 strain 19 67420 Mus musculus SEQ ID NO: 63 SEQ ID NO: 64 Mm1 strain 20 330450 SEQ ID NO: 65 SEQ ID NO: 66 Mm2 strain 21 101510781 Cicer arietinum (chickpea) SEQ ID NO: 17 SEQ ID NO: 18 Ca1 strain 22 101262598 Solanum lycopersicum (tomato) SEQ ID NO: 25 SEQ ID NO: 26 Sl3 strain 23 101212401 Cucumis sativus (cucumber) SEQ ID NO: 27 SEQ ID NO: 28 Cc1 strain 24 100845156 Brachypodium distachyon SEQ ID NO: 29 SEQ ID NO: 30 Bd1 strain 25 101779750 Setaria italica (foxtail millet) SEQ ID NO: 31 SEQ ID NO: 32 Si1 strain 26 SORBI_01g046030 Sorghum bicolor (sorghum) SEQ ID NO: 33 SEQ ID NO: 34 Sb1 strain 27 Os03t0167600-01 Oryza sativa japonica (Japanese rice) SEQ ID NO: 35 SEQ ID NO: 36 Os1 strain

(93) The acyl-CoA reductase genes and the aldehyde decarbonylase genes used in this example were artificially synthesized on the basis of the nucleotide sequence information stored in the database. SEQ ID NOs: 67 and 68 show the nucleotide sequence and the amino acid sequence of the aldehyde decarbonylase gene (Gene ID: Npun R1711), respectively.

(94) The artificially synthesized acyl-CoA reductase gene was inserted into the NdeI-XhoI site of the pCDFDuet-1 vector (Novagen), and the artificially synthesized aldehyde decarbonylase gene was inserted into the PstI site of the pRSFDuet-1 vector (Novagen) (see FIG. 4). When artificially synthesizing the acyl-CoA reductase gene, the sequence: TACCATGGGCATACATATGGCCATCATAACGGTTCTGGCAAATATTCTGAAATGA GCTGTTGACAATTAATCATCGGCTCGTATAATGTGTGGAATTGTGAGCGGATAAC AATTTCACACAAGGAGATATACG (SEQ ID NO: 69) comprising the NdeI recognition sequence was added to the 5 terminus, and the sequence: TAATTAACCTAGGCTGCTGCCACCGCTGAGCAATAACTAGCATAACCCCTTGGGG CCTCTAAACGGGTCTTGAGGGGTTTTTTGCCCTCGAGTCCGGCCGCATGCGGCCGCAT (SEQ ID NO: 19) comprising the XhoI recognition sequence was added to the 3 terminus.

(95) Subsequently, the two types of prepared expression vectors were transformed into the E. coli BL21 (DE3) strain. Transformation was carried out by preparing E. coli BL21 (DE3) competent cells with reference to User Protocol TB009 Rev. F0104 (Novagen).

(96) Subsequently, the resulting transformant was subjected to shake culture in 0.5 ml of LB medium, which contains 30 mg/ml streptomycin and 50 mg/ml kanamycin, at 37 C. and 130 rpm overnight. The culture solution was inoculated into 2 ml of M9 medium, which contains 2% glucose, 0.1% yeast extract, 30 mg/ml streptomycin, and 50 mg/ml kanamycin, to an amount of 1% therein by volume, and shake culture was conducted at 37 C. and 130 rpm for about 4 hours (final absorption: OD 600 of 0.4 to 0.6). Isopropyl -D-1-thiogalactopyranoside (IPTG) was added to the culture solution to a final concentration of 1 mM therein, and culture was conducted at 37 C. and 130 rpm for 3 days.

(97) The culture solution (1 ml) was sampled in a 1.5-ml Eppendorf tube, the bacterial strains were collected using a centrifuge (6,000 rpm, 1 minute, room temperature), and the supernatant was removed. Ethyl acetate (100 ml) was added to the pellets, and a suspension was prepared via vortex for about 1 minute. The resultant was centrifuged at 10,000 rpm for 1 minute at room temperature, and the resulting supernatant was then subjected to GC/MS analysis. The conditions for GC/MS analysis are shown in Table 3.

(98) TABLE-US-00006 TABLE 3 [GC/MS analysis conditions] Column: HP-5MS (Agilent: 19091S-433) Inlet temperature: 260 C. Detector temperature: 260 C. Split ratio: 1/20 Carrier gas: He 1.0 ml/min Oven heating conditions 60 C., 1 min Raised to 260 C. at 50 C./min 260 C., 1 min

(99) FIG. 5 shows the results of quantitative GC/MS analysis of tridecane and pentadecane of the 27 types of recombinant Escherichia coli strains prepared in this example, and FIG. 6 shows the results of quantitative GC/MS analysis of tetradecanol and hexadecanol thereof. FIG. 7 shows a chart showing the results of GC/MS analysis of the Gm2 strain among the 27 types of recombinant Escherichia coli strains. Table 4 shows a summary of the results of quantification shown in FIGS. 5 and 6.

(100) TABLE-US-00007 TABLE 4 Concentration(mg/L) Tridecane Pentadecane Tetradecanol Hexadecanol 1 At1 strain 0.0 0.0 0.0 0.0 2 At2 strain 0.0 0.0 0.0 0.0 3 At3 strain 0.0 0.0 0.0 0.0 4 Fv1 strain 1.3 3.4 5.0 40.2 5 Fv2 strain 0.0 0.0 0.0 0.0 6 Fv3 strain 0.0 0.0 0.0 0.0 7 Gm1 strain 2.1 3.8 74.9 207.3 8 Gm2 strain 3.6 9.9 49.7 158.3 9 Pt1 strain 0.5 2.5 2.1 35.5 10 Sl1 strain 0.0 0.0 0.0 0.0 11 Sl2 strain 0.0 0.0 0.0 0.0 12 Rc1 strain 0.0 0.0 0.0 0.0 13 Rc2 strain 0.0 0.0 0.0 0.0 14 Vv1 strain 1.2 2.4 65.6 42.8 15 Vv2 strain 0.0 0.0 0.0 0.0 16 Vv3 strain 0.0 0.0 0.0 0.0 17 Vv4 strain 0.0 0.0 0.0 0.0 18 Vv5 strain 0.0 0.0 0.0 0.0 19 Mm1 strain 0.0 0.0 0.0 0.0 20 Mm2 strain 0.0 0.0 0.0 0.0 21 Ca1 strain 1.8 9.4 68.9 180.1 22 Sl3 strain 0.6 4.7 11.0 76.4 23 Cc1 strain 0.2 6.1 6.3 27.6 24 Bd1 strain 0.1 5.9 0.8 5.3 25 Si1 strain 0.1 2.5 0.9 8.4 26 Sb1 strain 0.2 5.9 1.2 21.5 27 Os1 strain 0.0 0.8 0.0 1.0

(101) On the basis of the results shown in FIGS. 5 and 6 and Table 4, 12 types of recombinant Escherichia coli strains: i.e., the Fv1 strain, the Gm1 strain, the Gm2 strain, the Pt1 strain, the Vv1 strain, the Cal strain, the Sl3 strain, the Cc1 strain, the Bd1 strain, the Si1 strain, the Sb1 strain, and the Os1 strain, were found to have got alcohol and alkane production capacity. The results demonstrate that these 12 types of recombinant Escherichia coli strains had achieved the capacity to produce an aldehyde compound from acyl-CoA upon introduction of the acyl-CoA reductase gene. In other words, the acyl-CoA reductase genes in these 12 types of recombinant Escherichia coli strains were found to encode acyl-CoA reductases having activity for reducing acyl-CoA to generate an aldehyde compound in the host microorganisms.

(102) In this example, more specifically, the gene identified with Gene ID: 101311020 derived from Fragaria vesca (woodland strawberry), the gene identified with Gene ID: 100776505 derived from Glycine max (soybean), the gene identified with Gene ID: 100801815 derived from Glycine max (soybean), the gene identified with Gene ID: POPTR_576417 derived from Populus trichocarpa (black cottonwood), the gene identified with Gene ID: 100245182 derived from Vitis vinifera (wine grape), the gene identified with Gene ID: 101510781 derived from Cicer arietinum (chickpea), the gene identified with Gene ID: 101262598 derived from Solanum lycopersicum (tomato), the gene identified with Gene ID: 101212401 derived from Cucumis sativus (cucumber), the gene identified with Gene ID: 100845156 derived from Brachypodium distachyon, the gene identified with Gene ID: 101779750 derived from Setaria italica (foxtail millet), the gene identified with Gene ID: SORBI_01g046030 derived from Sorghum bicolor (sorghum), and the gene identified with Gene ID: Os03t0167600-01 derived from Oryza sativa japonica (Japanese rice) were found to encode acyl-CoA reductases having activity for reducing acyl-CoA to generate an aldehyde compound in the host microorganisms. Common sequences 1 and 2 characterize the acyl-CoA reductases encoded by these 12 types of genes.

(103) In particular, the results shown in FIGS. 5 and 6 and Table 4 demonstrate that the gene identified with Gene ID: 100776505 derived from Glycine max (soybean), the gene identified with Gene ID: 100801815 derived from Glycine max (soybean), and the gene identified with Gene ID: 101510781 derived from Cicer arietinum (chickpea) encode acyl-CoA reductases having the above-described activity, which is particularly remarkable. Common sequence 3 characterizes the acyl-CoA reductases encoded by these 3 types of genes.

(104) All publications, patents, and patent applications cited herein are incorporated herein by reference in their entirety.