ENGINEERED TARGET SPECIFIC NUCLEASES

20190241877 ยท 2019-08-08

    Inventors

    Cpc classification

    International classification

    Abstract

    Described herein are engineered nucleases comprising mutations in the cleavage domain (e.g., FokI or homologue thereof) and/or DNA binding domain (zinc finger protein, TALE, single guide RNA) such that on-target specificity is increased.

    Claims

    1. A zinc finger nuclease (ZFN) comprising first and second ZFNs, the first ZFN comprising the ZFN designated 71557 and the second ZFN comprising the ZFN designated 71728.

    2. One or more polynucleotides encoding the first and second ZFNs of claim 1.

    3. The one or more polynucleotides of claim 2, wherein a first polynucleotide encoding the first ZFN comprises an AAV vector comprising the sequences as shown in Table 4 and a second polynucleotide encoding the second ZFN comprises an AAV vector comprising the sequences as shown in Table 5.

    4. An AAV vector of claim 3, wherein the AAV vector encoding the first ZFN comprises the sequence shown in SEQ ID NO:43.

    5. The AAV vector of claim 3, wherein the AAV vector encoding the second ZFN comprises the sequence shown in SEQ ID NO:56.

    6. A cell comprising the one or more polynucleotides of claim 3.

    7. The cell of claim 6, wherein the cell is a liver cell, a stem cell or a precursor cell.

    8. A pharmaceutical composition comprising the one or more polynucleotides claim 3.

    9. A method of cleaving an endogenous albumin gene in a cell of a subject, the method comprising administering the one or more polynucleotides of claim 3 to the subject.

    10. The method of claim 9, further comprising administering a donor sequence to the subject such that the donor is integrated into the cleavage albumin gene.

    11. A kit comprising the one or more polynucleotides of claim 3.

    12. A composition comprising: (a) a first polynucleotide encoding a first ZFN designated 71557; (b) a second polynucleotide encoding a second ZFN designated 71728, the second polynucleotide optionally comprising an AAV vector comprising the sequences as shown in Table 5 or SEQ ID NO:56; and (c) a donor polynucleotide comprising a sequence encoding a Factor IX (FIX) sequence.

    13. The composition of claim 12, wherein (a) the first polynucleotide is an AAV vector comprising the sequences as shown in Table 4 or the sequence as shown in SEQ ID NO:43; (b) the second polynucleotide is an AAV vector comprising the sequences as shown in Table 5 or the sequence as shown in SEQ ID NO:56; and/or (c) the donor polynucleotide is an AAV vector comprising the sequences as shown in Table 6 or a sequence as shown in SEQ ID NO:59.

    14. The composition of claim 13, wherein the first, second and donor polynucleotides are carried on separate AAV vectors.

    15. A method of expressing a FIX protein in a subject in need thereof, the method comprising administering the composition of claim 12 to the subject such that that the FIX protein is expressed in the cell.

    16. A method of expressing a FIX protein in a subject in need thereof, the method comprising administering the composition of claim 13 to the subject such that that the FIX protein is expressed in the cell.

    17. A method of expressing a FIX protein in a subject in need thereof, the method comprising administering the composition of claim 14 to the subject such that that the FIX protein is expressed in the cell.

    18. The method of claim 15, wherein the subject has a hemophilia and expression of the FIX protein treats and/or prevents the disease.

    19. A kit comprising one or more compositions of any of claim 12.

    20. A composition comprising: (a) a first polynucleotide encoding a first ZFN designated 71557; (b) a second polynucleotide encoding a second ZFN designated 71728; and (c) a donor polynucleotide comprising a sequence encoding an iduronate-2-sulfatase (IDS) sequence.

    21. The composition of claim 20, wherein (a) the first polynucleotide is an AAV vector comprising the sequences as shown in Table 4 or the sequence as shown in SEQ ID NO:43; (b) the second polynucleotide is an AAV vector comprising the sequences as shown in Table 5 or the sequence as shown in SEQ ID NO:56; and/or (c) the donor polynucleotide is an AAV vector comprising the sequences as shown in Table 7 or the sequence as shown in SEQ ID NO:65.

    22. The composition of claim 21, wherein the first, second and donor polynucleotides are carried on separate AAV vectors.

    23. A method of expressing an IDS protein in a subject in need thereof, the method comprising administering one or more compositions of claim 20 to the subject such that that the IDS protein is expressed in the cell.

    24. A method of expressing an IDS protein in a subject in need thereof, the method comprising administering one or more compositions of claim 21 to the subject such that that the IDS protein is expressed in the cell.

    25. A method of expressing an IDS protein in a subject in need thereof, the method comprising administering one or more compositions of claim 22 to the subject such that that the IDS protein is expressed in the cell.

    26. The method of claim 23, wherein the subject has MPS II disease and expression of the IDS protein treats and/or prevents the disease.

    27. A kit comprising one or more compositions of claim 20.

    28. A composition comprising: (a) a first polynucleotide encoding a first ZFN designated 71557; (b) a second polynucleotide encoding a second ZFN designated 71728; and (c) a donor polynucleotide comprising a sequence encoding an alpha-L iduronidase (IDUA) sequence.

    29. The composition of claim 28, wherein (a) the first polynucleotide is an AAV vector comprising the sequences as shown in Table 4 or the sequence as shown in SEQ ID NO:43; (b) the second polynucleotide is an AAV vector comprising the sequences as shown in Table 5 or the sequence as shown in SEQ ID NO:56; and/or (c) the donor polynucleotide is an AAV vector the sequences as shown in Table 8 or the sequence as shown in SEQ ID NO:72.

    30. The composition of claim 29, wherein the first, second and donor polynucleotides are carried on separate AAV vectors.

    31. A method of expressing an IDUA protein in a subject in need thereof, the method comprising administering one or more compositions of claim 28 to the subject such that that the IDUA protein is expressed in the cell.

    32. A method of expressing an IDUA protein in a subject in need thereof, the method comprising administering one or more compositions of claim 29 to the subject such that that the IDUA protein is expressed in the cell.

    33. A method of expressing an IDUA protein in a subject in need thereof, the method comprising administering one or more compositions of claim 30 to the subject such that that the IDUA protein is expressed in the cell.

    34. The method of claim 31, wherein the subject has MPS I disease and expression of the IDUA protein treats and/or prevents the disease.

    35. A kit comprising one or more compositions of claim 28.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0048] FIGS. 1A and 1B depict partial sequence of a human albumin genomic sequence (SEQ ID NO:41) and show the binding sites of exemplary ZFNs 47171-FLAG and 47898-FLAG (target sites shown by underline or overline). FIG. 1A also shows (boxed) a single nucleotide polymorphism (SNP) from A/T to G/C that occurs in approximately 20% of individuals. FIG. 1B is a schematic depicting the manner in which the left and right ZFNs associate with the target albumin sequences.

    [0049] FIG. 2 is a graph showing genomic modifications (% indels) by the indicated exemplary nucleases and the indicated doses. The left bar under each condition shows modification of the wild-type A/T sequence and the right bar shows modification of the G/C SNP.

    [0050] FIGS. 3A through 3H show exemplary results of genomic modifications using ZFN-encoding vectors as described herein. FIG. 3A shows results of modifications (at the intended target (albumin) as compared to modifications of an off-target site (SMCHD1) under the indicated conditions using exemplary artificial nucleases as described herein (modifications indicated in name) as compared to nucleases not including the modifications described herein (parent). As shown, the nucleases described herein exhibit increased activity and specificity as compared to the parent nucleases. FIG. 3B shows cleavage activity (% indels as measured by deep sequencing of using the indicated parent or optimized ZFNs at the indicated dosages for the intended target (albuminon target) (2000 ng, 62.5 ng, 31.3 ng, 15.6 ng) or for the off-target sites (off-target) (2000 ng). The engineered FokI domain N159D shown in the Figure is also referred to as N542D and the FokI domain designated P95S is also referred to as P478S. FIG. 3B also shows a schematic of the ZFN expression cassette with the modifications made in the improved versions. FIG. 3C shows results of activity (cleavage activity as shown by % indels and targeted integration designated capture events) at the indicated on-target site (albumin) and off-target sites (rows 1 to 26) in K562 and HepG2 cells treated with the ZFNs described herein. ns refers to not significant; ns* refers to indels not consistent with ZFN cleavage; refers to indels consistent with ZFN cleavage and a non-significant p-value; and ND refers to no data. FIG. 3D is a graph showing cleavage (% indels) at the indicated dosages of albumin ZFNs carried by AAV vectors and AAV donors carrying an IDS transgene (low=30/240 ZFN/Donor MOI; mid=100/800 ZFN/Donor MOI; and high=300/2400 ZFN/Donor MOI) using parent 47171/47898 ZFN pair (ZFN Std the left bars of each condition) or optimized 71557/71728 ZFN pair (ZFN 2.0 the right bars of each condition). The 71557/71728 ZFN-encoding AAV constructs used in this experiment included the 5 -globin untranslated region (UTR), 3 FLAG and Woodchuck Hepatitis Virus (WHV) Post-transcriptional Regulatory Element mutant 6 (WPREmut6). FIG. 3E(i) is a graph showing activity of the protein encoded by the donor transgene (IDS) at the indicated dosages of albumin ZFNs carried by AAV vectors and AAV donors carrying an IDS transgene (low=30/240 ZFN/Donor MOI; mid=100/800 ZFN/Donor MOI; and high=300/2400 ZFN/Donor MOI) using parent (ZFN Std the left bars of each condition) or optimized ZFNs (ZFN 2.0 the right bars of each condition). FIG. 3E(ii) is a graph showing IDS activity at the indicated dosages. From left to right under each condition are shown (left to right): standard ZFN at day 5; standard ZFN at day 7; ZFN 2.0 at day 5 and ZFN 2.0 at day 7. FIGS. 3F(i) and 3F(ii) depict the results from a comparison of the 47171/47898 pair and the 71557/47898 pair. The indicated amount of ZFN-encoding mRNA was transfected in triplicate into primary human hepatocytes that are heterozygous for the WT (A:T) and SNP (G:C)-containing ZFN target sites. The 71557 ZFN-encoding mRNA used in this experiment included the 5 -globin untranslated region (UTR) and Woodchuck Hepatitis Virus (WHV) Post-transcriptional Regulatory Element (WPRE). Levels of ZFN activity were determined 24-hr post-transfection by deep-sequencing. FIG. 3F(i) shows ZFN activity (presented as % indels) at the A:T WT allele (dark gray) and G:C SNP allele (light gray) target site. FIG. 3F(ii) shows the ratio of ZFN activity at the A:T WT allele target site versus the G:C SNP allele target site, where a value of 1.0 indicates equal cutting at each allele (47171/47898 ZFN pair in light gray, 71557/47898 ZFN pair in dark gray). FIG. 3G is a graph depicting the cleavage kinetics in primary human hepatocytes of the 47171/47898 and 71557/71728 ZFN pairs, wherein the ZFNs were delivered to the cells by AAV. The 71557/71728 ZFN-encoding AAV constructs used in this experiment included the 5 -globin untranslated region (UTR), 3 FLAG and Woodchuck Hepatitis Virus (WHV) Post-transcriptional Regulatory Element mutant 6 (WPREmut6). FIG. 3H shows a comparison of on-target and off-target cleavage data for the 47171/47898 and 71557/71728 ZFN pairs in primary human hepatocytes. The 71557/71728 ZFN-encoding AAV constructs used in this experiment included the 5 -globin untranslated region (UTR), 3 FLAG and Woodchuck Hepatitis Virus (WHV) Post-transcriptional Regulatory Element mutant 6 (WPREmut6). The top row shows activity of the 71557/71728 ZFN pair on the albumin locus and the SMCHD1 locus at MOI concentrations from 3K to 600K. Also indicated on the left graph at the top is the expected clinical dose range. Human primary hepatocytes transduced with AAV2/6 encoding second generation ZFNs were evaluated by MiSeq deep sequencing. NSnot statistically significant by two tailed t-test, * p-value<0.05 by two tailed t-test. The bottom row shows a blow up of the 100 K and 600K MOI doses for both the first and second generation ZFN pair against the albumin locus compared with a separate experiment against the SMCHD1 locus. At the 100K MOI dose, the first generation ZFNs showed mean on-target activity of 17% indels and off-target activity of 0.11% indels and second generation ZFNs showed mean on-target activity of 35% and off-target activity of 0.08%. Comparing the two on-target to off-target ratios, second generation ZFNs are 2.8-fold more selective than first generation ZFNs. At the 600K MOI dose, the first generation ZFNs showed mean on-target activity of 25% indels and off-target activity of 0.36% indels; and second generation ZFNs showed mean on-target activity of 44% and off-target activity of 0.34%. Comparing the two ratios, second generation ZFNs are 1.9-fold more selective than first generation ZFNs. At the 100K and 600K MOI, % indels for the 47171/47898 and 71557/71728 ZFN pairs are 17% and 35%, and 25% and 44%, respectively, suggesting that the 71557/71728 ZFN pair is 2-fold more potent than the 47171/47898 ZFN pair.

    [0051] FIGS. 4A through 4C show increased nuclease activity (% indels, as determined by next generation sequencing) when the nucleases are expressed from polynucleotides further comprising one or more FLAG sequences. FIG. 4A is a graph showing activity (% indels) following introduction of polynucleotides encoding the artificial nuclease with (y-axis) or without (x-axis) a 3 FLAG sequence. Data points to the left of the diagonal line indicate where 3 FLAG was beneficial to nuclease activity as compared to data points to the right of the line which indicate where 3 FLAG sequences were detrimental. FIG. 4B shows the increased activity averaged over 4-fold as compared to polynucleotides without FLAG sequences. FIG. 4C is a graph showing nuclease activity (% indels, as determined by deep sequencing) in K562 cells transfected at the indicated mRNA amounts with mRNA encoding albumin-targeting ZFNs with (light shaded circles shown as +Peptide) or without (dark shaded circles shown as No Peptide) a FLAG peptide. Cells were assessed for ZFN activity 24 hours after transfection. The numbers above the light shaded circles (mRNA including the 5 peptide) indicate the fold increase as compared to mRNA without the 5 peptide.

    [0052] FIGS. 5A through 5C are graphs depicting increased nuclease activity (% indels, as determined by next generation sequencing) when the nucleases are expressed from polynucleotides further comprising modified 3 UTRs (e.g., WPRE sequences) as compared to unmodified 3 UTRs. FIG. 5A shows increased cleavage activity in isolated cells when the polynucleotide (mRNA) encoding the artificial nuclease included a WPRE in the 3 UTR. FIG. 5B showed increased activity using WPRE-including ZFNs in vivo (in mouse liver) following administration of the indicated mRNAs (using LNPs) to the mouse. FIG. 5B showed increased cleavage activity using WPRE-including ZFNs in vivo (in mouse liver) following administration of the indicated AAVs to the mouse.

    [0053] FIG. 6 is a graph showing increased nuclease activity (% indels, as determined by next generation sequencing) using the indicated combinations of polynucleotide components at the indicated MOIs. The left-most bar (standard) under each condition shows results where the nuclease-encoding polynucleotide did not include 3 FLAG, a WPRE sequence or a poly A sequence. The bar second from the left (3 Flag, WPRE) shows results where the nuclease-encoding polynucleotide included a 3 FLAG peptide sequence and a WPRE sequence. The bar second from the right (5XBG, WPRE) shows results where the nuclease-encoding polynucleotide included a bovine growth hormone (BG) poly A sequence and a WPRE sequence. The right-most bar (SXBG, 3 FLAG, WPRE) shows results where the nuclease-encoding polynucleotide included a BG poly A sequence, a 3 FLAG peptide sequence and a WPRE sequence. Shown above each condition (MOI) is the fold increase in nuclease activity observed.

    [0054] FIGS. 7A and 7B are illustrations of exemplary different variant constructs made and tested. FIG. 7A depicts V1 is the initial expression architecture and V2-V8 depict the various variant architecture. Abbreviations are as follows: ApoE is the Apo E enhancer; hAAT is the human-al anti-trypsin promoter; HBB-IGG is the human beta chimeric intron comprising the 5 donor site from the first intron of the human -globin gene and the branch and 3 acceptor site from the intron of an immunoglobulin gene heavy chain variable region; NLS is the nuclear localization sequence; polyA is the poly A sequence; WPRE is the woodchuck hepatitis virus post-transcriptional regulator element; 3 FLAG is the peptide described as SEQ ID NO:4 and/or SEQ ID NO: 71; and -glb is the 5 untranslated region of the Xenopus beta-globin gene. FIG. 7B shows schematics of the AAVs comprising sequences encoding ZFNs 47171, 47898, 71557 and 71728.

    [0055] FIG. 8 is a graph showing nuclease activity (% indels, as determined by next generation sequencing) using the indicated combinations of polynucleotide components at the indicated MOIs. The left-most bar (standard (V1)) under each condition shows results where the nuclease-encoding polynucleotide did not include 3 FLAG, a WPRE sequence or a poly A sequence, also referred to as a variant 1 (V1) or parent. The bar second from the left (WPRE (V2)) shows results where the nuclease-encoding polynucleotide included a WPRE sequence. The middle bar (3 Flag, WPRE (V4)) shows results with a variant (designated V4) that included a 3 FLAG sequence and a WPRE sequence. The bar second from the right (5XBG, WPRE (V6)) shows results where the nuclease-encoding polynucleotide (designated variant 6 or V6) included a bovine growth hormone (BG) poly A sequence and a WPRE sequence. The right-most bar (SXBG, 3 FLAG, WPRE) shows results where the nuclease-encoding polynucleotide (designated variant 8 or V8) that included a BG poly A sequence, a 3 FLAG peptide sequence and a WPRE sequence.

    [0056] FIG. 9 is a graph showing nuclease activity (% indels, as determined by deep sequencing) in K562 cells transfected at the indicated mRNA amounts with mRNA encoding albumin-targeting ZFNs with (light shaded circles shown as +Novel 5 UTR) or without (dark shaded circles shown as No 5UTR) a 5UTR sequence (Xenopus -globin UTR as shown in SEQ ID NO:1). Cells were assessed for ZFN activity 24 hours after transfection. The numbers above the light shaded circles (mRNA including the 5UTR) indicate the fold increase as compared to mRNA without the 5UTR.

    [0057] FIGS. 10A through 10C are graphs showing cutting efficiency and ZFN expression in vivo or in vitro. FIG. 10A is a graph showing in vivo cleavage as determined by % indels in mouse liver cells 56 days post injection of the indicated ZFN constructs and FIG. 10B shows ZFN expression levels. Wild type male mice were intravenously injected with albumin ZFN-encoding AAV6 constructs without (ZFN standard) or with the 5UTR, FLAG peptide and WPRE sequences (ZFN improved or ZFP 2.0) and IDS donor in three doses: 2.0E+11 vg/mouse (low dose), 6.0E+11 vg/mouse (mid dose) and or 2.0E+12 vg/mouse (high mouse). Liver samples were collected 56 days post injection. From left to right, shown are indels following administration of formulation buffer, low dose unmodified (standard) ZFN-encoding vectors, low dose AAV ZFN-encoding vectors modified as described herein, unmodified (standard) mid dose, mid dose AAV ZFN-encoding vectors ZFNs modified as described herein, unmodified (standard) high dose, and high dose AAV ZFN-encoding vectors ZFNs modified as described herein. As shown, AAV vectors including the modifications described herein (5UTR, 5 peptide, WPRE) provided a 7-fold increase in cleavage efficiency as compared to unmodified AAV vectors. * p<0.05, ** p<0.01 by two tailed Student's t-test. FIG. 10C demonstrates the increased expression of the FIX donor using the 71557/71728 or the 47171/47898 ZFN pair. The ZFN pairs were used to treat HepG2 cells on day 1, and then one day 2, the FIX transgene was used. On day 9, the media was subject to ELISA to determine the amount of FIX protein expressed. The data demonstrates that the use of the 71557/71728 ZFN pair resulted in nearly 3 times more FIX being expressed in the media as compared to the 47171/47898 pair.

    [0058] FIGS. 11A through 11C depict the donor designs used in these studies. FIG. 11A is a graphical depiction of the three donors showing the elements and transgenes comprised by the donor AAVs. FIG. 11B shows the results of the modifications for editing on primary human hepatocytes (left graph) and the increased activity detected in the supernatant of the hepatocytes that have been subject to ZFN-driven targeted integration using the standard (Current shown as left bar under indicated dose) ZFN pair as compared with the improved ZFNs (ZFN 2.0 shown as right bar under indicated dose). FIG. 11C is a graph showing in vivo transgene expression (IDS) of the mouse subjects treated as described in FIG. 10 and Example 7. Wild type male mice were intravenously injected with albumin ZFN-encoding AAV6 constructs without (ZFN standard) or with the 5UTR, FLAG peptide and WPRE sequences (ZFN improved) and IDS donor in three doses: 2.0E+11 vg/mouse (low dose), 6.0E+11 vg/mouse (mid dose) and or 2.0E+12 vg/mouse (high mouse). Liver samples were collected 56 days post injection and relative transgene expression measured as described in the Examples. From left to right, shown are results following administration of formulation buffer, low dose unmodified (standard) ZFN-encoding vectors, low dose AAV ZFN-encoding vectors modified as described herein, unmodified (standard) mid dose, mid dose AAV ZFN-encoding vectors ZFNs modified as described herein, unmodified (standard) high dose, and high dose AAV ZFN-encoding vectors ZFNs modified as described herein. As shown, AAV vectors including the modifications described herein (5UTR, 5 peptide, WPRE) provided an 18-fold increase in donor (IDS) expression as compared to unmodified AAV vectors.

    [0059] FIG. 12 shows results of Western blot analysis of IDS expression in liver samples of the subjects treated as described in Example 7 and FIGS. 10 and 11.

    [0060] FIG. 13 is a graph showing enzymatic activity of the IDS protein encoded by the donor administered with the modified and unmodified ZFNs (at low, mid and high doses) for targeted integration (see Example 7). Enzymatic activity was measured as described in the Examples. From left to right, shown are results following administration of formulation buffer, low dose unmodified (standard) ZFN-encoding vectors, low dose AAV ZFN-encoding vectors modified as described herein, unmodified (standard) mid dose, mid dose AAV ZFN-encoding vectors ZFNs modified as described herein, unmodified (standard) high dose, and high dose AAV ZFN-encoding vectors ZFNs modified as described herein.

    [0061] FIGS. 14A and 14B depict insertion of the IDUA donor in HepG2 cells using the standard 47171/47898 ZFN pair or the 71557/71728 ZFN pair. FIG. 14A depicts IDUA activity over time in the supernatant of HepG2 cells treated with the ZFNs and donor. ZFN dose was at an MOI of 600K and donor was at a dose of 1200K MOI. FIG. 14B depicts the percent indels for each testing condition in the cells. The data demonstrate that both pairs of ZFNs are active and cause ZFN-directed targeted integration of the IDUA transgene.

    DETAILED DESCRIPTION

    [0062] Disclosed herein are methods and compositions for increasing the efficiency (cleavage activity) of expression of an engineered nuclease, as well as increasing the specificity of on-target engineered nuclease cleavage activity. The methods involve optimizing the combination of expression elements in the nuclease expression vector and decreasing the non-specific interactions between the FokI cleavage domain and DNA and decreasing non-specific interactions between the zinc finger backbone and DNA. Further, the methods and compositions of the invention provide optimized ZFN reagents capable of cleaving a human albumin locus with high specificity, and the optimized albumin reagents are also capable of cleaving a wildtype albumin target sequence and the same target sequence comprising a SNP. The ZFN reagents described herein can be used for efficient and highly targeted cleavage of an albumin gene, including for nuclease-mediated integration of one or more therapeutic protein-encoding sequences (e.g., proteins lacking or deficient in a subject with a disease or disorder) into the cleaved albumin gene such the protein(s) are expressed in the subject and reduce, prevent, and/or treat (e.g., alleviate the symptoms) of the disease or disorder in the subject.

    [0063] Hemophilia B is an X-linked recessive bleeding disorder caused by mutations in the gene encoding blood coagulation Factor IX (FIX). It is also known as Christmas disease and is the second most common form of hemophilia, after Hemophilia A or Factor VIII deficiency. It occurs in about one in 25,000 males with a prevalence of approximately 4,000 in the United States. The disease manifestation varies depending upon the level of Factor IX clotting activity. The majority of subjects with hemophilia B have a severe form of the disease (<1% FIX activity). They are usually diagnosed during the first two years of life after developing spontaneous joint or deep muscle bleeding. Those with moderate disease (1-5% FIX activity) present with prolonged or delayed bleeding after relatively minor trauma and are diagnosed before age six. By comparison, mild hemophiliacs (>5-30% FIX activity) are diagnosed later in life and do not suffer from spontaneous bleeding but will develop excessive bleeding following surgery or tooth extraction. Finally, approximately 10% of female carriers have FIX activity below 30% and are at risk of excessive bleeding after major trauma or surgery.

    [0064] The current treatment of hemophilia B consists of the use of FIX concentrates, which were initially derived from donor plasma in the late 1960s. Subsequent improvements such as viral inactivation and donor screening led to more purified concentrates which culminated with the introduction of recombinant FIX in 1997. More recently, a recombinant FIX Fc fusion protein allowing for weekly or biweekly administration was approved for marketing in the United States. Increasing the levels of Factor IX to 5% of normal (i.e. 250 ng/mL) results in a profound improvement in symptoms and is sufficient to prevent spontaneous and life-threatening bleeding episodes. (Scriver, C R et al. The Metabolic and Molecular Bases of Inherited Disease. New York: McGraw-Hill (2001); Lofqvist, T et al. (1997) J. Intern. Med. 241(5): 395-400; Ljung, R C. (1998) Br. J. Haematol. 101(2): 215-219). These therapeutic advances have increased the median life expectancy from 11 years prior to the introduction of plasma derived FIX to 63 years with the recombinant protein (Darby, S C et al. (2007) Blood. 110(3): 815-25).

    [0065] Current treatments for hemophilia B rely on chronic, repeated intravenous infusions of purified recombinant Factor IX and suffer from a number of drawbacks. This includes the need for repeated intravenous infusions, which is associated with inhibitor formation, and is prophylactic rather than curative. An alternative approach to clotting factor delivery, based on synthesis from a therapeutic transgene in situ (within the liver of the subject) offers the prospect of eliminating these concerns. The methods and compositions disclosed herein describe treating hemophilia B via a novel strategy that places a corrective FIX transgene into the genome, and under the control of the subject's own endogenous albumin locus or a highly expressed exogenous promoter, thus resulting in liver-specific synthesis of Factor IX. In particular, engineered zinc finger nucleases (ZFNs) as described herein are employed to site-specifically integrate a FIX transgene into the genome of the subject's own hepatocytes in vivo. Integration of the FIX transgene using nucleases as described herein results in stable, high level, liver-specific expression and secretion of FIX into the blood of the subject.

    [0066] Mucopolysaccharidosis type I (MPS I), also referred to as Hurler/Hurler-Scheie/Scheie syndrome, is a recessive lysosomal storage disorder. According to the National Institute of Neurological Disorders and Stroke (NINDS) factsheet for MPS I, the estimated incidence is 1 in about 100,000 births for severe MPS I, 1 in about 500,000 births for attenuated MPS I, and 1 in about 115,000 births for disease that falls between severe and attenuated.

    [0067] MPS I is associated with mutations in the gene encoding the iduronidase (IDUA) enzyme, which degrades glycosaminoglycans (sulfated carbohydrate polymers; GAGs). Mutations in the IDUA gene diminish or eliminate IDUA enzyme activity, which results in the accumulation of toxic GAGs in urine, plasma, and body tissues.

    [0068] Depending upon the specific type of IDUA mutation (more than 100 different mutations have been described) and the levels of the resulting residual IDUA enzyme, patients will develop either Hurler syndrome (MPS I H) or the attenuated variants (MPS I H/S and MPS I S). It has been estimated that 50%-80% of all MPS I patients present with the severe form, which could be partly attributed to the relative ease of diagnosis (Muenzer et al. (2009) Pediatrics. 123(1): 19-29). MPS I H patients show symptoms of developmental delay before the end of their first year as well as halted growth and progressive mental decline between ages 2-4 yrs. Other symptoms include organomegaly, corneal clouding, joint stiffness and skeletal deformities (including abnormal spinal bones), coarse facial features with enlarged tongue, hearing loss and hernias. The life expectancy of these MPS I H patients is less than 10 years. Patients with the attenuated form share most of these clinical manifestations but with less severe symptoms. In addition, there is no CNS involvement and therefore they do not suffer from mental retardation.

    [0069] Many of these patients can survive into adulthood but with significant morbidity. Current therapies for MPS I include hematopoietic stem cell transplant (HSCT) and enzyme replacement therapy (ERT). If patients suffering from the severe MPS I form (MPS I-H) can be diagnosed early (<2.5 yr), therapeutic intervention by HSCT (bone marrow or umbilical cord stems cells) can prevent or reverse most clinical features including neurocognition. Currently, almost all patients with MPS I H undergo HSCT. For MPS I the mortality rate after HSCT is 15% and survival rate with successful engraftment is 56% ERT with a polymorphic recombinant protein produced in Chinese Hamster Ovary cells, Aldurazyme, has been in use since 2003. This enzyme has been shown to improve pulmonary function, hepatosplenomegaly, and exercise capacity and leads to improved health related quality of life. ERT should be instituted as early as possible. Limitations to enzyme replacement therapy includes the need for life-long treatment, development of neutralizing antibodies, inability to cross the blood brain barrier, continued cardiac, orthopedic, ocular complications and the inconvenience of weekly intravenous infusions. Together, these limitations underscore the urgent need to develop a broader array of curative therapies for MPS I.

    [0070] The objective and rationale for the use of the methods and compositions disclosed herein is to abrogate or decrease the need for enzyme replacement therapy by in vivo genome editing. In particular, engineered zinc finger nucleases (ZFNs) as described herein are employed to site-specifically integrate a corrective copy of the iduronidase enzyme (hIDUA) transgene into the genome of the subject's own hepatocytes in vivo. Integration of the hIDUA transgene may be targeted to intron 1 of the albumin locus, resulting in stable, high level, liver-specific expression and secretion of iduronidase into the blood. Placement of the huIDUA transgene under the control of the highly expressed endogenous albumin locus is expected to provide permanent, liver-specific expression of iduronidase for the lifetime of an MPS I patient.

    [0071] Mucopolysaccharidosis II (MPS II), also referred to as Hunter syndrome, is an X-linked, recessive, lysosomal storage disorder predominantly in males. The incidence of MPS II is reported as 0.3 to 0.71 per 100,000 live births (Burton & Giugliani (2012) Eur J Pediatr 171(4):631-9. doi: 10.1007/s00431-012-1703-y. Epub 2012 Mar. 1.). Applying the more conservative median life expectancy of 21.7 years for the attenuated form of the disease (the life expectancy for the severe form of the disease is 11.8 years) (Burrow & Leslie (2008) Biologics. 2008 June; 2(2):311-20; Young & Harper (1982) J Med Genet. 19(6):408-11) to the yearly incidence yields an estimated prevalence of about 629 individuals with MPS II currently living in the US.

    [0072] MPS II is caused by mutations in the iduronate-2-sulfatase (IDS) gene which encodes an enzyme involved in the lysosomal degradation of the mucopolysaccharides glycosaminoglycans (GAG). This results in the accumulation of GAG in the urine, plasma and tissues and causes multi-systemic, progressive disease. Hunter syndrome represents a disease spectrum spanning early onset, severe disease (two-thirds of patients) with somatic and cognitive involvement, to attenuated MPS II characterized by later onset of somatic disease and little or no central nervous system (CNS) disease. The specific type of IDS mutation (>150 gene mutations have been identified) and the levels of the resulting residual IDS enzyme most likely determine the severity of disease. The residual IDS activity in the attenuated form has been measured at 0.2-2.4% of the wildtype IDS activity and those with the severe phenotype have no activity (Sukegawa-Hayasaka et al. (2006) J Inherit Metab Dis 29(6): 755-61). The IDS gene is mapped to Xq28, and contains nine exons spread over 24 kb. Major deletions and rearrangements are always associated with the severe form of the disease.

    [0073] Severe MPS II patients typically start to have delayed speech and developmental delay between 18 months to 3 years of age. The disease is characterized in severe MPS II patients by organomegaly, hyperactivity and aggressiveness, neurologic deterioration, joint stiffness and skeletal deformities (including abnormal spinal bones), coarse facial features with enlarged tongue, heart valve thickening, hearing loss and hernias. The life expectancy of untreated patients with severe Hunter syndrome is into the mid teenage years with death due to neurologic deterioration and/or cardiorespiratory failure. Patients with the attenuated form are typically diagnosed later than the severe patients. The somatic clinical features are similar to the severe patients, but overall disease severity in milder with, in general, slower disease progression with no or only mild cognitive impairment. Death in the untreated attenuated form is often between the ages of 20-30 years from cardiac and respiratory disease.

    [0074] The only approved therapy for MPS II is enzyme replacement therapy (ERT). Intravenous (IV) ERT with recombinant IDS protein (idursulfase; Elaprase) has been approved since 2006. ERT using idursulfase has been shown to improve hepatosplenomegaly, pulmonary function (FVC) and exercise capacity (6 minute walk) and leads to improved health related quality of life. Response to ERT depends on the subject's disease severity at the time of initiation of treatment. Limitations to ERT include the need for life-long treatment, development of neutralizing antibodies, inability of the enzyme to cross the blood brain barrier, and the inconvenience of weekly intravenous infusions. In contrast to Hurler syndrome (the severe form of MPS I), hematopoietic stem cell transplantation (HSCT) is not recommended for the severe form of MPS II. Together, these limitations underscore the urgent need to develop a broader array of curative therapies for MPS II.

    [0075] Thus, the methods and compositions disclosed herein abrogate or decrease the need for enzyme replacement therapy by in vivo genome editing in subjects with MPS II. In particularly, engineered zinc finger nucleases (ZFNs) as described herein are used to site-specifically integrate a corrective copy of the enzyme iduronate-2-sulfatase (hIDS) transgene into the genome of the subject's own hepatocytes in vivo. Integration of the hIDS transgene is targeted to intron 1 of the albumin locus, resulting in stable, high level, liver-specific expression and secretion of iduronate-2-sulfatase into the blood. Placement of the hIDS transgene under the control of the highly expressed endogenous albumin locus is expected to provide permanent, liver-specific expression of iduronate-2-sulfatase for the lifetime of an MPS II patient.

    [0076] General

    [0077] Practice of the methods, as well as preparation and use of the compositions disclosed herein employ, unless otherwise indicated, conventional techniques in molecular biology, biochemistry, chromatin structure and analysis, computational chemistry, cell culture, recombinant DNA and related fields as are within the skill of the art. These techniques are fully explained in the literature. See, for example, Sambrook et al. MOLECULAR CLONING: A LABORATORY MANUAL, Second edition, Cold Spring Harbor Laboratory Press, 1989 and Third edition, 2001; Ausubel et al., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, New York, 1987 and periodic updates; the series METHODS IN ENZYMOLOGY, Academic Press, San Diego; Wolffe, CHROMATIN STRUCTURE AND FUNCTION, Third edition, Academic Press, San Diego, 1998; METHODS IN ENZYMOLOGY, Vol. 304, Chromatin (P. M. Wassarman and A. P. Wolffe, eds.), Academic Press, San Diego, 1999; and METHODS IN MOLECULAR BIOLOGY, Vol. 119, Chromatin Protocols (P. B. Becker, ed.) Humana Press, Totowa, 1999.

    [0078] Definitions

    [0079] The terms nucleic acid, polynucleotide, and oligonucleotide are used interchangeably and refer to a deoxyribonucleotide or ribonucleotide polymer, in linear or circular conformation, and in either single- or double-stranded form. For the purposes of the present disclosure, these terms are not to be construed as limiting with respect to the length of a polymer. The terms can encompass known analogues of natural nucleotides, as well as nucleotides that are modified in the base, sugar and/or phosphate moieties (e.g., phosphorothioate backbones). In general, an analogue of a particular nucleotide has the same base-pairing specificity; i.e., an analogue of A will base-pair with T.

    [0080] The terms polypeptide, peptide and protein are used interchangeably to refer to a polymer of amino acid residues. The term also applies to amino acid polymers in which one or more amino acids are chemical analogues or modified derivatives of a corresponding naturally-occurring amino acids.

    [0081] Binding refers to a sequence-specific, non-covalent interaction between macromolecules (e.g., between a protein and a nucleic acid). Not all components of a binding interaction need be sequence-specific (e.g., contacts with phosphate residues in a DNA backbone), as long as the interaction as a whole is sequence-specific. Such interactions are generally characterized by a dissociation constant (K.sub.d) of 10 or lower. Affinity refers to the strength of binding: increased binding affinity being correlated with a lower K.sub.d. Non-specific binding refers to, non-covalent interactions that occur between any molecule of interest (e.g. an engineered nuclease) and a macromolecule (e.g. DNA) that are not dependent on-target sequence.

    [0082] A binding protein is a protein that is able to bind non-covalently to another molecule. A binding protein can bind to, for example, a DNA molecule (a DNA-binding protein), an RNA molecule (an RNA-binding protein) and/or a protein molecule (a protein-binding protein). In the case of a protein-binding protein, it can bind to itself (to form homodimers, homotrimers, etc.) and/or it can bind to one or more molecules of a different protein or proteins. A binding protein can have more than one type of binding activity. For example, zinc finger proteins have DNA-binding, RNA-binding and protein-binding activity. In the case of an RNA-guided nuclease system, the RNA guide is heterologous to the nuclease component (Cas9 or Cfp1) and both may be engineered.

    [0083] A DNA binding molecule is a molecule that can bind to DNA. Such DNA binding molecule can be a polypeptide, a domain of a protein, a domain within a larger protein or a polynucleotide. In some embodiments, the polynucleotide is DNA, while in other embodiments, the polynucleotide is RNA. In some embodiments, the DNA binding molecule is a protein domain of a nuclease (e.g. the FokI domain), while in other embodiments, the DNA binding molecule is a guide RNA component of an RNA-guided nuclease (e.g. Cas9 or Cfp1).

    [0084] A DNA binding protein (or binding domain) is a protein, or a domain within a larger protein, that binds DNA in a sequence-specific manner, for example through one or more zinc fingers or through interaction with one or more RVDs in a zinc finger protein or TALE, respectively. The term zinc finger DNA binding protein is often abbreviated as zinc finger protein or ZFP.

    [0085] A zinc finger DNA binding protein (or binding domain) is a protein, or a domain within a larger protein, that binds DNA in a sequence-specific manner through one or more zinc fingers, which are regions of amino acid sequence within the binding domain whose structure is stabilized through coordination of a zinc ion. The term zinc finger DNA binding protein is often abbreviated as zinc finger protein or ZFP. Artificial nucleases and transcription factors can include a ZFP DNA-binding domain and a functional domain (nuclease domain for a ZFN or transcriptional regulatory domain for ZFP-TF). The term zinc finger nuclease includes one ZFN as well as a pair of ZFNs (the members of the pair are referred to as left and right or first and second or pair) that dimerize to cleave the target gene.

    [0086] A TALE DNA binding domain or TALE is a polypeptide comprising one or more TALE repeat domains/units. The repeat domains are involved in binding of the TALE to its cognate target DNA sequence. A single repeat unit (also referred to as a repeat) is typically 33-35 amino acids in length and exhibits at least some sequence homology with other TALE repeat sequences within a naturally occurring TALE protein. See, e.g., U.S. Pat. Nos. 8,586,526 and 9,458,205. Artificial nucleases and transcription factors can include a TALE DNA-binding domain and a functional domain (nuclease domain for a TALEN or transcriptional regulatory domain for TALEN-TF). The term TALEN includes one TALEN as well as a pair of TALENs (the members of the pair are referred to as left and right or first and second or pair) that dimerize to cleave the target gene.

    [0087] Zinc finger and TALE DNA-binding domains can be engineered to bind to a predetermined nucleotide sequence, for example via engineering (altering one or more amino acids) of the recognition helix region of a naturally occurring zinc finger protein or by engineering of the amino acids involved in DNA binding (the repeat variable diresidue or RVD region). Therefore, engineered zinc finger proteins or TALE proteins are proteins that are non-naturally occurring. Non-limiting examples of methods for engineering zinc finger proteins and TALEs are design and selection. A designed protein is a protein not occurring in nature whose design/composition results principally from rational criteria. Rational criteria for design include application of substitution rules and computerized algorithms for processing information in a database storing information of existing ZFP or TALE designs and binding data. See, for example, U.S. Pat. Nos. 8,586,526; 6,140,081; 6,453,242; and 6,534,261; see also WO 98/53058; WO 98/53059; WO 98/53060; WO 02/016536 and WO 03/016496.

    [0088] A selected zinc finger protein, TALE protein or CRISPR/Cas system is not found in nature whose production results primarily from an empirical process such as phage display, interaction trap, rational design or hybrid selection. See e.g., U.S. Pat. Nos. 5,789,538; 5,925,523; 6,007,988; 6,013,453; 6,200,759; WO 95/19431; WO 96/06166; WO 98/53057; WO 98/54311; WO 00/27878; WO 01/60970; WO 01/88197 and WO 02/099084.

    [0089] TtAgo is a prokaryotic Argonaute protein thought to be involved in gene silencing. TtAgo is derived from the bacteria Thermus thermophilus. See, e.g. Swarts et al, ibid; G. Sheng et al., (2013) Proc. Natl. Acad. Sci. U.S.A. 111, 652). A TtAgo system is all the components required including e.g. guide DNAs for cleavage by a TtAgo enzyme.

    [0090] Recombination refers to a process of exchange of genetic information between two polynucleotides, including but not limited to, capture by non-homologous end joining (NHEJ) and homologous recombination. For the purposes of this disclosure, homologous recombination (HR) refers to the specialized form of such exchange that takes place, for example, during repair of double-strand breaks in cells via homology-directed repair mechanisms. This process requires nucleotide sequence homology, uses a donor molecule to template repair of a target molecule (i.e., the one that experienced the double-strand break), and is variously known as non-crossover gene conversion or short tract gene conversion, because it leads to the transfer of genetic information from the donor to the target. Without wishing to be bound by any particular theory, such transfer can involve mismatch correction of heteroduplex DNA that forms between the broken target and the donor, and/or synthesis-dependent strand annealing, in which the donor is used to resynthesize genetic information that will become part of the target, and/or related processes. Such specialized HR often results in an alteration of the sequence of the target molecule such that part or all of the sequence of the donor polynucleotide is incorporated into the target polynucleotide.

    [0091] In certain methods of the disclosure, one or more targeted nucleases as described herein create a double-stranded break (DSB) in the target sequence (e.g., cellular chromatin) at a predetermined site (e.g., a gene or locus of interest). The DSB mediates integration of a construct (e.g. donor) as described herein. Optionally, the construct has homology to the nucleotide sequence in the region of the break. An expression construct may be physically integrated or, alternatively, the expression cassette is used as a template for repair of the break via homologous recombination, resulting in the introduction of all or part of the nucleotide sequence as in the expression cassette into the cellular chromatin. Thus, a first sequence in cellular chromatin can be altered and, in certain embodiments, can be converted into a sequence present in an expression cassette. Thus, the use of the terms replace or replacement can be understood to represent replacement of one nucleotide sequence by another, (i.e., replacement of a sequence in the informational sense), and does not necessarily require physical or chemical replacement of one polynucleotide by another.

    [0092] In any of the methods described herein, additional engineered nucleases can be used for additional double-stranded cleavage of additional target sites within the cell.

    [0093] In certain embodiments of methods for targeted recombination and/or replacement and/or alteration of a sequence in a region of interest in cellular chromatin, a chromosomal sequence is altered by homologous recombination with an exogenous donor nucleotide sequence. Such homologous recombination is stimulated by the presence of a double-stranded break in cellular chromatin, if sequences homologous to the region of the break are present.

    [0094] In any of the methods described herein, the first nucleotide sequence (the donor sequence) can contain sequences that are homologous, but not identical, to genomic sequences in the region of interest, thereby stimulating homologous recombination to insert a non-identical sequence in the region of interest. Thus, in certain embodiments, portions of the donor sequence that are homologous to sequences in the region of interest exhibit between about 80 to 99% (or any integer therebetween) sequence identity to the genomic sequence that is replaced. In other embodiments, the homology between the donor and genomic sequence is higher than 99%, for example if only 1 nucleotide differs as between donor and genomic sequences of over 100 contiguous base pairs. In certain cases, a non-homologous portion of the donor sequence can contain sequences not present in the region of interest, such that new sequences are introduced into the region of interest. In these instances, the non-homologous sequence is generally flanked by sequences of 50-1,000 base pairs (or any integral value therebetween) or any number of base pairs greater than 1,000, that are homologous or identical to sequences in the region of interest. In other embodiments, the donor sequence is non-homologous to the first sequence, and is inserted into the genome by non-homologous recombination mechanisms.

    [0095] Any of the methods described herein can be used for partial or complete inactivation of one or more target sequences in a cell by targeted integration of donor sequence or via cleavage of the target sequence(s) followed by error-prone NHEJ-mediated repair that disrupts expression of the gene(s) of interest. Cell lines with partially or completely inactivated genes are also provided.

    [0096] Furthermore, the methods of targeted integration as described herein can also be used to integrate one or more exogenous sequences. The exogenous nucleic acid sequence can comprise, for example, one or more genes or cDNA molecules, or any type of coding or noncoding sequence, as well as one or more control elements (e.g., promoters). In addition, the exogenous nucleic acid sequence may produce one or more RNA molecules (e.g., small hairpin RNAs (shRNAs), inhibitory RNAs (RNAis), microRNAs (miRNAs), etc.).

    [0097] Cleavage refers to the breakage of the covalent backbone of a DNA molecule. Cleavage can be initiated by a variety of methods including, but not limited to, enzymatic or chemical hydrolysis of a phosphodiester bond. Both single-stranded cleavage and double-stranded cleavage are possible, and double-stranded cleavage can occur as a result of two distinct single-stranded cleavage events. DNA cleavage can result in the production of either blunt ends or staggered ends. In certain embodiments, fusion polypeptides are used for targeted double-stranded DNA cleavage.

    [0098] A cleavage half-domain is a polypeptide sequence which, in conjunction with a second polypeptide (either identical or different) forms a complex having cleavage activity (preferably double-strand cleavage activity). The terms first and second cleavage half-domains; + and cleavage half-domains and right and left cleavage half-domains are used interchangeably to refer to pairs of cleavage half-domains that dimerize. The term cleavage domain is used interchangeably with the term cleavage half-domain. The term FokI cleavage domain includes the FokI sequence as shown in SEQ ID NO:2 as well as any FokI homologues.

    [0099] An engineered cleavage half-domain is a cleavage half-domain that has been modified so as to form obligate heterodimers with another cleavage half-domain (e.g., another engineered cleavage half-domain).

    [0100] The term sequence refers to a nucleotide sequence of any length, which can be DNA or RNA; can be linear, circular or branched and can be either single-stranded or double stranded. The term transgene refers to a nucleotide sequence that is inserted into a genome. A transgene can be of any length, for example between 2 and 100,000,000 nucleotides in length (or any integer value therebetween or thereabove), preferably between about 100 and 100,000 nucleotides in length (or any integer therebetween), more preferably between about 2000 and 20,000 nucleotides in length (or any value therebetween) and even more preferable, between about 5 and 15 kb (or any value therebetween).

    [0101] A chromosome, is a chromatin complex comprising all or a portion of the genome of a cell. The genome of a cell is often characterized by its karyotype, which is the collection of all the chromosomes that comprise the genome of the cell. The genome of a cell can comprise one or more chromosomes.

    [0102] An episome is a replicating nucleic acid, nucleoprotein complex or other structure comprising a nucleic acid that is not part of the chromosomal karyotype of a cell. Examples of episomes include plasmids, minicircles and certain viral genomes. The liver specific constructs described herein may be episomally maintained or, alternatively, may be stably integrated into the cell.

    [0103] An exogenous molecule is a molecule that is not normally present in a cell, but can be introduced into a cell by one or more genetic, biochemical or other methods. Normal presence in the cell is determined with respect to the particular developmental stage and environmental conditions of the cell. Thus, for example, a molecule that is present only during embryonic development of muscle is an exogenous molecule with respect to an adult muscle cell. Similarly, a molecule induced by heat shock is an exogenous molecule with respect to a non-heat-shocked cell. An exogenous molecule can comprise, for example, a functioning version of a malfunctioning endogenous molecule or a malfunctioning version of a normally-functioning endogenous molecule.

    [0104] An exogenous molecule can be, among other things, a small molecule, such as is generated by a combinatorial chemistry process, or a macromolecule such as a protein, nucleic acid, carbohydrate, lipid, glycoprotein, lipoprotein, polysaccharide, any modified derivative of the above molecules, or any complex comprising one or more of the above molecules. Nucleic acids include DNA and RNA, can be single- or double-stranded; can be linear, branched or circular; and can be of any length. Nucleic acids include those capable of forming duplexes, as well as triplex-forming nucleic acids. See, for example, U.S. Pat. Nos. 5,176,996 and 5,422,251. Proteins include, but are not limited to, DNA-binding proteins, transcription factors, chromatin remodeling factors, methylated DNA binding proteins, polymerases, methylases, demethylases, acetylases, deacetylases, kinases, phosphatases, ligases, deubiquitinases, integrases, recombinases, ligases, topoisomerases, gyrases and helicases.

    [0105] An exogenous molecule can be the same type of molecule as an endogenous molecule, e.g., an exogenous protein or nucleic acid. For example, an exogenous nucleic acid can comprise an infecting viral genome, a plasmid or episome introduced into a cell, or a chromosome that is not normally present in the cell. Methods for the introduction of exogenous molecules into cells are known to those of skill in the art and include, but are not limited to, lipid-mediated transfer (i.e., liposomes, including neutral and cationic lipids), electroporation, direct injection, cell fusion, particle bombardment, calcium phosphate co-precipitation, DEAE-dextran-mediated transfer and viral vector-mediated transfer. An exogenous molecule can also be the same type of molecule as an endogenous molecule but derived from a different species than the cell is derived from. For example, a human nucleic acid sequence may be introduced into a cell line originally derived from a mouse or hamster. Methods for the introduction of exogenous molecules into plant cells are known to those of skill in the art and include, but are not limited to, protoplast transformation, silicon carbide (e.g., WHISKERS) Agrobacterium-mediated transformation, lipid-mediated transfer (i.e., liposomes, including neutral and cationic lipids), electroporation, direct injection, cell fusion, particle bombardment (e.g., using a gene gun), calcium phosphate co-precipitation, DEAE-dextran-mediated transfer and viral vector-mediated transfer.

    [0106] By contrast, an endogenous molecule is one that is normally present in a particular cell at a particular developmental stage under particular environmental conditions. For example, an endogenous nucleic acid can comprise a chromosome, the genome of a mitochondrion, chloroplast or other organelle, or a naturally-occurring episomal nucleic acid. Additional endogenous molecules can include proteins, for example, transcription factors and enzymes.

    [0107] As used herein, the term product of an exogenous nucleic acid includes both polynucleotide and polypeptide products, for example, transcription products (polynucleotides such as RNA) and translation products (polypeptides).

    [0108] A fusion molecule is a molecule in which two or more subunit molecules are linked, preferably covalently. The subunit molecules can be the same chemical type of molecule, or can be different chemical types of molecules. Examples of fusion molecules include, but are not limited to, fusion proteins (for example, a fusion between a protein DNA-binding domain and a cleavage domain such as a ZFN or TALEN), fusions between a polynucleotide DNA-binding domain (e.g., sgRNA) operatively associated with a cleavage domain, and fusion nucleic acids (for example, a nucleic acid encoding the fusion protein).

    [0109] Expression of a fusion molecule in a cell can result from delivery of the components of the fusion molecule to the cell or by delivery of one or more polynucleotide encoding one or more components of the fusion molecule to a cell, wherein the necessary polynucleotide is transcribed, and the transcript is translated, to generate the fusion molecule. Trans-splicing, polypeptide cleavage and polypeptide ligation can also be involved in expression of a protein in a cell. Methods for polynucleotide and polypeptide delivery to cells are presented elsewhere in this disclosure.

    [0110] A gene, for the purposes of the present disclosure, includes a DNA region encoding a gene product (see infra), as well as all DNA regions which regulate the production of the gene product, whether or not such regulatory sequences are adjacent to coding and/or transcribed sequences. Accordingly, a gene includes, but is not necessarily limited to, promoter sequences, terminators, translational regulatory sequences such as ribosome binding sites and internal ribosome entry sites, enhancers, silencers, insulators, boundary elements, replication origins, matrix attachment sites and locus control regions.

    [0111] Gene expression refers to the conversion of the information contained in a gene, into a gene product. A gene product can be the direct transcriptional product of a gene (e.g., mRNA, tRNA, rRNA, antisense RNA, ribozyme, structural RNA or any other type of RNA) or a protein produced by translation of an mRNA. Gene products also include RNAs which are modified, by processes such as capping, polyadenylation, methylation, and editing, and proteins modified by, for example, methylation, acetylation, phosphorylation, ubiquitination, ADP-ribosylation, myristilation, and glycosylation.

    [0112] Modulation of gene expression refers to a change in the activity of a gene. Modulation of expression can include, but is not limited to, gene activation and gene repression. Genome editing (e.g., cleavage, alteration, inactivation, random mutation) can be used to modulate expression. Gene inactivation refers to any reduction in gene expression as compared to a cell that does not include a ZFP, TALE or CRISPR/Cas system as described herein. Thus, gene inactivation may be partial or complete.

    [0113] A region of interest is any region of cellular chromatin, such as, for example, a gene or a non-coding sequence within or adjacent to a gene, in which it is desirable to bind an exogenous molecule. Binding can be for the purposes of targeted DNA cleavage and/or targeted recombination. A region of interest can be present in a chromosome, an episome, an organellar genome (e.g., mitochondrial, chloroplast), or an infecting viral genome, for example. A region of interest can be within the coding region of a gene, within transcribed non-coding regions such as, for example, leader sequences, trailer sequences or introns, or within non-transcribed regions, either upstream or downstream of the coding region. A region of interest can be as small as a single nucleotide pair or up to 2,000 nucleotide pairs in length, or any integral value of nucleotide pairs.

    [0114] A safe harbor locus is a locus within the genome wherein a gene may be inserted without any deleterious effects on the host cell. Most beneficial is a safe harbor locus in which expression of the inserted gene sequence is not perturbed by any read-through expression from neighboring genes. Non-limiting examples of safe harbor loci that are targeted by nuclease(s) include CCR5, HPRT, AAVS1, Rosa and albumin. See, e.g., U.S. Pat. Nos. 7,951,925; 8,771,985; 8,110,379; 7,951,925; U.S. Publication Nos. 20100218264; 20110265198; 20130137104; 20130122591; 20130177983; 20130177960; 20150056705 and 20150159172.

    [0115] A reporter gene or reporter sequence refers to any sequence that produces a protein product that is easily measured, preferably although not necessarily in a routine assay. Suitable reporter genes include, but are not limited to, sequences encoding proteins that mediate antibiotic resistance (e.g., ampicillin resistance, neomycin resistance, G418 resistance, puromycin resistance), sequences encoding colored or fluorescent or luminescent proteins (e.g., green fluorescent protein, enhanced green fluorescent protein, red fluorescent protein, luciferase), and proteins which mediate enhanced cell growth and/or gene amplification (e.g., dihydrofolate reductase). Epitope tags include, for example, one or more copies of FLAG, His, myc, Tap, HA or any detectable amino acid sequence. Expression tags include sequences that encode reporters that may be operably linked to a desired gene sequence in order to monitor expression of the gene of interest.

    [0116] A WPRE sequence is a woodchuck hepatitis posttranscriptional regulatory element derived from the woodchuck hepatitis virus. WPRE is a 600 bp long tripartite element containing gamma, alpha, and beta elements, in the given order (Donello et al (1992) J Virol 72:5085-5092) and contributes to the strong expression of transgenes in AAV systems (Loeb et al (1999) Hum Gene Ther 10:2295-2305). It also enhances the expression of a transgene lacking introns. In its natural form WPRE contains a partial open reading frame (ORF) for the WHV-X protein. The fully expressed WHV-X protein in the context of other viral elements like the WHV (We2) enhancer has been associated with a higher risk of hepatocarcinoma in woodchucks and mice (Hohne et. al (1990) EMBO J9(4):1137-45; Flajolet et. al (1998) J Virol 72(7):6175-80). The WHV-X protein does not appear to be directly oncogenic, but some studies suggest that under certain circumstances it can act as a weak cofactor for the generation of liver cancers associated with infection by hepadnaviruses (hepatitis B virus for man; woodchuck hepatitis virus for woodchucks). Many times, mention of wildtype WPRE is referring to a 591 bp sequence (nucleotides 1094-1684 in GenBank accession number J02442) containing a portion of the WHV X protein open-reading frame (ORF) in its 3 region. In this element, there is an initial ATG start codon for WHV-X at position 1502 and a promoter region with the sequence GCTGA at position 1488. In Zanta-Boussif (ipid), a mut6WPRE sequence was disclosed wherein the promoter sequence at position 1488 was modified to ATCAT and the start codon at position 1502 was modified to TTG, effectively prohibiting expression of WHV-X. In the J04514.1 WPRE variant, the ATG WHV X start site is a position 1504, and a mut6 type variant can be made in the this J04514,1 strain. Another WPRE variant is the 247 bp WPRE3 variant comprising only minimal gamma and alpha elements from the wild type WPRE (Choi et al (2014) Mol Brain 7:17), which lacks the WHV X sequences.

    [0117] Eukaryotic cells include, but are not limited to, fungal cells (such as yeast), plant cells, animal cells, mammalian cells and human cells (e.g., T-cells), including stem cells (pluripotent and multipotent).

    [0118] The terms operative linkage and operatively linked (or operably linked) are used interchangeably with reference to a juxtaposition of two or more components (such as sequence elements), in which the components are arranged such that both components function normally and allow the possibility that at least one of the components can mediate a function that is exerted upon at least one of the other components. By way of illustration, a transcriptional regulatory sequence, such as a promoter, is operatively linked to a coding sequence if the transcriptional regulatory sequence controls the level of transcription of the coding sequence in response to the presence or absence of one or more transcriptional regulatory factors. A transcriptional regulatory sequence is generally operatively linked in cis with a coding sequence, but need not be directly adjacent to it. For example, an enhancer is a transcriptional regulatory sequence that is operatively linked to a coding sequence, even though they are not contiguous.

    [0119] A functional fragment of a protein, polypeptide or nucleic acid is a protein, polypeptide or nucleic acid whose sequence is not identical to the full-length protein, polypeptide or nucleic acid, yet retains the same function as the full-length protein, polypeptide or nucleic acid. A functional fragment can possess more, fewer, or the same number of residues as the corresponding native molecule, and/or can contain one or more amino acid or nucleotide substitutions. Methods for determining the function of a nucleic acid or protein (e.g., coding function, ability to hybridize to another nucleic acid, enzymatic activity assays) are well-known in the art.

    [0120] A polynucleotide vector or construct is capable of transferring gene sequences to target cells. Typically, vector construct, expression vector, expression construct, expression cassette, and gene transfer vector, mean any nucleic acid construct capable of directing the expression of a gene of interest and which can transfer gene sequences to target cells. Thus, the term includes cloning, and expression vehicles, as well as integrating vectors.

    [0121] The terms subject and patient are used interchangeably and refer to mammals such as human patients and non-human primates, as well as experimental animals such as rabbits, dogs, cats, rats, mice, and other animals. Accordingly, the term subject or patient as used herein means any mammalian patient or subject to which the expression cassettes of the invention can be administered. Subjects of the present invention include those with a disorder.

    [0122] The terms treating and treatment as used herein refer to reduction in severity and/or frequency of symptoms, elimination of symptoms and/or underlying cause, prevention of the occurrence of symptoms and/or their underlying cause, and improvement or remediation of damage. Cancer, monogenic diseases and graft versus host disease are non-limiting examples of conditions that may be treated using the compositions and methods described herein.

    [0123] Chromatin is the nucleoprotein structure comprising the cellular genome. Cellular chromatin comprises nucleic acid, primarily DNA, and protein, including histones and non-histone chromosomal proteins. The majority of eukaryotic cellular chromatin exists in the form of nucleosomes, wherein a nucleosome core comprises approximately 150 base pairs of DNA associated with an octamer comprising two each of histones H2A, H2B, H3 and H4; and linker DNA (of variable length depending on the organism) extends between nucleosome cores. A molecule of histone H1 is generally associated with the linker DNA. For the purposes of the present disclosure, the term chromatin is meant to encompass all types of cellular nucleoprotein, both prokaryotic and eukaryotic. Cellular chromatin includes both chromosomal and episomal chromatin.

    [0124] An accessible region is a site in cellular chromatin in which a target site present in the nucleic acid can be bound by an exogenous molecule which recognizes the target site. Without wishing to be bound by any particular theory, it is believed that an accessible region is one that is not packaged into a nucleosomal structure. The distinct structure of an accessible region can often be detected by its sensitivity to chemical and enzymatic probes, for example, nucleases.

    [0125] A target site or target sequence is a nucleic acid sequence that defines a portion of a nucleic acid to which a binding molecule will bind, provided sufficient conditions for binding exist. For example, the sequence 5-GAATTC-3 is a target site for the Eco RI restriction endonuclease. An intended or on-target sequence is the sequence to which the binding molecule is intended to bind and an unintended or off-target sequence includes any sequence bound by the binding molecule that is not the intended target.

    [0126] DNA-Binding Molecules/Domains

    [0127] Described herein are compositions comprising a DNA-binding molecule/domain that specifically binds to a target site in any gene or locus of interest. Any DNA-binding molecule/domain can be used in the compositions and methods disclosed herein, including but not limited to a zinc finger DNA-binding domain, a TALE DNA binding domain, the DNA-binding portion (guide or sgRNA) of a CRISPR/Cas nuclease, or a DNA-binding domain from a meganuclease.

    [0128] In certain embodiments, the DNA binding domain comprises a zinc finger protein. Preferably, the zinc finger protein is non-naturally occurring in that it is engineered to bind to a target site of choice. See, for example, Beerli et al. (2002) Nature Biotechnol. 20:135-141; Pabo et al. (2001) Ann. Rev. Biochem. 70:313-340; Isalan et al. (2001) Nature Biotechnol. 19:656-660; Segal et al. (2001) Curr. Opin. Biotechnol. 12:632-637; Choo et al. (2000) Curr. Opin. Struct. Biol. 10:411-416; U.S. Pat. Nos. 6,453,242; 6,534,261; 6,599,692; 6,503,717; 6,689,558; 7,030,215; 6,794,136; 7,067,317; 7,262,054; 7,070,934; 7,361,635; 7,253,273; and U.S. Patent Publication Nos. 2005/0064474; 2007/0218528; 2005/0267061, all incorporated herein by reference in their entireties. In certain embodiments, the DNA-binding domain comprises a zinc finger protein disclosed in U.S. Patent Publication No. 2012/0060230 (e.g., Table 1), incorporated by reference in its entirety herein.

    [0129] An engineered zinc finger binding domain can have a novel binding specificity, compared to a naturally-occurring zinc finger protein. Engineering methods include, but are not limited to, rational design and various types of selection. Rational design includes, for example, using databases comprising triplet (or quadruplet) nucleotide sequences and individual zinc finger amino acid sequences, in which each triplet or quadruplet nucleotide sequence is associated with one or more amino acid sequences of zinc fingers which bind the particular triplet or quadruplet sequence. See, for example, U.S. Pat. Nos. 6,453,242 and 6,534,261, incorporated by reference herein in their entireties.

    [0130] Exemplary selection methods, including phage display and two-hybrid systems, are disclosed in U.S. Pat. Nos. 5,789,538; 5,925,523; 6,007,988; 6,013,453; 6,410,248; 6,140,466; 6,200,759; and 6,242,568; as well as WO 98/37186; WO 98/53057; WO 00/27878; WO 01/88197 and GB 2,338,237. In addition, enhancement of binding specificity for zinc finger binding domains has been described, for example, in U.S. Pat. No. 6,794,136.

    [0131] In addition, as disclosed in these and other references, zinc finger domains and/or multi-fingered zinc finger proteins may be linked together using any suitable linker sequences, including for example, linkers of 5 or more amino acids in length. See, also, U.S. Pat. Nos. 6,479,626; 6,903,185; and 7,153,949 for exemplary linker sequences 6 or more amino acids in length. The proteins described herein may include any combination of suitable linkers between the individual zinc fingers of the protein. In addition, enhancement of binding specificity for zinc finger binding domains has been described, for example, in U.S. Pat. No. 6,794,136.

    [0132] Selection of target sites; ZFPs and methods for design and construction of fusion molecules (and polynucleotides encoding same) are known to those of skill in the art and described in detail in U.S. Pat. Nos. 6,140,081; 5,789,538; 6,453,242; 6,534,261; 5,925,523; 6,007,988; 6,013,453; 6,200,759; WO 95/19431; WO 96/06166; WO 98/53057; WO 98/54311; WO 00/27878; WO 01/60970 WO 01/88197; WO 02/099084; WO 98/53058; WO 98/53059; WO 98/53060; WO 02/016536 and WO 03/016496.

    [0133] In addition, as disclosed in these and other references, zinc finger domains and/or multi-fingered zinc finger proteins may be linked together using any suitable linker sequences, including for example, linkers of 5 or more amino acids in length. See, also, U.S. Pat. Nos. 6,479,626; 6,903,185; and 7,153,949 for exemplary linker sequences 6 or more amino acids in length. The proteins described herein may include any combination of suitable linkers between the individual zinc fingers of the protein.

    [0134] Usually, the ZFPs include at least three fingers. Certain of the ZFPs include four, five or six fingers. The ZFPs that include three fingers typically recognize a target site that includes 9 or 10 nucleotides; ZFPs that include four fingers typically recognize a target site that includes 12 to 14 nucleotides; while ZFPs having six fingers can recognize target sites that include 18 to 21 nucleotides. The ZFPs can also be fusion proteins that include one or more regulatory domains, which domains can be transcriptional activation or repression domains.

    [0135] In some embodiments, the DNA-binding domain may be derived from a nuclease. For example, the recognition sequences of homing endonucleases and meganucleases such as I-SceI, I-CeuI, PI-PspI, PI-Sce, I-SceIV, I-CsmI, I-PanI, I-SceII, I-PpoI, I-SceIII, I-CreI, I-TevI, I-TevII and I-TevIII are known. See also U.S. Pat. Nos. 5,420,032; 6,833,252; Belfort et al. (1997) Nucleic Acids Res. 25:3379-3388; Dujon et al. (1989) Gene 82:115-118; Perler et al. (1994) Nucleic Acids Res. 22, 1125-1127; Jasin (1996) Trends Genet. 12:224-228; Gimble et al. (1996) J. Mol. Biol. 263:163-180; Argast et al. (1998) J. Mol. Biol. 280:345-353 and the New England Biolabs catalogue. In addition, the DNA-binding specificity of homing endonucleases and meganucleases can be engineered to bind non-natural target sites. See, for example, Chevalier et al. (2002) Molec. Cell 10:895-905; Epinat et al. (2003) Nucleic Acids Res. 31:2952-2962; Ashworth et al. (2006) Nature 441:656-659; Paques et al. (2007) Current Gene Therapy 7:49-66; U.S. Patent Publication No. 20070117128.

    [0136] In certain embodiments, the zinc finger protein (e.g., used in a fusion molecule with a wild-type or mutant cleavage domain) as described herein comprises one or more mutations (substitutions, deletions, and/or insertions) to the backbone regions (e.g., regions outside the 7-amino acid recognition helix region numbered 1 to 6), for example at one or more of positions 14, 9 and/or 5 (see, e.g., FIG. 5A). The wild-type residue at one or more these positions may be deleted, replaced with any amino acid residue and/or include on or more additional residues. In some embodiments, the Arg (R) at position 5 is changed to a Tyr (Y), Asp (N), Glu (E), Leu (L), Gln (Q), or Ala (A). In other embodiments, the Arg (R) at position (9) is replaced with Ser (S), Asp (N), or Glu (E). In further embodiments, the Arg (R) at position (14) is replaced with Ser (S) or Gln (Q). In other embodiments, the fusion polypeptides can comprise mutations in the zinc finger DNA binding domain where the amino acids at the (5), (9) and/or (14) positions are changed to any of the above listed amino acids in any combination.

    [0137] In certain embodiments, the ZFN comprises first and second (left and right) ZFNs as described in any of the appended Tables or Figures. In certain embodiments, the first ZFN comprises the ZFN designated 71557 and the second ZFN comprises the ZFN designated 71728. In certain embodiments, the ZFN designated 71557 is carried on an AAV vector, for example an AAV vector comprising the sequences shown in Table 4 and/or the sequence as shown in SEQ ID NO:43. In other embodiments, the ZFN designated 71728 is carried on an AAV vector, for example an AAV vector comprising the sequences shown in Table 5 and/or SEQ ID NO:56.

    [0138] In other embodiments, the DNA binding domain comprises an engineered domain from a Transcriptional Activator-Like (TAL) effector (TALE) similar to those derived from the plant pathogens Xanthomonas (see Boch et al, (2009) Science 326: 1509-1512 and Moscou and Bogdanove, (2009) Science 326: 1501) and Ralstonia (see Heuer et al (2007) Applied and Environmental Microbiology 73(13): 4379-4384); U.S. Patent Publication Nos. 20110301073 and 20110145940. The plant pathogenic bacteria of the genus Xanthomonas are known to cause many diseases in important crop plants. Pathogenicity of Xanthomonas depends on a conserved type III secretion (T3 S) system which injects more than 25 different effector proteins into the plant cell. Among these injected proteins are transcription activator-like effectors (TALE) which mimic plant transcriptional activators and manipulate the plant transcriptome (see Kay et al (2007) Science 318:648-651). These proteins contain a DNA binding domain and a transcriptional activation domain. One of the most well characterized TALEs is AvrBs3 from Xanthomonas campestgris pv. Vesicatoria (see Bonas et al (1989) Mol Gen Genet 218: 127-136 and WO2010079430). TALEs contain a centralized domain of tandem repeats, each repeat containing approximately 34 amino acids, which are key to the DNA binding specificity of these proteins. In addition, they contain a nuclear localization sequence and an acidic transcriptional activation domain (for a review see Schornack S, et al (2006) J Plant Physiol 163(3): 256-272). In addition, in the phytopathogenic bacteria Ralstonia solanacearum two genes, designated brg11 and hpx17 have been found that are homologous to the AvrBs3 family of Xanthomonas in the R. solanacearum biovar 1 strain GMI1000 and in the biovar 4 strain RS1000 (See Heuer et al (2007) Appl and Envir Micro 73(13): 4379-4384). These genes are 98.9% identical in nucleotide sequence to each other but differ by a deletion of 1,575 base pairs in the repeat domain of hpx17. However, both gene products have less than 40% sequence identity with AvrBs3 family proteins of Xanthomonas.

    [0139] Specificity of these TAL effectors depends on the sequences found in the tandem repeats. The repeated sequence comprises approximately 102 base pairs and the repeats are typically 91-100% homologous with each other (Bonas et al, ibid). Polymorphism of the repeats is usually located at positions 12 and 13 and there appears to be a one-to-one correspondence between the identity of the hypervariable diresidues (the repeat variable diresidue or RVD region) at positions 12 and 13 with the identity of the contiguous nucleotides in the TAL-effector's target sequence (see Moscou and Bogdanove, (2009) Science 326:1501 and Boch et al (2009) Science 326:1509-1512). Experimentally, the natural code for DNA recognition of these TAL-effectors has been determined such that an HD sequence at positions 12 and 13 (Repeat Variable Diresidue or RVD) leads to a binding to cytosine (C), NG binds to T, NI to A, C, G or T, NN binds to A or G, and ING binds to T. These DNA binding repeats have been assembled into proteins with new combinations and numbers of repeats, to make artificial transcription factors that are able to interact with new sequences and activate the expression of a non-endogenous reporter gene in plant cells (Boch et al, ibid). Engineered TAL proteins have been linked to a FokI cleavage half domain to yield a TAL effector domain nuclease fusion (TALEN), including TALENs with atypical RVDs. See, e.g., U.S. Pat. No. 8,586,526.

    [0140] In some embodiments, the TALEN comprises an endonuclease (e.g., FokI) cleavage domain or cleavage half-domain. In other embodiments, the TALE-nuclease is a mega TAL. These mega TAL nucleases are fusion proteins comprising a TALE DNA binding domain and a meganuclease cleavage domain. The meganuclease cleavage domain is active as a monomer and does not require dimerization for activity. (See Boissel et al., (2013) Nucl Acid Res: 1-13, doi: 10.1093/nar/gkt1224).

    [0141] In still further embodiments, the nuclease comprises a compact TALEN. These are single chain fusion proteins linking a TALE DNA binding domain to a TevI nuclease domain. The fusion protein can act as either a nickase localized by the TALE region, or can create a double strand break, depending upon where the TALE DNA binding domain is located with respect to the TevI nuclease domain (see Beurdeley et al (2013) Nat Comm: 1-8 DOI: 10.1038/ncomms2782). In addition, the nuclease domain may also exhibit DNA-binding functionality. Any TALENs may be used in combination with additional TALENs (e.g., one or more TALENs (cTALENs or FokI-TALENs) with one or more mega-TALEs.

    [0142] In addition, as disclosed in these and other references, zinc finger domains and/or multi-fingered zinc finger proteins or TALEs may be linked together using any suitable linker sequences, including for example, linkers of 5 or more amino acids in length. See, also, U.S. Pat. Nos. 6,479,626; 6,903,185; and 7,153,949 for exemplary linker sequences 6 or more amino acids in length. The proteins described herein may include any combination of suitable linkers between the individual zinc fingers of the protein. In addition, enhancement of binding specificity for zinc finger binding domains has been described, for example, in U.S. Pat. No. 6,794,136. In certain embodiments, the DNA-binding domain is part of a CRISPR/Cas nuclease system, including a single guide RNA (sgRNA) DNA binding molecule that binds to DNA. See, e.g., U.S. Pat. No. 8,697,359 and U.S. Patent Publication Nos. 20150056705 and 20150159172. The CRISPR (clustered regularly interspaced short palindromic repeats) locus, which encodes RNA components of the system, and the cas (CRISPR-associated) locus, which encodes proteins (Jansen et al., 2002. Mol. Microbiol. 43: 1565-1575; Makarova et al., 2002. Nucleic Acids Res. 30: 482-496; Makarova et al., 2006. Biol. Direct 1: 7; Haft et al., 2005. PLoS Comput. Biol. 1: e60) make up the gene sequences of the CRISPR/Cas nuclease system. CRISPR loci in microbial hosts contain a combination of CRISPR-associated (Cas) genes as well as non-coding RNA elements capable of programming the specificity of the CRISPR-mediated nucleic acid cleavage.

    [0143] In some embodiments, the DNA binding domain is part of a TtAgo system (see Swarts et al, ibid; Sheng et al, ibid). In eukaryotes, gene silencing is mediated by the Argonaute (Ago) family of proteins. In this paradigm, Ago is bound to small (19-31 nt) RNAs. This protein-RNA silencing complex recognizes target RNAs via Watson-Crick base pairing between the small RNA and the target and endonucleolytically cleaves the target RNA (Vogel (2014) Science 344:972-973). In contrast, prokaryotic Ago proteins bind to small single-stranded DNA fragments and likely function to detect and remove foreign (often viral) DNA (Yuan et al., (2005) Mol. Cell 19, 405; Olovnikov, et al. (2013) Mol. Cell 51, 594; Swarts et al., ibid). Exemplary prokaryotic Ago proteins include those from Aquifex aeolicus, Rhodobacter sphaeroides, and Thermus thermophilus.

    [0144] One of the most well-characterized prokaryotic Ago protein is the one from T. thermophilus (TtAgo; Swarts et al. ibid). TtAgo associates with either 15 nt or 13-25 nt single-stranded DNA fragments with 5 phosphate groups. This guide DNA bound by TtAgo serves to direct the protein-DNA complex to bind a Watson-Crick complementary DNA sequence in a third-party molecule of DNA. Once the sequence information in these guide DNAs has allowed identification of the target DNA, the TtAgo-guide DNA complex cleaves the target DNA. Such a mechanism is also supported by the structure of the TtAgo-guide DNA complex while bound to its target DNA (G. Sheng et al., ibid). Ago from Rhodobacter sphaeroides (RsAgo) has similar properties (Olivnikov et al. ibid).

    [0145] Exogenous guide DNAs of arbitrary DNA sequence can be loaded onto the TtAgo protein (Swarts et al. ibid.). Since the specificity of TtAgo cleavage is directed by the guide DNA, a TtAgo-DNA complex formed with an exogenous, investigator-specified guide DNA will therefore direct TtAgo target DNA cleavage to a complementary investigator-specified target DNA. In this way, one may create a targeted double-strand break in DNA. Use of the TtAgo-guide DNA system (or orthologous Ago-guide DNA systems from other organisms) allows for targeted cleavage of genomic DNA within cells. Such cleavage can be either single- or double-stranded. For cleavage of mammalian genomic DNA, it would be preferable to use of a version of TtAgo codon optimized for expression in mammalian cells. Further, it might be preferable to treat cells with a TtAgo-DNA complex formed in vitro where the TtAgo protein is fused to a cell-penetrating peptide. Further, it might be preferable to use a version of the TtAgo protein that has been altered via mutagenesis to have improved activity at 37 C. Ago-RNA-mediated DNA cleavage could be used to affect a panoply of outcomes including gene knock-out, targeted gene addition, gene correction, targeted gene deletion using techniques standard in the art for exploitation of DNA breaks.

    [0146] Thus, any DNA-binding molecule/domain can be used.

    [0147] Fusion Molecules

    [0148] Fusion molecules comprising DNA-binding domains (e.g., ZFPs or TALEs, CRISPR/Cas components such as single guide RNAs) as described herein and a heterologous regulatory (functional) domain (or functional fragment thereof) are also provided. Common domains include, e.g., transcription factor domains (activators, repressors, co-activators, co-repressors), silencers, oncogenes (e.g., myc, jun, fos, myb, max, mad, rel, ets, bcl, myb, mos family members etc.); DNA repair enzymes and their associated factors and modifiers; DNA rearrangement enzymes and their associated factors and modifiers; chromatin associated proteins and their modifiers (e.g. kinases, acetylases and deacetylases); and DNA modifying enzymes (e.g., methyltransferases, topoisomerases, helicases, ligases, kinases, phosphatases, polymerases, endonucleases) and their associated factors and modifiers. U.S. Patent Publication Nos. 20050064474; 20060188987 and 2007/0218528 for details regarding fusions of DNA-binding domains and nuclease cleavage domains, incorporated by reference in their entireties herein.

    [0149] Suitable domains for achieving activation include the HSV VP16 activation domain (see, e.g., Hagmann et al., J. Virol. 71, 5952-5962 (1997)) nuclear hormone receptors (see, e.g., Torchia et al., Curr. Opin. Cell. Biol. 10:373-383 (1998)); the p65 subunit of nuclear factor kappa B (Bitko & Barik, J Virol. 72:5610-5618 (1998) and Doyle & Hunt, Neuroreport 8:2937-2942 (1997)); Liu et al., Cancer Gene Ther. 5:3-28 (1998)), or artificial chimeric functional domains such as VP64 (Beerli et al., (1998) Proc. Natl. Acad. Sci. USA 95:14623-33), and degron (Molinari et al., (1999) EMBO J. 18, 6439-6447). Additional exemplary activation domains include, Oct 1, Oct-2A, Sp1, AP-2, and CTF1 (Seipel et al., EMBO J. 11, 4961-4968 (1992) as well as p300, CBP, PCAF, SRC1 PvALF, AtHD2A and ERF-2. See, for example, Robyr et al. (2000) Mol. Endocrinol. 14:329-347; Collingwood et al. (1999) J. Mol. Endocrinol. 23:255-275; Leo et al. (2000) Gene 245:1-11; Manteuffel-Cymborowska (1999) Acta Biochim. Pol. 46:77-89; McKenna et al. (1999) J. Steroid Biochem. Mol. Biol. 69:3-12; Malik et al. (2000) Trends Biochem. Sci. 25:277-283; and Lemon et al. (1999) Curr. Opin. Genet. Dev. 9:499-504. Additional exemplary activation domains include, but are not limited to, OsGAI, HALF-1, C1, AP1, ARF-5,-6,-7, and -8, CPRF1, CPRF4, MYC-RP/GP, and TRAB1. See, for example, Ogawa et al. (2000) Gene 245:21-29; Okanami et al. (1996) Genes Cells 1:87-99; Goff et al. (1991) Genes Dev. 5:298-309; Cho et al. (1999) Plant Mol. Biol. 40:419-429; Ulmason et al. (1999) Proc. Natl. Acad. Sci. USA 96:5844-5849; Sprenger-Haussels et al. (2000) Plant J. 22:1-8; Gong et al. (1999) Plant Mol. Biol. 41:33-44; and Hobo et al. (1999) Proc. Natl. Acad. Sci. USA 96:15,348-15,353.

    [0150] It will be clear to those of skill in the art that, in the formation of a fusion molecule (or a nucleic acid encoding same) between a DNA-binding domain and a functional domain, either an activation domain or a molecule that interacts with an activation domain is suitable as a functional domain. Essentially any molecule capable of recruiting an activating complex and/or activating activity (such as, for example, histone acetylation) to the target gene is useful as an activating domain of a fusion protein. Insulator domains, localization domains, and chromatin remodeling proteins such as ISWI-containing domains and/or methyl binding domain proteins suitable for use as functional domains in fusion molecules are described, for example, in U.S. Patent Publications 2002/0115215 and 2003/0082552 and in WO 02/44376.

    [0151] Exemplary repression domains include, but are not limited to, KRAB A/B, KOX, TGF-beta-inducible early gene (TIEG), v-erbA, SID, MBD2, MBD3, members of the DNMT family (e.g., DNMT1, DNMT3A, DNMT3B), Rb, and MeCP2. See, for example, Bird et al. (1999) Cell 99:451-454; Tyler et al. (1999) Cell 99:443-446; Knoepfler et al. (1999) Cell 99:447-450; and Robertson et al. (2000) Nature Genet. 25:338-342. Additional exemplary repression domains include, but are not limited to, ROM2 and AtHD2A. See, for example, Chem et al. (1996) Plant Cell 8:305-321; and Wu et al. (2000) Plant J. 22:19-27.

    [0152] Fusion molecules are constructed by methods of cloning and biochemical conjugation that are well known to those of skill in the art. Fusion molecules comprise a DNA-binding domain and a functional domain (e.g., a transcriptional activation or repression domain). Fusion molecules also optionally comprise nuclear localization signals (such as, for example, that from the SV40 medium T-antigen) and epitope tags (such as, for example, FLAG and hemagglutinin). Fusion molecules (and nucleic acids encoding them) are designed such that the translational reading frame is preserved among the components of the fusion.

    [0153] Fusions between a polypeptide component of a functional domain (or a functional fragment thereof) on the one hand, and a non-protein DNA-binding domain (e.g., antibiotic, intercalator, minor groove binder, nucleic acid) on the other, are constructed by methods of biochemical conjugation known to those of skill in the art. See, for example, the Pierce Chemical Company (Rockford, Ill.) Catalogue. Methods and compositions for making fusions between a minor groove binder and a polypeptide have been described. Mapp et al. (2000) Proc. Natl. Acad. Sci. USA 97:3930-3935. Furthermore, single guide RNAs of the CRISPR/Cas system associate with functional domains to form active transcriptional regulators and nucleases.

    [0154] In certain embodiments, the target site is present in an accessible region of cellular chromatin. Accessible regions can be determined as described, for example, in U.S. Pat. Nos. 7,217,509 and 7,923,542. If the target site is not present in an accessible region of cellular chromatin, one or more accessible regions can be generated as described in U.S. Pat. Nos. 7,785,792 and 8,071,370. In additional embodiments, the DNA-binding domain of a fusion molecule is capable of binding to cellular chromatin regardless of whether its target site is in an accessible region or not. For example, such DNA-binding domains are capable of binding to linker DNA and/or nucleosomal DNA. Examples of this type of pioneer DNA binding domain are found in certain steroid receptor and in hepatocyte nuclear factor 3 (HNF3) (Cordingley et al. (1987) Cell 48:261-270; Pina et al. (1990) Cell 60:719-731; and Cirillo et al. (1998) EMBO J. 17:244-254). The target sites for the fusion molecules (e.g., artificial nucleases) as described herein may be 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more contiguous or non-contiguous base pairs in length.

    [0155] The fusion molecule may be formulated with a pharmaceutically acceptable carrier, as is known to those of skill in the art. See, for example, Remington's Pharmaceutical Sciences, 17th ed., 1985; and U.S. Pat. Nos. 6,453,242 and 6,534,261.

    [0156] The functional component/domain of a fusion molecule can be selected from any of a variety of different components capable of influencing transcription of a gene once the fusion molecule binds to a target sequence via its DNA binding domain. Hence, the functional component can include, but is not limited to, various transcription factor domains, such as activators, repressors, co-activators, co-repressors, and silencers.

    [0157] Additional exemplary functional domains are disclosed, for example, in U.S. Pat. Nos. 6,534,261 and 6,933,113.

    [0158] Functional domains that are regulated by exogenous small molecules or ligands may also be selected. For example, RheoSwitch technology may be employed wherein a functional domain only assumes its active conformation in the presence of the external RheoChem ligand (see for example US 20090136465). Thus, the ZFP may be operably linked to the regulatable functional domain wherein the resultant activity of the ZFP-TF is controlled by the external ligand.

    [0159] Nucleases

    [0160] In certain embodiments, the fusion molecules comprise a DNA-binding binding domain and cleavage (nuclease) domain to form an artificial nuclease. As such, gene modification can be achieved using a nuclease, for example an engineered nuclease. Engineered nuclease technology is based on the engineering of naturally occurring DNA-binding proteins. For example, engineering of homing endonucleases with tailored DNA-binding specificities has been described. Chames et al. (2005) Nucleic Acids Res 33(20):e178; Arnould et al. (2006) J. Mol. Biol. 355:443-458. In addition, engineering of ZFPs has also been described. See, e.g., U.S. Pat. Nos. 6,534,261; 6,607,882; 6,824,978; 6,979,539; 6,933,113; 7,163,824; and 7,013,219.

    [0161] In addition, ZFPs and/or TALEs have been fused to nuclease domains to create ZFNs and TALENsa functional entity that is able to recognize its intended nucleic acid target through its engineered (ZFP or TALE) DNA binding domain and cause the DNA to be cut near the DNA binding site via the nuclease activity. See, e.g., Kim et al. (1996) Proc Nat'l Acad Sci USA 93(3):1156-1160. More recently, such nucleases have been used for genome modification in a variety of organisms. See, for example, United States Patent Publications 20030232410; 20050208489; 20050026157; 20050064474; 20060188987; 20060063231; and International Publication WO 07/014275.

    [0162] Thus, the methods and compositions described herein are broadly applicable and may involve any nuclease of interest. Non-limiting examples of nucleases include meganucleases, TALENs and zinc finger nucleases. The nuclease may comprise heterologous DNA-binding and cleavage domains (e.g., zinc finger nucleases; meganuclease DNA-binding domains with heterologous cleavage domains) or, alternatively, the DNA-binding domain of a naturally-occurring nuclease may be altered to bind to a selected target site (e.g., a meganuclease that has been engineered to bind to site different than the cognate binding site).

    [0163] In certain embodiments, the ZFN comprises first and second (left and right) ZFNs as described in any of the appended Tables or Figures. In certain embodiments, the first ZFN comprises the ZFN designated 71557 and the second ZFN comprises the ZFN designated 71728. In certain embodiments, the ZFN designated 71557 is carried on an AAV vector, for example an AAV vector comprising the sequences shown in Table 4 and/or the sequence as shown in SEQ ID NO:43. In other embodiments, the ZFN designated 71728 is carried on an AAV vector, for example an AAV vector comprising the sequences shown in Table 5 and/or SEQ ID NO:56.

    [0164] In any of the nucleases described herein, the nuclease can comprise an engineered TALE DNA-binding domain and a nuclease domain (e.g., endonuclease and/or meganuclease domain), also referred to as TALENs. Methods and compositions for engineering these TALEN proteins for robust, site specific interaction with the target sequence of the user's choosing have been published (see U.S. Pat. No. 8,586,526). In some embodiments, the TALEN comprises an endonuclease (e.g., FokI) cleavage domain or cleavage half-domain. In other embodiments, the TALE-nuclease is a mega TAL. These mega TAL nucleases are fusion proteins comprising a TALE DNA binding domain and a meganuclease cleavage domain. The meganuclease cleavage domain is active as a monomer and does not require dimerization for activity. (See Boissel et al., (2013) Nucl Acid Res: 1-13, doi: 10.1093/nar/gkt1224). In addition, the nuclease domain may also exhibit DNA-binding functionality.

    [0165] In still further embodiments, the nuclease comprises a compact TALEN (cTALEN). These are single chain fusion proteins linking a TALE DNA binding domain to a TevI nuclease domain. The fusion protein can act as either a nickase localized by the TALE region, or can create a double strand break, depending upon where the TALE DNA binding domain is located with respect to the TevI nuclease domain (see Beurdeley et al (2013) Nat Comm: 1-8 DOI: 10.1038/ncomms2782). Any TALENs may be used in combination with additional TALENs (e.g., one or more TALENs (cTALENs or FokI-TALENs) with one or more mega-TALs) or other DNA cleavage enzymes.

    [0166] In certain embodiments, the nuclease comprises a meganuclease (homing endonuclease) or a portion thereof that exhibits cleavage activity. Naturally-occurring meganucleases recognize 15-40 base-pair cleavage sites and are commonly grouped into four families: the LAGLIDADG family (LAGLIDADG disclosed as SEQ ID NO: 70), the GIY-YIG family, the His-Cyst box family and the HNH family. Exemplary homing endonucleases include I-SceI, I-CeuI, PI-PspI, PI-Sce, I-SceIV, I-CsmI, I-PanI, I-SceII, I-PpoI, I-SceIII, I-CreI, I-TevI, I-TevII and I-TevIII. Their recognition sequences are known. See also U.S. Pat. Nos. 5,420,032; 6,833,252; Belfort et al. (1997) Nucleic Acids Res. 25:3379-3388; Dujon et al. (1989) Gene 82:115-118; Perler et al. (1994) Nucleic Acids Res. 22, 1125-1127; Jasin (1996) Trends Genet. 12:224-228; Gimble et al. (1996) J. Mol. Biol. 263:163-180; Argast et al. (1998) J. Mol. Biol. 280:345-353 and the New England Biolabs catalogue.

    [0167] DNA-binding domains from naturally-occurring meganucleases, primarily from the LAGLIDADG family (LAGLIDADG disclosed as SEQ ID NO: 70), have been used to promote site-specific genome modification in plants, yeast, Drosophila, mammalian cells and mice, but this approach has been limited to the modification of either homologous genes that conserve the meganuclease recognition sequence (Monet et al. (1999), Biochem. Biophysics. Res. Common. 255: 88-93) or to pre-engineered genomes into which a recognition sequence has been introduced (Route et al. (1994), Mol. Cell. Biol. 14: 8096-106; Chilton et al. (2003), Plant Physiology. 133: 956-65; Puchta et al. (1996), Proc. Natl. Acad. Sci. USA 93: 5055-60; Rong et al. (2002), Genes Dev. 16: 1568-81; Gouble et al. (2006), J. Gene Med. 8(5):616-622). Accordingly, attempts have been made to engineer meganucleases to exhibit novel binding specificity at medically or biotechnologically relevant sites (Porteus et al. (2005), Nat. Biotechnol. 23: 967-73; Sussman et al. (2004), J. Mol. Biol. 342: 31-41; Epinat et al. (2003), Nucleic Acids Res. 31: 2952-62; Chevalier et al. (2002) Molec. Cell 10:895-905; Epinat et al. (2003) Nucleic Acids Res. 31:2952-2962; Ashworth et al. (2006) Nature 441:656-659; Paques et al. (2007) Current Gene Therapy 7:49-66; U.S. Patent Publication Nos. 20070117128; 20060206949; 20060153826; 20060078552; and 20040002092). In addition, naturally-occurring or engineered DNA-binding domains from meganucleases can be operably linked with a cleavage domain from a heterologous nuclease (e.g., FokI) and/or cleavage domains from meganucleases can be operably linked with a heterologous DNA-binding domain (e.g., ZFP or TALE).

    [0168] In other embodiments, the nuclease is a zinc finger nuclease (ZFN) or TALE DNA binding domain-nuclease fusion (TALEN). ZFNs and TALENs comprise a DNA binding domain (zinc finger protein or TALE DNA binding domain) that has been engineered to bind to a target site in a gene of choice and cleavage domain or a cleavage half-domain (e.g., from a restriction and/or meganuclease as described herein).

    [0169] As described in detail above, zinc finger binding domains and TALE DNA binding domains can be engineered to bind to a sequence of choice. See, for example, Beerli et al. (2002) Nature Biotechnol. 20:135-141; Pabo et al. (2001) Ann. Rev. Biochem. 70:313-340; Isalan et al. (2001) Nature Biotechnol. 19:656-660; Segal et al. (2001) Curr. Opin. Biotechnol. 12:632-637; Choo et al. (2000) Curr. Opin. Struct. Biol. 10:411-416. An engineered zinc finger binding domain or TALE protein can have a novel binding specificity, compared to a naturally-occurring protein. Engineering methods include, but are not limited to, rational design and various types of selection. Rational design includes, for example, using databases comprising triplet (or quadruplet) nucleotide sequences and individual zinc finger or TALE amino acid sequences, in which each triplet or quadruplet nucleotide sequence is associated with one or more amino acid sequences of zinc fingers or TALE repeat units which bind the particular triplet or quadruplet sequence. See, for example, U.S. Pat. Nos. 6,453,242 and 6,534,261, incorporated by reference herein in their entireties.

    [0170] Selection of target sites; and methods for design and construction of fusion molecules (and polynucleotides encoding same) are known to those of skill in the art and described in detail in U.S. Pat. Nos. 7,888,121 and 8,409,861, incorporated by reference in their entireties herein.

    [0171] In addition, as disclosed in these and other references, zinc finger domains, TALEs and/or multi-fingered zinc finger proteins may be linked together using any suitable linker sequences, including for example, linkers of 5 or more amino acids in length. See, e.g., U.S. Pat. Nos. 6,479,626; 6,903,185; and 7,153,949 for exemplary linker sequences 6 or more amino acids in length. The proteins described herein may include any combination of suitable linkers between the individual zinc fingers of the protein and/or between the DNA-binding domain and the nuclease domain. See, also, U.S. Pat. Nos. 8,772,453 and 9,567,609.

    [0172] Thus, nucleases such as ZFNs, TALENs and/or meganucleases can comprise any DNA-binding domain and any nuclease (cleavage) domain (cleavage domain, cleavage half-domain). As noted above, the cleavage domain may be heterologous to the DNA-binding domain, for example a zinc finger or TAL-effector DNA-binding domain and a cleavage domain from a nuclease or a meganuclease DNA-binding domain and cleavage domain from a different nuclease. Heterologous cleavage domains can be obtained from any endonuclease or exonuclease. Exemplary endonucleases from which a cleavage domain can be derived include, but are not limited to, restriction endonucleases and homing endonucleases. See, for example, 2002-2003 Catalogue, New England Biolabs, Beverly, Mass.; and Belfort et al. (1997) Nucleic Acids Res. 25:3379-3388. Additional enzymes which cleave DNA are known (e.g., 51 Nuclease; mung bean nuclease; pancreatic DNase I; micrococcal nuclease; yeast HO endonuclease; see also Linn et al. (eds.) Nucleases, Cold Spring Harbor Laboratory Press,1993). One or more of these enzymes (or functional fragments thereof) can be used as a source of cleavage domains and cleavage half-domains.

    [0173] Similarly, a cleavage half-domain can be derived from any nuclease or portion thereof, as set forth above, that requires dimerization for cleavage activity. In general, two fusion molecules are required for cleavage if the fusion molecules comprise cleavage half-domains. Alternatively, a single protein comprising two cleavage half-domains can be used. The two cleavage half-domains can be derived from the same endonuclease (or functional fragments thereof), or each cleavage half-domain can be derived from a different endonuclease (or functional fragments thereof). In addition, the target sites for the two fusion molecules are preferably disposed, with respect to each other, such that binding of the two fusion molecules to their respective target sites places the cleavage half-domains in a spatial orientation to each other that allows the cleavage half-domains to form a functional cleavage domain, e.g., by dimerizing. Thus, in certain embodiments, the near edges of the paired target sites are separated by 5-10 nucleotides or by 15-18 nucleotides. However, any integral number of nucleotides or nucleotide pairs can intervene between two target sites (e.g., from 2 to 50 nucleotide pairs or more). In general, the site of cleavage lies between the target sites.

    [0174] Restriction endonucleases (restriction enzymes) are present in many species and are capable of sequence-specific binding to DNA (at a recognition site), and cleaving DNA at or near the site of binding. Certain restriction enzymes (e.g., Type IIS) cleave DNA at sites removed from the recognition site and have separable binding and cleavage domains. For example, the Type IIS enzyme FokI catalyzes double-stranded cleavage of DNA, at 9 nucleotides from its recognition site on one strand and 13 nucleotides from its recognition site on the other. See, for example, U.S. Pat. Nos. 5,356,802; 5,436,150 and 5,487,994; as well as Li et al. (1992) Proc. Natl. Acad. Sci. USA 89:4275-4279; Li et al. (1993) Proc. Natl. Acad. Sci. USA 90:2764-2768; Kim et al. (1994a) Proc. Natl. Acad. Sci. USA 91:883-887; Kim et al. (1994b) J. Biol. Chem. 269:31,978-31,982. Thus, in one embodiment, fusion molecules comprise the cleavage domain (or cleavage half-domain) from at least one Type IIS restriction enzyme and one or more zinc finger binding domains, which may or may not be engineered.

    [0175] An exemplary Type IIS restriction enzyme, whose cleavage domain is separable from the binding domain, is FokI. This particular enzyme is active as a dimer. Bitinaite et al. (1998) Proc. Natl. Acad. Sci. USA 95: 10,570-10,575. Accordingly, for the purposes of the present disclosure, the portion of the FokI enzyme used in the disclosed fusion molecules is considered a cleavage half-domain. Thus, for targeted double-stranded cleavage and/or targeted replacement of cellular sequences using zinc finger-FokI fusions, two fusion molecules, each comprising a FokI cleavage half-domain, can be used to reconstitute a catalytically active cleavage domain. Alternatively, a single polypeptide molecule containing a zinc finger binding domain and two FokI cleavage half-domains can also be used. Parameters for targeted cleavage and targeted sequence alteration using zinc finger-FokI fusions are provided elsewhere in this disclosure.

    [0176] A cleavage domain or cleavage half-domain can be any portion of a protein that retains cleavage activity, or that retains the ability to multimerize (e.g., dimerize) to form a functional cleavage domain.

    [0177] Exemplary Type IIS restriction enzymes are described in International Publication WO 07/014275, incorporated herein in its entirety. Additional restriction enzymes also contain separable binding and cleavage domains, and these are contemplated by the present disclosure. See, for example, Roberts et al. (2003) Nucleic Acids Res. 31:418-420.

    [0178] In certain embodiments, the cleavage domain comprises a FokI cleavage domain used to generate the crystal structures 1FOK.pdb and 2FOK.pdb (see Wah et al (1997) Nature 388:97-100). The sequence of the full-length FokI is shown below. The cleavage domain used in the nucleases described herein is shown in italics and underlining (positions 384 to 579 of the full-length protein) where the holo protein sequence is described below (SEQ ID NO:2):

    TABLE-US-00001 (SEQIDNO:2) MVSKIRTFGWVQNPGKFENLKRVVQVFDRNSKVHNEVKNIKIPTLVKES KIQKELVAIMNQHDLIYTYKELVGTGTSIRSEAPCDAIIQATIADQGNK KGYIDNWSSDGFLRWAHALGFIEYINKSDSFVITDVGLAYSKSADGSAI EKEILIEAISSYPPAIRILTLLEDGQHLTKFDLGKNLGFSGESGFTSLP EGILLDTLANAMPKDKGEIRNNWEGSSDKYARMIGGWLDKLGLVKQGKK EFIIPTLGKPDNKEFISHAFKITGEGLKVLRRAKGSTKFTRVPKRVYWE MLATNLTDKEYVRTRRALILEILIKAGSLKIEQIQDNLKKLGFDEVIET IENDIKGLINTGIFIEIKGRFYQLKDHILQFVIPNRGVTKQLVKSELEE KKSELRHKLKYVPHEYIELIEIARNSTQDRILEAIKVMEFFMKVYGYRG KHLGGSRKPDGAIYTVGSPIDYGVIVDTKAYSGGYNLPIGQADEAVRYV EENQTRNKHINPNEWWKVYPSSVTEFKFLFVSGHFKGNYKAQLTRLNHI TNCNGAVLSVEELLIGGEMIKAGTLTLEEVRRKFNNGEINF

    [0179] Cleavage half domains derived from FokI may comprise a mutation in one or more of amino acid residues as shown in SEQ ID NO:2. Mutations include substitutions (of a wild-type amino acid residue for a different residue, insertions (of one or more amino acid residues) and/or deletions (of one or more amino acid residues). In certain embodiments, one or more of residues 414-426, 443-450, 467-488, 501-502, and/or 521-531 (numbered relative to SEQ ID NO:2) are mutated since these residues are located close to the DNA backbone in a molecular model of a ZFN bound to its target site described in Miller et al. ((2007) Nat Biotechnol 25:778-784 Non-limiting examples of FokI mutants include one or more mutations as described herein U.S. Patent Publication No. 20180087072, including but not limited one or more residues at positions 416, 421, 422, 424, 472, 478, 480, 525 or 542 are mutated. In certain embodiments, the mutation comprises a substitution of a wild-type residue with any different residue, for example an alanine (A) residue, a cysteine (C) residue, an aspartic acid (D) residue, a glutamic acid (E) residue, a histidine (H) residue, a phenylalanine (F) residue, a glycine (G) residue, an asparagine (N) residue, a serine (S) residue or a threonine (T) residue. In other embodiments, the wild-type residue at one or more of positions 416, 418, 421, 422, 424, 446, 448, 472, 476, 478, 479, 480, 481, 525 and/or 542 are replaced with any other residues, including but not limited to, R416D, R416E, S418E, S418D, R422H, S446D, K448A, N476D, P478S, I479Q, I479T, G480D, Q481A, Q481E, K525S, K525A, N527D, N542D, R416E+R422H, R416D+R422H, R416E+K448A, R416D+R422H, K448A+I479Q, K448A+Q481A. K448A+K525A,R416E, R416D, R416H, R416N, S418D, S418E, D421S, L424F, S446D, K448A, S472D, N476E, N476G, N476K, P478D, I479Q, I479T, G480D, Q481A, Q481C, Q481D, Q481S, Q481E Q481H, K525A, K525C, K525AE, K5251, K525S, K525T, K525V, and/or N542D.

    [0180] In certain embodiments, the cleavage domain comprises one or more engineered cleavage half-domain (also referred to as dimerization domain mutants) that minimize or prevent homodimerization, as described, for example, in U.S. Pat. Nos. 7,914,796; 8,034,598 and 8,623,618; and U.S. Patent Publication No. 20110201055, the disclosures of all of which are incorporated by reference in their entireties herein. Amino acid residues at positions 446, 447, 478, 479, 483, 484, 486, 487, 490, 491, 496, 498, 499, 500, 531, 534, 537, 538 and 542 of FokI (numbered relative to SEQ ID NO:2) are all targets for influencing dimerization of the FokI cleavage half-domains. The mutations may include mutations to residues found in natural restriction enzymes homologous to FokI. In a preferred embodiment, the mutation at positions 416, 422, 447, 448, 478, 525 and/or 542 (numbered relative to SEQ ID NO:2) comprise replacement of a positively charged amino acid with an uncharged or a negatively charged amino acid. In another embodiment, the engineered cleavage half domain comprises mutations in amino acid residues 499, 496 and 486 in addition to the mutations in one or more amino acid residues 416, 422, 447, 448, or 525, all numbered relative to SEQ ID NO:2.

    [0181] In certain embodiments, the compositions described herein include engineered cleavage half-domains of FokI that form obligate heterodimers as described, for example, in U.S. Pat. Nos. 7,914,796; 8,034,598; 8,961,281 and 8,623,618; U.S. Patent Publication Nos. 20080131962 and 20120040398. Thus, in one preferred embodiment, the invention provides fusion molecules wherein the engineered cleavage half-domain comprises a polypeptide in which the wild-type Gln (Q) residue at position 486 is replaced with a Glu (E) residue, the wild-type Ile (I) residue at position 499 is replaced with a Leu (L) residue and the wild-type Asn (N) residue at position 496 is replaced with an Asp (D) or a Glu (E) residue (ELD or ELE) in addition to one or more mutations at positions 416, 422, 447, 448, or 525 (numbered relative to SEQ ID NO:2). In another embodiment, the engineered cleavage half domains are derived from a wild-type FokI cleavage half domain and comprise mutations in the amino acid residues 490, 538 and 537, numbered relative to wild-type FokI (SEQ ID NO:2) in addition to the one or more mutations at amino acid residues 416, 422, 447, 448, or 525. In a preferred embodiment, the invention provides a fusion molecules, wherein the engineered cleavage half-domain comprises a polypeptide in which the wild-type Glu (E) residue at position 490 is replaced with a Lys (K) residue, the wild-type Ile (I) residue at position 538 is replaced with a Lys (K) residue, and the wild-type His (H) residue at position 537 is replaced with a Lys (K) residue or an Arg (R) residue (KKK or KKR) (see U.S. Pat. No. 8,962,281, incorporated by reference herein) in addition to one or more mutations at positions 416, 422, 447, 448, or 525. See, e.g., U.S. Pat. Nos. 7,914,796; 8,034,598 and 8,623,618, the disclosures of which are incorporated by reference in its entirety for all purposes. In other embodiments, the wild-type Asn (N) residue at position 542 is replaced with an Asp (D) residue or the wild-type Pro (P) residue at position 478 is replaced with a Ser (S) residue. In other embodiments, the engineered cleavage half domain comprises the Sharkey and/or Sharkey mutations (see Guo et al, (2010) J. Mol. Biol. 400(1):96-107).

    [0182] In another embodiment, the engineered cleavage half domains are derived from a wild-type FokI cleavage half domain and comprise mutations in the amino acid residues 490, and 538, numbered relative to wild-type FokI or a FokI homologue in addition to the one or more mutations at amino acid residues 416, 422, 447, 448, or 525. In a preferred embodiment, the invention provides a fusion molecule, wherein the engineered cleavage half-domain comprises a polypeptide in which the wild-type Glu (E) residue at position 490 is replaced with a Lys (K) residue, and the wild-type Ile (I) residue at position 538 is replaced with a Lys (K) residue (KK) in addition to one or more mutations at positions 416, 422, 447, 448, or 525. In a preferred embodiment, the invention provides a fusion molecule, wherein the engineered cleavage half-domain comprises a polypeptide in which the wild-type Gln (Q) residue at position 486 is replaced with an Glu (E) residue, and the wild-type Ile (I) residue at position 499 is replaced with a Leu (L) residue (EL) (See U.S. Pat. No. 8,034,598, incorporated by reference herein) in addition to one or more mutations at positions 416, 422, 447, 448, or 525.

    [0183] In one aspect, the invention provides a fusion molecule wherein the engineered cleavage half-domain comprises a polypeptide in which the wild-type amino acid residue at one or more of positions 387, 393, 394, 398, 400, 402, 416, 422, 427, 434, 439, 441, 447, 448, 469, 478, 487, 495, 497, 506, 516, 525, 529, 534, 542, 559, 569, 570, 571 in the FokI catalytic domain are mutated. Nuclease domains comprising one or more mutations as shown in any of the appended Tables and Figures are provided. In some embodiments, the one or more mutations alter the wild type amino acid from a positively charged residue to a neutral residue or a negatively charged residue. In any of these embodiments, the mutants described may also be made in a FokI domain comprising one or more additional mutations. In preferred embodiments, these additional mutations are in the dimerization domain, e.g. at positions 418, 432, 441, 481, 483, 486, 487, 490, 496, 499, 523, 527, 537, 538 and/or 559. Non-limiting examples of mutations include mutations (e.g., substitutions) of the wild-type residues of any cleavage domain (e.g., FokI or homologue of FokI) at positions 393, 394, 398, 416, 421, 422, 442, 444, 472, 473, 478, 480, 525 or 530 with any amino acid residue (e.g., K393X, K394X, R398X, R416S, D421X, R422X, K444X, S472X, G473X, 5472, P478X, G480X, K525X, A530X and/or, N542X, where the first residue depicts wild-type and X refers to any amino acid that is substituted for the wild-type residue). In some embodiments, X is E, D, H, A, K, S, T, D or N. Other exemplary mutations include S418E, S418D, S446D, K448A, P478S, I479Q, I479T, Q481A, Q481N, Q481E, A530E, A530K and/or N542D wherein the amino acid residues are numbered relative to full length FokI wild-type cleavage domain and homologues thereof. In certain embodiments, combinations may include 416 and 422, a mutation at position 416 and K448A, K448A and I479Q, K448A and Q481A and/or K448A and a mutation at position 525. In one embodiment, the wild-residue at position 416 may be replaced with a Glu (E) residue (R416E), the wild-type residue at position 422 is replaced with a His (H) residue (R422H), and the wild-type residue at position 525 is replaced with an Ala (A) residue. The cleavage domains as described herein can further include additional mutations, including but not limited to at positions 432, 441, 483, 486, 487, 490, 496, 499, 527, 537, 538 and/or 559, for example dimerization domain mutants (e.g., ELD, KKR) and or nickase mutants (mutations to the catalytic domain). The cleavage half-domains with the mutations described herein form heterodimers as known in the art.

    [0184] Alternatively, nucleases may be assembled in vivo at the nucleic acid target site using so-called split-enzyme technology (see e.g. U.S. Patent Publication No. 20090068164). Components of such split enzymes may be expressed either on separate expression constructs, or can be linked in one open reading frame where the individual components are separated, for example, by a self-cleaving 2A peptide or IRES sequence. Components may be individual zinc finger binding domains or domains of a meganuclease nucleic acid binding domain.

    [0185] Nucleases (e.g., ZFNs and/or TALENs) can be screened for activity prior to use, for example in a yeast-based chromosomal system as described in as described in U.S. Pat. No. 8,563,314.

    [0186] In certain embodiments, the nuclease comprises a CRISPR/Cas system. The CRISPR (clustered regularly interspaced short palindromic repeats) locus, which encodes RNA components of the system, and the Cas (CRISPR-associated) locus, which encodes proteins (Jansen et al., 2002. Mol. Microbiol. 43: 1565-1575; Makarova et al., 2002. Nucleic Acids Res. 30: 482-496; Makarova et al., 2006. Biol. Direct 1: 7; Haft et al., 2005. PLoS Comput. Biol. 1: e60) make up the gene sequences of the CRISPR/Cas nuclease system. CRISPR loci in microbial hosts contain a combination of CRISPR-associated (Cas) genes as well as non-coding RNA elements capable of programming the specificity of the CRISPR-mediated nucleic acid cleavage.

    [0187] The Type II CRISPR is one of the most well characterized systems and carries out targeted DNA double-strand break in four sequential steps. First, two non-coding RNA, the pre-crRNA array and tracrRNA, are transcribed from the CRISPR locus. Second, tracrRNA hybridizes to the repeat regions of the pre-crRNA and mediates the processing of pre-crRNA into mature crRNAs containing individual spacer sequences. Third, the mature crRNA:tracrRNA complex directs Cas9 to the target DNA via Watson-Crick base-pairing between the spacer on the crRNA and the protospacer on the target DNA next to the protospacer adjacent motif (PAM), an additional requirement for target recognition. Finally, Cas9 mediates cleavage of target DNA to create a double-stranded break within the protospacer. Activity of the CRISPR/Cas system comprises of three steps: (i) insertion of alien DNA sequences into the CRISPR array to prevent future attacks, in a process called adaptation, (ii) expression of the relevant proteins, as well as expression and processing of the array, followed by (iii) RNA-mediated interference with the alien nucleic acid. Thus, in the bacterial cell, several of the so-called Cas proteins are involved with the natural function of the CRISPR/Cas system and serve roles in functions such as insertion of the alien DNA etc.

    [0188] In some embodiments, the CRISPR-Cpf1 system is used. The CRISPR-Cpf1 system, identified in Francisella spp, is a class 2 CRISPR-Cas system that mediates robust DNA interference in human cells. Although functionally conserved, Cpf1 and Cas9 differ in many aspects including in their guide RNAs and substrate specificity (see Fagerlund et al, (2015) Genom Bio 16:251). A major difference between Cas9 and Cpf1 proteins is that Cpf1 does not utilize tracrRNA, and thus requires only a crRNA. The FnCpf1 crRNAs are 42-44 nucleotides long (19-nucleotide repeat and 23-25-nucleotide spacer) and contain a single stem-loop, which tolerates sequence changes that retain secondary structure. In addition, the Cpf1 crRNAs are significantly shorter than the 100-nucleotide engineered sgRNAs required by Cas9, and the PAM requirements for FnCpf1 are 5-TTN-3 and 5-CTA-3 on the displaced strand. Although both Cas9 and Cpf1 make double strand breaks in the target DNA, Cas9 uses its RuvC- and HNH-like domains to make blunt-ended cuts within the seed sequence of the guide RNA, whereas Cpf1 uses a RuvC-like domain to produce staggered cuts outside of the seed. Because Cpf1 makes staggered cuts away from the critical seed region, NHEJ will not disrupt the target site, therefore ensuring that Cpf1 can continue to cut the same site until the desired HDR recombination event has taken place. Thus, in the methods and compositions described herein, it is understood that the term Cas includes both Cas9 and Cfp1 proteins. Thus, as used herein, a CRISPR/Cas system refers both CRISPR/Cas and/or CRISPR/Cfp1 systems, including both nuclease and/or transcription factor systems.

    [0189] In certain embodiments, Cas protein may be a functional derivative of a naturally occurring Cas protein. A functional derivative of a native sequence polypeptide is a compound having a qualitative biological property in common with a native sequence polypeptide. Functional derivatives include, but are not limited to, fragments of a native sequence and derivatives of a native sequence polypeptide and its fragments, provided that they have a biological activity in common with a corresponding native sequence polypeptide. A biological activity contemplated herein is the ability of the functional derivative to hydrolyze a DNA substrate into fragments. The term derivative encompasses both amino acid sequence variants of polypeptide, covalent modifications, and fusions thereof such as derivative Cas proteins. Suitable derivatives of a Cas polypeptide or a fragment thereof include but are not limited to mutants, fusions, covalent modifications of Cas protein or a fragment thereof. Cas protein, which includes Cas protein or a fragment thereof, as well as derivatives of Cas protein or a fragment thereof, may be obtainable from a cell or synthesized chemically or by a combination of these two procedures. The cell may be a cell that naturally produces Cas protein, or a cell that naturally produces Cas protein and is genetically engineered to produce the endogenous Cas protein at a higher expression level or to produce a Cas protein from an exogenously introduced nucleic acid, which nucleic acid encodes a Cas that is same or different from the endogenous Cas. In some case, the cell does not naturally produce Cas protein and is genetically engineered to produce a Cas protein. In some embodiments, the Cas protein is a small Cas9 ortholog for delivery via an AAV vector (Ran et al (2015) Nature 510, p. 186).

    [0190] The nuclease(s) may make one or more double-stranded and/or single-stranded cuts in the target site. In certain embodiments, the nuclease comprises a catalytically inactive cleavage domain (e.g., FokI and/or Cas protein). See, e.g., U.S. Pat. Nos. 9,200,266; 8,703,489 and Guillinger et al. (2014) Nature Biotech. 32(6):577-582. The catalytically inactive cleavage domain may, in combination with a catalytically active domain act as a nickase to make a single-stranded cut. Therefore, two nickases can be used in combination to make a double-stranded cut in a specific region. Additional nickases are also known in the art, for example, McCaffery et al. (2016) Nucleic Acids Res. 44(2):ell. doi: 10.1093/nar/gkv878. Epub 2015 Oct. 19.

    [0191] In certain embodiments, the nuclease is a zinc finger nuclease comprising first and second (also referred to as left and right and partner) zinc finger nucleases, each comprising a zinc finger DNA-binding domain and a cleavage domain (e.g., engineered FokI). The ZFN may be carried by one or more AAV vectors. In certain embodiments, separate AAV vectors carry the left and right ZFNs of the nuclease. The AAV vector(s) may include additional coding and/or non-coding sequences, including but not limited to a 5 ITR, one or more enhancer sequences (e.g., ApoE enhancer), one or more promoter sequences (e.g., hAAT promoter), a 5 UTR, one or more intron sequences (e.g., human globin/IgG chimeric intron), an N-terminal peptide coding sequence, an NLS signal, one or more WPRE sequences (e.g., WPREmut6), a polyA signal and/or a 3ITR. Exemplary nuclease AAVs are shown in Tables 4 and 5 below. It will be apparent that one or more of the listed elements (excluding the ZFN-encoding sequences) may be omitted; replaced with analogous sequences (e.g., different promoter sequences, different WPRE sequences such as those known in the art or described in Example 4), different intron sequences, etc.); and/or additional elements may be added. The AAV vector(s) encoding the nucleases may be used in systems with donors, for instant 2 ZFN AAVs (e.g., left and right ZFN AAVs as disclosed in Table 4 and 5) in combination with a donor AAV, typically encoding a therapeutic peptide. The AAV donors can include one or more of the following elements: 5 and/or 3ITRs from any source; left and/or right homology arms (to albumin) flanking the transgene (therapeutic protein-encoding sequence of any length encoding any protein or functional fragment thereof) of any length; a splice acceptor sequence; and/or a polyadenylation (polyA) signal. In certain embodiments, the AAV donor encodes a Factor IX, IDS or IDUA protein, for example a donor as shown in Tables 6-8 below.

    Delivery

    [0192] The proteins (e.g., nucleases), polynucleotides and/or compositions comprising the proteins and/or polynucleotides described herein may be delivered to a target cell by any suitable means, including, for example, by injection of the protein and/or mRNA components.

    [0193] Suitable cells include but not limited to eukaryotic and prokaryotic cells and/or cell lines. Non-limiting examples of such cells or cell lines generated from such cells include T-cells, COS, CHO (e.g., CHO-S, CHO-K1, CHO-DG44, CHO-DUXB11, CHO-DUKX, CHOK1SV), VERO, MDCK, WI38, V79, B14AF28-G3, BHK, HaK, NS0, SP2/0-Ag14, HeLa, HEK293 (e.g., HEK293-F, HEK293-H, HEK293-T), and perC6 cells as well as insect cells such as Spodoptera fugiperda (Sf), or fungal cells such as Saccharomyces, Pichia and Schizosaccharomyces. In certain embodiments, the cell line is a CHO-K1, MDCK or HEK293 cell line. Suitable cells also include stem cells such as, by way of example, embryonic stem cells, induced pluripotent stem cells (iPS cells), hematopoietic stem cells, neuronal stem cells and mesenchymal stem cells.

    [0194] Methods of delivering proteins comprising DNA-binding domains as described herein are described, for example, in U.S. Pat. Nos. 6,453,242; 6,503,717; 6,534,261; 6,599,692; 6,607,882; 6,689,558; 6,824,978; 6,933,113; 6,979,539; 7,013,219; and 7,163,824, the disclosures of all of which are incorporated by reference herein in their entireties.

    [0195] DNA binding domains and fusion molecules comprising these DNA binding domains as described herein may also be delivered using vectors containing sequences encoding one or more of the DNA-binding protein(s). Additionally, additional nucleic acids (e.g., donors) also may be delivered via these vectors. Any vector systems may be used including, but not limited to, plasmid vectors, retroviral vectors, lentiviral vectors, adenovirus vectors, poxvirus vectors; herpesvirus vectors and adeno-associated virus vectors, etc. See, also, U.S. Pat. Nos. 6,534,261; 6,607,882; 6,824,978; 6,933,113; 6,979,539; 7,013,219; and 7,163,824, incorporated by reference herein in their entireties. Furthermore, it will be apparent that any of these vectors may comprise one or more DNA-binding protein-encoding sequences and/or additional nucleic acids as appropriate. Thus, when one or more DNA-binding proteins as described herein are introduced into the cell, and additional DNAs as appropriate, they may be carried on the same vector or on different vectors. When multiple vectors are used, each vector may comprise a sequence encoding one or multiple DNA-binding proteins and additional nucleic acids as desired.

    [0196] Conventional viral and non-viral based gene transfer methods can be used to introduce nucleic acids encoding engineered DNA-binding proteins in cells (e.g., mammalian cells) and target tissues and to co-introduce additional nucleotide sequences as desired. Such methods can also be used to administer nucleic acids (e.g., encoding DNA-binding proteins and/or donors) to cells in vitro. In certain embodiments, nucleic acids are administered for in vivo or ex vivo gene therapy uses. Non-viral vector delivery systems include DNA plasmids, naked nucleic acid, and nucleic acid complexed with a delivery vehicle such as a liposome or poloxamer. Viral vector delivery systems include DNA and RNA viruses, which have either episomal or integrated genomes after delivery to the cell. For a review of gene therapy procedures, see Anderson, Science 256:808-813 (1992); Nabel & Felgner, TIBTECH 11:211-217 (1993); Mitani & Caskey, TIBTECH 11:162-166 (1993); Dillon, TIBTECH 11:167-175 (1993); Miller, Nature 357:455-460 (1992); Van Brunt, Biotechnology 6(10):1149-1154 (1988); Vigne, Restorative Neurology and Neuroscience 8:35-36 (1995); Kremer & Perricaudet, British Medical Bulletin 51(1):31-44 (1995); Haddada et al., in Current Topics in Microbiology and Immunology Doerfler and Bohm (eds.) (1995); and Yu et al., Gene Therapy 1:13-26 (1994).

    [0197] Methods of non-viral delivery of nucleic acids include electroporation, lipofection, microinjection, biolistics, virosomes, liposomes, immunoliposomes, polycation or lipid:nucleic acid conjugates, naked DNA, mRNA, artificial virions, and agent-enhanced uptake of DNA. Sonoporation using, e.g., the Sonitron 2000 system (Rich-Mar) can also be used for delivery of nucleic acids. In a preferred embodiment, one or more nucleic acids are delivered as mRNA. Also preferred is the use of capped mRNAs to increase translational efficiency and/or mRNA stability. Especially preferred are ARCA (anti-reverse cap analog) caps or variants thereof. See U.S. Pat. Nos. 7,074,596 and 8,153,773, incorporated by reference herein.

    [0198] Additional exemplary nucleic acid delivery systems include those provided by Amaxa Biosystems (Cologne, Germany), Maxcyte, Inc. (Rockville, Md.), BTX Molecular Delivery Systems (Holliston, Mass.) and Copernicus Therapeutics Inc, (see for example U.S. Pat. No. 6,008,336). Lipofection is described in e.g., U.S. Pat. Nos. 5,049,386, 4,946,787; and 4,897,355) and lipofection reagents are sold commercially (e.g., Transfectam, Lipofectin, and Lipofectamine RNAiMAX). Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides include those of Felgner, WO 91/17424, WO 91/16024. Delivery can be to cells (ex vivo administration) or target tissues (in vivo administration).

    [0199] The preparation of lipid:nucleic acid complexes, including targeted liposomes such as immunolipid complexes, is well known to one of skill in the art (see, e.g., Crystal, Science 270:404-410 (1995); Blaese et al., Cancer Gene Ther. 2:291-297 (1995); Behr et al., Bioconjugate Chem. 5:382-389 (1994); Remy et al., Bioconjugate Chem. 5:647-654 (1994); Gao et al., Gene Therapy 2:710-722 (1995); Ahmad et al., Cancer Res. 52:4817-4820 (1992); U.S. Pat. Nos. 4,186,183, 4,217,344, 4,235,871, 4,261,975, 4,485,054, 4,501,728, 4,774,085, 4,837,028, and 4,946,787).

    [0200] Additional methods of delivery include the use of packaging the nucleic acids to be delivered into EnGeneIC delivery vehicles (EDVs). These EDVs are specifically delivered to target tissues using bispecific antibodies where one arm of the antibody has specificity for the target tissue and the other has specificity for the EDV. The antibody brings the EDVs to the target cell surface and then the EDV is brought into the cell by endocytosis. Once in the cell, the contents are released (see MacDiarmid et al (2009) Nature Biotechnology 27(7) p. 643).

    [0201] The use of RNA or DNA viral based systems for the delivery of nucleic acids encoding engineered DNA-binding proteins, and/or donors (e.g. CARs or ACTRs) as desired takes advantage of highly evolved processes for targeting a virus to specific cells in the body and trafficking the viral payload to the nucleus. Viral vectors can be administered directly to patients (in vivo) or they can be used to treat cells in vitro and the modified cells are administered to patients (ex vivo). Conventional viral based systems for the delivery of nucleic acids include, but are not limited to, retroviral, lentivirus, adenoviral, adeno-associated, vaccinia and herpes simplex virus vectors for gene transfer. Integration in the host genome is possible with the retrovirus, lentivirus, and adeno-associated virus gene transfer methods, often resulting in long term expression of the inserted transgene. Additionally, high transduction efficiencies have been observed in many different cell types and target tissues.

    [0202] The tropism of a retrovirus can be altered by incorporating foreign envelope proteins, expanding the potential target population of target cells. Lentiviral vectors are retroviral vectors that are able to transduce or infect non-dividing cells and typically produce high viral titers. Selection of a retroviral gene transfer system depends on the target tissue. Retroviral vectors are comprised of cis-acting long terminal repeats with packaging capacity for up to 6-10 kb of foreign sequence. The minimum cis-acting LTRs are sufficient for replication and packaging of the vectors, which are then used to integrate the therapeutic gene into the target cell to provide permanent transgene expression. Widely used retroviral vectors include those based upon murine leukemia virus (MuLV), gibbon ape leukemia virus (GaLV), Simian Immunodeficiency virus (SIV), human immunodeficiency virus (HIV), and combinations thereof (see, e.g., Buchscher et al., J. Virol. 66:2731-2739 (1992); Johann et al., J. Virol. 66:1635-1640 (1992); Sommerfelt et al., Virol. 176:58-59 (1990); Wilson et al., J. Virol. 63:2374-2378 (1989); Miller et al., J. Virol. 65:2220-2224 (1991); PCT/US94/05700).

    [0203] In applications in which transient expression is preferred, adenoviral based systems can be used. Adenoviral based vectors are capable of very high transduction efficiency in many cell types and do not require cell division. With such vectors, high titer and high levels of expression have been obtained. This vector can be produced in large quantities in a relatively simple system. Adeno-associated virus (AAV) vectors are also used to transduce cells with target nucleic acids, e.g., in the in vitro production of nucleic acids and peptides, and for in vivo and ex vivo gene therapy procedures (see, e.g., West et al., Virology 160:38-47 (1987); U.S. Pat. No. 4,797,368; WO 93/24641; Kotin, Human Gene Therapy 5:793-801 (1994); Muzyczka, J. Clin. Invest. 94:1351 (1994). Construction of recombinant AAV vectors are described in a number of publications, including U.S. Pat. No. 5,173,414; Tratschin et al., Mol. Cell. Biol. 5:3251-3260 (1985); Tratschin, et al., Mol. Cell. Biol. 4:2072-2081 (1984); Hermonat & Muzyczka, PNAS USA 81:6466-6470 (1984); and Samulski et al., J. Virol. 63:03822-3828 (1989).

    [0204] At least six viral vector approaches are currently available for gene transfer in clinical trials, which utilize approaches that involve complementation of defective vectors by genes inserted into helper cell lines to generate the transducing agent.

    [0205] pLASN and MFG-S are examples of retroviral vectors that have been used in clinical trials (Dunbar et al., Blood 85:3048-305 (1995); Kohn et al., Nat. Med. 1:1017-102 (1995); Malech et al., PNAS USA 94:22 12133-12138 (1997)). PA317/pLASN was the first therapeutic vector used in a gene therapy trial. (Blaese et al., Science 270:475-480 (1995)). Transduction efficiencies of 50% or greater have been observed for MFG-S packaged vectors. (Ellem et al., Immunol Immunother. 44(1):10-20 (1997); Dranoff et al., Hum. Gene Ther. 1:111-2 (1997).

    [0206] Recombinant adeno-associated virus vectors (rAAV) are a promising alternative gene delivery system based on the defective and nonpathogenic parvovirus adeno-associated type 2 virus. All vectors are derived from a plasmid that retains only the AAV 145 bp inverted terminal repeats flanking the transgene expression cassette. Efficient gene transfer and stable transgene delivery due to integration into the genomes of the transduced cell are key features for this vector system. (Wagner et al., Lancet 351:9117 1702-3 (1998), Kearns et al., Gene Ther. 9:748-55 (1996)). Other AAV serotypes, including AAV1, AAV3, AAV4, AAV5, AAV6, AAV8, AAV8.2, AAV9 and AAVrh10 and pseudotyped AAV such as AAV2/8, AAV2/5 and AAV2/6 can also be used in accordance with the present invention.

    [0207] Replication-deficient recombinant adenoviral vectors (Ad) can be produced at high titer and readily infect a number of different cell types. Most adenovirus vectors are engineered such that a transgene replaces the Ad E1a, E1b, and/or E3 genes; subsequently the replication defective vector is propagated in human 293 cells that supply deleted gene function in trans. Ad vectors can transduce multiple types of tissues in vivo, including nondividing, differentiated cells such as those found in liver, kidney and muscle. Conventional Ad vectors have a large carrying capacity. An example of the use of an Ad vector in a clinical trial involved polynucleotide therapy for antitumor immunization with intramuscular injection (Sterman et al., Hum. Gene Ther. 7:1083-9 (1998)). Additional examples of the use of adenovirus vectors for gene transfer in clinical trials include Rosenecker et al., Infection 24:1 5-10 (1996); Sterman et al., Hum. Gene Ther. 9:7 1083-1089 (1998); Welsh et al., Hum. Gene Ther. 2:205-18 (1995); Alvarez et al., Hum. Gene Ther. 5:597-613 (1997); Topf et al., Gene Ther. 5:507-513 (1998); Sterman et al., Hum. Gene Ther. 7:1083-1089 (1998).

    [0208] Packaging cells are used to form virus particles that are capable of infecting a host cell. Such cells include 293 cells, which package adenovirus, and 2 cells or PA317 cells, which package retrovirus. Viral vectors used in gene therapy are usually generated by a producer cell line that packages a nucleic acid vector into a viral particle. The vectors typically contain the minimal viral sequences required for packaging and subsequent integration into a host (if applicable), other viral sequences being replaced by an expression cassette encoding the protein to be expressed. The missing viral functions are supplied in trans by the packaging cell line. For example, AAV vectors used in gene therapy typically only possess inverted terminal repeat (ITR) sequences from the AAV genome which are required for packaging and integration into the host genome. Viral DNA is packaged in a cell line, which contains a helper plasmid encoding the other AAV genes, namely rep and cap, but lacking ITR sequences. The cell line is also infected with adenovirus as a helper. The helper virus promotes replication of the AAV vector and expression of AAV genes from the helper plasmid. The helper plasmid is not packaged in significant amounts due to a lack of ITR sequences. Contamination with adenovirus can be reduced by, e.g., heat treatment to which adenovirus is more sensitive than AAV.

    [0209] In many gene therapy applications, it is desirable that the gene therapy vector be delivered with a high degree of specificity to a particular tissue type. Accordingly, a viral vector can be modified to have specificity for a given cell type by expressing a ligand as a fusion with a viral coat protein on the outer surface of the virus. The ligand is chosen to have affinity for a receptor known to be present on the cell type of interest. For example, Han et al., (Proc. Natl. Acad. Sci. USA 92:9747-9751 (1995)), reported that Moloney murine leukemia virus can be modified to express human heregulin fused to gp70, and the recombinant virus infects certain human breast cancer cells expressing human epidermal growth factor receptor. This principle can be extended to other virus-target cell pairs, in which the target cell expresses a receptor and the virus expresses a fusion molecule comprising a ligand for the cell-surface receptor. For example, filamentous phage can be engineered to display antibody fragments (e.g., FAB or Fv) having specific binding affinity for virtually any chosen cellular receptor. Although the above description applies primarily to viral vectors, the same principles can be applied to nonviral vectors. Such vectors can be engineered to contain specific uptake sequences which favor uptake by specific target cells.

    [0210] Delivery methods for CRISPR/Cas systems can comprise those methods described above. For example, in animal models, in vitro transcribed Cas encoding mRNA or recombinant Cas protein can be directly injected into one-cell stage embryos using glass needles to genome-edited animals. To express Cas and guide RNAs in cells in vitro, typically plasmids that encode them are transfected into cells via lipofection or electroporation. Also, recombinant Cas protein can be complexed with in vitro transcribed guide RNA where the Cas-guide RNA ribonucleoprotein is taken up by the cells of interest (Kim et al (2014) Genome Res 24(6):1012). For therapeutic purposes, Cas and guide RNAs can be delivered by a combination of viral and non-viral techniques. For example, mRNA encoding Cas may be delivered via nanoparticle delivery while the guide RNAs and any desired transgene or repair template are delivered via AAV (Yin et al (2016) Nat Biotechnol 34(3) p. 328).

    [0211] Gene therapy vectors can be delivered in vivo by administration to an individual patient, typically by systemic administration (e.g., intravenous, intraperitoneal, intramuscular, subdermal, or intracranial infusion) or topical application, as described below. Alternatively, vectors can be delivered to cells ex vivo, such as cells explanted from an individual patient (e.g., lymphocytes, bone marrow aspirates, tissue biopsy) or universal donor hematopoietic stem cells, followed by re-implantation of the cells into a patient, usually after selection for cells which have incorporated the vector.

    [0212] Ex vivo cell transfection for diagnostics, research, transplant or for gene therapy (e.g., via re-infusion of the transfected cells into the host organism) is well known to those of skill in the art. In a preferred embodiment, cells are isolated from the subject organism, transfected with a DNA-binding proteins nucleic acid (gene or cDNA), and re-infused back into the subject organism (e.g., patient). Various cell types suitable for ex vivo transfection are well known to those of skill in the art (see, e.g., Freshney et al., Culture of Animal Cells, A Manual of Basic Technique (3rd ed. 1994)) and the references cited therein for a discussion of how to isolate and culture cells from patients).

    [0213] In one embodiment, stem cells are used in ex vivo procedures for cell transfection and gene therapy. The advantage to using stem cells is that they can be differentiated into other cell types in vitro, or can be introduced into a mammal (such as the donor of the cells) where they will engraft in the bone marrow. Methods for differentiating CD34+ cells in vitro into clinically important immune cell types using cytokines such a GM-CSF, IFN- and TNF- are known (see Inaba et al., J. Exp. Med. 176:1693-1702 (1992)).

    [0214] Stem cells are isolated for transduction and differentiation using known methods. For example, stem cells are isolated from bone marrow cells by panning the bone marrow cells with antibodies which bind unwanted cells, such as CD4+ and CD8+ (T cells), CD45+ (panB cells), GR-1 (granulocytes), and Tad (differentiated antigen presenting cells) (see Inaba et al., J. Exp. Med. 176:1693-1702 (1992)).

    [0215] Stem cells that have been modified may also be used in some embodiments. For example, neuronal stem cells that have been made resistant to apoptosis may be used as therapeutic compositions where the stem cells also contain the ZFP TFs of the invention. Resistance to apoptosis may come about, for example, by knocking out BAX and/or BAK using BAX- or BAK-specific ZFNs (see, U.S. Pat. No. 8,597,912) in the stem cells, or those that are disrupted in a caspase, again using caspase-6 specific ZFNs for example.

    [0216] Vectors (e.g., retroviruses, adenoviruses, liposomes, etc.) containing therapeutic DNA-binding proteins (or nucleic acids encoding these proteins) can also be administered directly to an organism for transduction of cells in vivo. Alternatively, naked DNA can be administered. Administration is by any of the routes normally used for introducing a molecule into ultimate contact with blood or tissue cells including, but not limited to, injection, infusion, topical application and electroporation. Suitable methods of administering such nucleic acids are available and well known to those of skill in the art, and, although more than one route can be used to administer a particular composition, a particular route can often provide a more immediate and more effective reaction than another route.

    [0217] Methods for introduction of DNA into hematopoietic stem cells are disclosed, for example, in U.S. Pat. No. 5,928,638. Vectors useful for introduction of transgenes into hematopoietic stem cells, e.g., CD34+ cells, include adenovirus Type 35.

    [0218] Vectors suitable for introduction of transgenes into immune cells (e.g., T-cells) include non-integrating lentivirus vectors. See, for example, Ory et al. (1996) Proc. Natl. Acad. Sci. USA 93:11382-11388; Dull et al. (1998) J. Virol. 72:8463-8471; Zuffery et al. (1998) J. Virol. 72:9873-9880; Follenzi et al. (2000) Nature Genetics 25:217-222.

    [0219] Pharmaceutically acceptable carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition. Accordingly, there is a wide variety of suitable formulations of pharmaceutical compositions available, as described below (see, e.g., Remington's Pharmaceutical Sciences, 17th ed., 1989).

    [0220] As noted above, the disclosed methods and compositions can be used in any type of cell including, but not limited to, prokaryotic cells, fungal cells, Archaeal cells, plant cells, insect cells, animal cells, vertebrate cells, mammalian cells and human cells, including T-cells and stem cells of any type. Suitable cell lines for protein expression are known to those of skill in the art and include, but are not limited to COS, CHO (e.g., CHO-S, CHO-K1, CHO-DG44, CHO-DUXB11), VERO, MDCK, WI38, V79, B14AF28-G3, BHK, HaK, NS0, SP2/0-Ag14, HeLa, HEK293 (e.g., HEK293-F, HEK293-H, HEK293-T), perC6, insect cells such as Spodoptera fugiperda (Sf), and fungal cells such as Saccharomyces, Pichia and Schizosaccharomyces. Progeny, variants and derivatives of these cell lines can also be used.

    [0221] Applications

    [0222] Use of engineered nucleases in treatment and prevention of disease is one of the most significant developments in medicine in the coming years. The methods and compositions described herein serve to increase the specificity of these novel tools to ensure that the desired target sites will be the primary place of cleavage. Minimizing or eliminating off-target cleavage will be required to realize the full potential of this technology, for all in vitro, in vivo and ex vivo applications.

    [0223] Exemplary genetic diseases include, but are not limited to, achondroplasia, achromatopsia, acid maltase deficiency, adenosine deaminase deficiency (OMIM No. 102700), adrenoleukodystrophy, aicardi syndrome, alpha-1 antitrypsin deficiency, alpha-thalassemia, androgen insensitivity syndrome, apert syndrome, arrhythmogenic right ventricular, dysplasia, ataxia telangictasia, barth syndrome, beta-thalassemia, blue rubber bleb nevus syndrome, canavan disease, chronic granulomatous diseases (CGD), cri du chat syndrome, cystic fibrosis, dercum's disease, ectodermal dysplasia, fanconi anemia, fibrodysplasia ossificans progressive, fragile X syndrome, galactosemis, Gaucher's disease, generalized gangliosidoses (e.g., GM1), hemochromatosis, the hemoglobin C mutation in the 6.sup.th codon of beta-globin (HbC), hemophilia, Huntington's disease, Hurler Syndrome, hypophosphatasia, Klinefleter syndrome, Krabbes Disease, Langer-Giedion Syndrome, leukocyte adhesion deficiency (LAD, OMIM No. 116920), leukodystrophy, long QT syndrome, Marfan syndrome, Moebius syndrome, mucopolysaccharidosis (MPS), nail patella syndrome, nephrogenic diabetes insipdius, neurofibromatosis, Neimann-Pick disease, osteogenesis imperfecta, phenylketonuria (PKU). porphyria, Prader-Willi syndrome, progeria, Proteus syndrome, retinoblastoma, Rett syndrome, Rubinstein-Taybi syndrome, Sanfilippo syndrome, severe combined immunodeficiency (SCID), Shwachman syndrome, sickle cell disease (sickle cell anemia), Smith-Magenis syndrome, Stickler syndrome, Tay-Sachs disease, Thrombocytopenia Absent Radius (TAR) syndrome, Treacher Collins syndrome, trisomy, tuberous sclerosis, Turner's syndrome, urea cycle disorder, von Hippel-Landau disease, Waardenburg syndrome, Williams syndrome, Wilson's disease, Wiskott-Aldrich syndrome, X-linked lymphoproliferative syndrome (XLP, OMIM No. 308240).

    [0224] Additional exemplary diseases that can be treated by targeted DNA cleavage and/or homologous recombination include acquired immunodeficiencies, lysosomal storage diseases (e.g., Gaucher's disease, GM1, Fabry disease and Tay-Sachs disease), mucopolysaccahidosis (e.g. MPSII (Hunter's disease), MPSI (Hurler's disease), hemoglobinopathies (e.g., sickle cell diseases, HbC, -thalassemia, -thalassemia) and hemophilias. See, e.g., U.S. Pat. Nos. 9,877,988 and 9,956,247. In particular, glucocerebrosidase (GBA) is deficient in Gaucher's, alpha-galactosidase (GLA) is deficient in Fabry's, iduronate-2-sulfatase deficiency (IDS) is deficient in MPS II (Hunter's), alpha-L iduronidase deficiency (IDUA) is deficient in MPS I (Hurler's), and sphingomyelin phosphodiesterase 1 deficiency (SMPD1) is deficient in Niemann-Pick's. Therefore, donors expressing one or more of the proteins lacking or deficient in these diseases can be introduced using the nucleases described herein to provide treatment and/or prevention for these diseases.

    [0225] Such methods also allow for treatment of infections (viral or bacterial) in a host (e.g., by blocking expression of viral or bacterial receptors, thereby preventing infection and/or spread in a host organism) to treat genetic diseases.

    [0226] Targeted cleavage of infecting or integrated viral genomes can be used to treat viral infections in a host. Additionally, targeted cleavage of genes encoding receptors for viruses can be used to block expression of such receptors, thereby preventing viral infection and/or viral spread in a host organism. Targeted mutagenesis of genes encoding viral receptors (e.g., the CCR5 and CXCR4 receptors for HIV) can be used to render the receptors unable to bind to virus, thereby preventing new infection and blocking the spread of existing infections. See, U.S. Patent Publication No. 2008/015996. Non-limiting examples of viruses or viral receptors that may be targeted include herpes simplex virus (HSV), such as HSV-1 and HSV-2, varicella zoster virus (VZV), Epstein-Barr virus (EBV) and cytomegalovirus (CMV), HHV6 and HHV7. The hepatitis family of viruses includes hepatitis A virus (HAV), hepatitis B virus (HBV), hepatitis C virus (HCV), the delta hepatitis virus (HDV), hepatitis E virus (HEV) and hepatitis G virus (HGV). Other viruses or their receptors may be targeted, including, but not limited to, Picornaviridae (e.g., polioviruses, etc.); Caliciviridae; Togaviridae (e.g., rubella virus, dengue virus, etc.); Flaviviridae; Coronaviridae; Reoviridae; Birnaviridae; Rhabodoviridae (e.g., rabies virus, etc.); Filoviridae; Paramyxoviridae (e.g., mumps virus, measles virus, respiratory syncytial virus, etc.); Orthomyxoviridae (e.g., influenza virus types A, B and C, etc.); Bunyaviridae; Arenaviridae; Retroviradae; lentiviruses (e.g., HTLV-I; HTLV-II; HIV-1 (also known as HTLV-III, LAV, ARV, hTLR, etc.) HIV-II); simian immunodeficiency virus (SIV), human papillomavirus (HPV), influenza virus and the tick-borne encephalitis viruses. See, e.g. Virology, 3rd Edition (W. K. Joklik ed. 1988); Fundamental Virology, 2nd Edition (B. N. Fields and D. M. Knipe, eds. 1991), for a description of these and other viruses. Receptors for HIV, for example, include CCR-5 and CXCR-4.

    [0227] Thus, heterodimeric cleavage domain variants as described herein provide broad utility for improving ZFN specificity in gene modification applications. These variant cleavage domains may be readily incorporated into any existing ZFN by either site directed mutagenesis or subcloning to improve the in vivo specificity of any ZFN dimers.

    [0228] As noted above, the compositions and methods described herein can be used for gene modification, gene correction, and gene disruption. Non-limiting examples of gene modification includes homology directed repair (HDR)-based targeted integration; HDR-based gene correction; HDR-based gene modification; HDR-based gene disruption; NHEJ-based gene disruption and/or combinations of HDR, NHEJ, and/or single strand annealing (SSA). Single-Strand Annealing (SSA) refers to the repair of a double strand break between two repeated sequences that occur in the same orientation by resection of the DSB by 5-3 exonucleases to expose the 2 complementary regions. The single-strands encoding the 2 direct repeats then anneal to each other, and the annealed intermediate can be processed such that the single-stranded tails (the portion of the single-stranded DNA that is not annealed to any sequence) are be digested away, the gaps filled in by DNA Polymerase, and the DNA ends rejoined. This results in the deletion of sequences located between the direct repeats.

    [0229] Compositions comprising cleavage domains (e.g., ZFNs, TALENs, CRISPR/Cas systems) and methods described herein can also be used in the treatment of various genetic diseases and/or infectious diseases.

    [0230] The compositions and methods can also be applied to stem cell based therapies, including but not limited to: correction of somatic cell mutations by short patch gene conversion or targeted integration for monogenic gene therapy; disruption of dominant negative alleles; disruption of genes required for the entry or productive infection of pathogens into cells; enhanced tissue engineering, for example, by modifying gene activity to promote the differentiation or formation of functional tissues; and/or disrupting gene activity to promote the differentiation or formation of functional tissues; blocking or inducing differentiation, for example, by disrupting genes that block differentiation to promote stem cells to differentiate down a specific lineage pathway, targeted insertion of a gene or siRNA expression cassette that can stimulate stem cell differentiation, targeted insertion of a gene or siRNA expression cassette that can block stem cell differentiation and allow better expansion and maintenance of pluripotency, and/or targeted insertion of a reporter gene in frame with an endogenous gene that is a marker of pluripotency or differentiation state that would allow an easy marker to score differentiation state of stem cells and how changes in media, cytokines, growth conditions, expression of genes, expression of siRNA, shRNA or miRNA molecules, exposure to antibodies to cell surface markers, or drugs alter this state; somatic cell nuclear transfer, for example, a patient's own somatic cells can be isolated, the intended target gene modified in the appropriate manner, cell clones generated (and quality controlled to ensure genome safety), and the nuclei from these cells isolated and transferred into unfertilized eggs to generate patient-specific hES cells that could be directly injected or differentiated before engrafting into the patient, thereby reducing or eliminating tissue rejection; universal stem cells by knocking out MHC receptors (e.g., to generate cells of diminished or altogether abolished immunological identity). Cell types for this procedure include but are not limited to, T-cells, B cells, hematopoietic stem cells, and embryonic stem cells. Additionally, induced pluripotent stem cells (iPSC) may be used which would also be generated from a patient's own somatic cells. Therefore, these stem cells or their derivatives (differentiated cell types or tissues) could be potentially engrafted into any person regardless of their origin or histocompatibility.

    [0231] The compositions and methods can also be used for somatic cell therapy, thereby allowing production of stocks of cells that have been modified to enhance their biological properties. Such cells can be infused into a variety of patients, independent of the donor source of the cells and their histocompatibility to the recipient.

    [0232] In addition to therapeutic applications, the increased specificity provided by the variants described herein when used in engineered nucleases can be used for crop engineering, cell line engineering and the construction of disease models. The obligate heterodimer cleavage half-domains provide a straightforward means for improving nuclease properties.

    [0233] The engineered cleavage half domains described can also be used in gene modification protocols requiring simultaneous cleavage at multiple targets either to delete the intervening region or to alter two specific loci at once. Cleavage at two targets would require cellular expression of four ZFNs or TALENs, which could yield potentially ten different active ZFN or TALEN combinations. For such applications, substitution of these novel variants for the wild-type nuclease domain would eliminate the activity of the undesired combinations and reduce chances of off-target cleavage. If cleavage at a certain desired DNA target requires the activity of the nuclease pair A+B, and simultaneous cleavage at a second desired DNA target requires the activity of the nuclease pair X+Y, then use of the mutations described herein can prevent the pairings of A with A, A with X, A with Y and so on. Thus, these FokI mutations decrease non-specific cleavage activity as a result of illegitimate pair formation and allow the generation of more efficient orthogonal mutant pairs of nucleases (see co-owned patent U.S. Patent Publication Nos. 20080131962 and 20090305346).

    EXAMPLES

    Example 1

    Preparation of ZFNs

    [0234] ZFNs targeted to human albumin gene was designed and incorporated into plasmids vectors essentially as described in Urnov et al. (2005) Nature 435(7042):646-651; Perez et al (2008) Nature Biotechnology 26(7):808-816, and U.S. Pat. No. 9,394,545.

    Example 2

    Optimizing Albumin-Specific ZFNs

    [0235] The binding site of the left hand ZFN partner (SBS47171-FLAG, see Table 1) comprises a SNP in 20% of humans (see FIG. 1). In the wild type sequence, the sequence comprises an AT base pair (indicated by the oval), while in the sequence comprising the SNP, there is a GC base pair in this position (indicated in rectangle above sequence). In human hepatocytes that are heterozygous for the wild type and SNP albumin sequences, the 47171-FLAG/47898-FLAG pair has a 3-4 fold preference for the wild type sequence (see FIG. 2). A second left hand partner was identified (42875) that was found to cleave the wild type albumin sequence and the SNP-containing sequence with equal activity, however the 42875/47898 pair also showed some cleavage activity at a SMCHD1 off target site.

    [0236] Thus, studies were performed with additional candidate ZFNs wherein modifications were made to the phosphate contacting amino acids within the ZFP backbone. The proteins used are shown below in Table 1.

    TABLE-US-00002 TABLE1 Albumin-specificZFNdesigns ZFNName target Domain sequence F1 F2 F3 F4 F5 F6 linker other SBS47171- QSGNLSR LKQNLCM WADNLQN TSGNLTR RQSHLCL N/A 5.6 N-term FLAG (SEQID (SEQID (SEQID (SEQID (SEQID 3x ttTGGGAT NO:14) NO:15) NO:16) NO:17) NO:18) FLAG AGTTATGA Attcaatc ttca (SEQID NO:12) SBS42875- QSGNLAR LKQNLCM WQSNLQN TSGNLTR RRSHLTS N/A 5.6 N-term FLAG (SEQID (SEQID (SEQID (SEQID (SEQID 3x ttTGGGAT NO:19) NO:15) NO:20) NO:17) NO:21) FLAG AGTTATGA Attcaatc ttca (SEQID NO:12) 42877- QSGNLAR LKQNLCM LITTLRN TSGNLTR RQSHLCL N/A 5.6 N-term FLAG (SEQID (SEQID (SEQID (SEQID (SEQID 3x ttTGGGAT NO:19) NO:15) NO:22) NO:17) NO:18) FLAG AGTTATGA Attcaatc ttca (SEQID NO:12) 42908- QSGNLAR LKQNLCM WASNLQN TSGNLTR RQSHLCL N/A 5.6 N-term FLAG (SEQID (SEQID (SEQID (SEQID (SEQID 3x ttTGGGAT NO:19) NO:15) NO:23) NO:17) NO:18) FLAG AGTTATGA Attcaatc ttca (SEQID NO:12) 47898- TPQLLDR LKHNLLT DQSNLNA RNFSLTM LRHDLDR HRSNLNK 5.6 N-term FLAG (SEQID (SEQID (SEQID (SEQID (SEQID (SEQID 3x ccTATCCA NO:24) NO:25) NO:26) NO:27) NO:28) NO:29) FLAG TTGCACTA TGCTttat ttaa (SEQID NO:13) 47874- QSSDLSR LKHNLLT DQSNLRA RNFSLTM LRHDLER HRSNLNK 5.6 N-term FLAG (SEQID (SEQID (SEQID (SEQID (SEQID (SEQID 3x ccTATCCA NO:30) NO:25) NO:31) NO:27) NO:32) NO:29) FLAG TTGCACTA TGCTttat ttaa (SEQID NO:13) 47931- TPQLLDR LKWNLRT DQSNLNA RNFSLTM LRHDLDR HRSNLNK 5.6 N-term FLAG (SEQID (SEQID (SEQID (SEQID (SEQID (SEQID 3x ccTATCCA NO:24) NO:33) NO:26) NO:27) NO:28) NO:29) FLAG TTGCACTA TGCTttat ttaa (SEQID NO:13)

    [0237] The ZFNs listed above were then modified to comprise alterations in their ZFP backbones to reduce any potential non-specific contacts between the ZFP and the DNA phosphate backbone (see U.S. Patent Publication No. US-2018-0087072-A1). In Table 2A and 2B below, exemplary ZFP backbone changes are shown under the heading of the parent ZFN from Table 1 along with the new SBS unique numeric identifiers assigned to each variant.

    Table 2: Phosphate Contact Variant ZFNs

    [0238]

    TABLE-US-00003 TABLE 2A Left partners 47171- 42875- 42877- 42908- m5Q Variants FLAG FLAG FLAG FLAG F1 F2 F3 F4 F5 SBS# SBS# SBS# SBS# 70949 70957 70965 70973 Q 70950 70958 70966 70974 Q 70951 70959 70967 70975 Q 70952 70960 70968 70976 Q Q 70953 70961 70969 70977 Q Q 70954 70962 70970 70978 Q Q 70955 70963 70971 70979 Q Q Q 70956 70964 70972 70980

    TABLE-US-00004 TABLE 2B Right partners 47898- 47874- m5Q Variants FLAG FLAG F1 F2 F3 F4 F5 SBS# SBS# 70981 70989 Q 70982 70990 Q 70983 70991 Q 70984 70992 Q Q 70985 70993 Q Q 70986 70994 Q Q 70987 70995 Q Q Q 70988 70996

    [0239] These proteins were then tested for activity against either the albumin locus (ALB) or the SMCHD1 off target, where the variants were paired with the original right (47898-FLAG)- or left-hand partner (47171-FLAG). K562 cells were electroporated with ZFN mRNA by Amaxa electroporation following manufacture's instruction. Cells were harvested 16 hours after electroporation. gDNA was extracted using QuickExtract DNA Extraction Solution (Lucigen) following manufacture's instruction. Percentage of indels was measured by MiSeq sequencing of PCR products obtained with primers surrounding Albumin ZFN cutting site or SMCHD1 off-target. High activity was seen in all variants and, increased specificity (comparison to off-target sites) was observed in most variants, particularly F1 and F3 variants (FIG. 3A).

    [0240] Next, phosphate contacting amino acid side chain mutations made in the ELD/KKR FokI nuclease domains (see U.S. Pat. No. 8,962,281) were paired with ZFP backbone mutations described above. In these experiments, the parent ZFNs are shown in Table 1 were recapitulated comprising mutations in both the backbone and in the nuclease domain, and each was given a new unique numeric identified (see Table 3).

    TABLE-US-00005 TABLE 3 Albumin specific ZFN variants SBS number ZFN parent Backbone mutation(s) Fok* 71545 42875-FLAG F1m5Q, F3m5Q ELD-R416H 71557 42875-FLAG F1m5Q, F3m5Q ELD-N542D 71673 47898-FLAG F3m5Q KKR-R416H 71721 47874-FLAG F3m5Q KKR-R416H 71739 47874-FLAG F1m5Q, F3m5Q KKR-S418P 71741 47874-FLAG F1m5Q, F3m5Q KKR-L424F 71721 47874-FLAG F3m5Q KKR-R416H 71728 47874-FLAG F3m5Q KKR-P478S 71639 42908-FLAG F1m5Q, F3m5Q ELD 71641 42908-FLAG F1m5Q, F3m5Q ELD-R416H 71653 42908-FLAG F1m5Q, F3m5Q ELD-N542D 71696 47898-FLAG F1m5Q, F3m5Q KKR-P478S *FokI domains may be numbered relative to full-length as shown in the Table or with respect to cleavage domain of FokI only (e.g., N542D and N159D refer to the same engineered FokI domain and P478S and P95S refer to the same engineered FokI domain)

    [0241] Pairs comprising these ZFNs were then tested in K562 cells to observe ZFN activity at the albumin locus and at the off-target site SMCHD1. Briefly, K562 cells were transfected with albumin-targeting ZFNs as indicated. Cells were assessed for ZFN activity (% indels) by deep sequencing 24 hours after transfection as described above.

    [0242] The results (shown in FIGS. 3A-3C) demonstrate that the albumin-specific activity was greatly improved while the off-target activity fell to background levels. FIGS. 3A and 3B shows results at off-target site SMCHD1. An unbiased capture assay was also used to identify potential off target loci for these ZFN pairs in both K562 cells and HepG2 cells (see U.S. Provisional Patent Application 62/675,435) and as shown (see FIG. 3C), the modified ZFN pairs had almost no detectable activity at these sites.

    [0243] Thus, optimized human albumin-specific ZFNs were designed that maintain a high level of on target cleavage at the albumin locus while being tolerant to the A to G SNP and having a high degree of specificity.

    [0244] The optimized ZFNs were also tested for activity (cleavage and targeted integration of a donor) in iPS-derived human hepatocytes. In brief, iPS-derived human hepatocytes were purchased from Cellular Dynamics international, plated and cultured following manufacture's protocol. The cells were transduced with human ZFNs AAV at day 4 post plating in the following dose: low30 MOI, mid100 MOI and high300 MOI. Next day the cells were transduced with human Donor AAV: low240 MOI, mid800 MOI and high 2400 MOI. Cells and conditional medium were harvested for the analysis at day 7 post ZFN AAV transduction.

    [0245] As shown in FIGS. 3D and 3E(i), optimized ZFNs showed up to 12-fold higher levels of cleavage efficiency and 13-fold higher level of transgene (IDS) production from the transgene integrated using optimized ZFNs as compared to the parent ZFNs.

    [0246] Studies were carried out to evaluate the expression of a transgene captured following cleavage with the two ZFN pairs over time. In brief, human iPSC-derived hepatocytes were transduced in triplicate with rAAV2/6 vectors encoding the first (47171:47898) or second (71557:71728) generation ZFNs in combination with the human IDS transgene donor (SB-IDS). IDS enzyme activity (expressed as nmol of product per hour per mL of cell culture supernatant [nmol/hr/mL]) on Day 5 and Day 7 post-transduction was determined by IDS enzyme activity assay. ZFNs and SB-IDS donor were delivered in a left ZFN:right ZFN:Donor ratio of 1:1:2. At doses of 100:100:200 (MOI of ZFN:ZFN:Donor), treatment of the cells with the second generation ZFN pair resulted in 2-fold and 5 more IDS in the cell supernatant at days 5 and 7 respectively than treatment with the first generation pair. At doses of 300:300:600, treatment of the cells with the second generation ZFN pair resulted in 7-fold and 21-fold more IDS in the supernatant at days 5 and 7 respectively than the first generation pair (see FIG. 3E(ii)).

    [0247] Next, primary human hepatocytes that were heterozygous for an A to G SNP within the left ZFN binding site were transfected with messenger RNA (mRNA) encoding the 47171/47898 or the 71557/47898 pairs at concentrations of 10 or 50 ng mRNA per ZFN. Genomic DNA was evaluated by MiSeq deep sequencing for levels of gene modification (% insertions and deletions [indels]) at the wildtype (A:T) or SNP (G:C) on-target site. The results (see FIGS. 3F(i) and 3F(ii)) demonstrated that the 71557/47898 pair had equal activity at both the SNP containing and the non-SNP containing alleles.

    [0248] The rates of gene modification in cells in vitro were also analyzed. Gene modification levels following AAV2/6-mediated delivery of ZFNs (100K and 600K MOIs) to cells was assessed over 10 days of exposure in human primary hepatocytes in three biological replicates. Cells were harvested on Days 1, 3, 5 and 10, genomic DNA was isolated, PCR amplified and MiSeq deep sequenced. The 71557/71728 ZFN pair showed faster kinetics over 10 days compared to the 47171/47898 ZFN pair (FIG. 3G). Faster kinetics for both dose levels of the 71557/71728 ZFN pair were evident as early as Day 3 where this pair yielded 8.3% and 17.8% indels for 100K and 600K dose levels, respectively, compared to 2.2% and 3.0% indels with the 47171/47898 ZFN pair. The 71557/71728 ZFN pair appeared to reach saturation of effect above 40% indels on Day 10. Treatment with the 71557/71728 ZFN pair resulted in higher levels of gene modification over time compared to the 47171/47898 ZFN pair. Administration of the 47171/47898 ZFN pair lead to gene modification levels of 16.9% and 25.4% indels for 100K and 600K MOI dose levels, respectively, while the 71557/71728 ZFN pair yielded 35.1% and 44.2% indels, respectively. At 10 days, the 71557/71728 ZFN pair activity was 2.1- and 1.7-fold higher than 47171/47898 ZFN pair activity for the low and high dose groups, respectively. As the entire dose-response curves were not achieved during the 10-day cell culture experiment, it was not possible to calculate and compare true EC50 values. The results above, however, provide a reasonable estimation of approximate 2-fold increase in ZFN activity over 10 days with the 2nd generation ZFNs.

    [0249] Evaluation studies were also carried out in human primary hepatocytes to characterize any off-target cleavage events related to the second generation ZFN pair. Off target cleavage was determined by previously disclosed methods (see PCT Publication WO2018039440). Genomic DNA was extracted using QuickExtract DNA Extraction Solution (Lucigen) following manufactures conditions.

    [0250] SMCHD1 has been identified as a detected off-target site for the ZFNs. Human primary hepatocytes transduced with AAV2/6 encoding the 47171/47898 or 71557/71728 ZFN pairs were evaluated by MiSeq deep sequencing. Human primary hepatocytes were treated with AAV comprising the second generation ZFN pair at the following MOI: 3K, 10K, 30K, 100K, 300K, 600K and Mock for 10 days. A dose response was observed with respect to ZFN modification at the on-target albumin site. Mean % indels at the albumin locus on Day 10 were 0.16, 7, 15, 15, 21, 30 and 44% following treatment with the 71557/71728 ZFN pair (see FIG. 3H, top row). NSnot statistically significant by two tailed t-test, * p-value<0.05 by two tailed t-test. At the 100K MOI dose, the 47171/47898 ZFNs showed mean on-target activity of 17% indels and off-target activity of 0.11% indels (17/0.11 ratio=154); and the 71557/71728 ZFNs showed mean on-target activity of 35% and off-target activity of 0.08% (35/0.08 ratio=438). Comparing the two ratios, 2nd generation ZFNs are 2.8-fold more selective than 1st generation ZFNs. At the 600K MOI dose, the 47171/47898 ZFNs showed mean on-target activity of 25% indels and off-target activity of 0.36% indels (25/0.36 ratio=69); and the 71557/71728 ZFNs showed mean on-target activity of 44% and off-target activity of 0.34% (44/0.34 ratio=130). Comparing the two ratios, 2nd generation ZFNs are 1.9-fold more selective than first generation ZFNs. At the 100 K and 600K MOI, % indels for the 1st and 2nd generations ZFNs are 17% and 35%, and 25% and 44%, respectively, indicating that 2nd generation ZFN (ZFN 2.0) is 2-fold more potent than the 1st generation ZFNs (see FIG. 3H).

    [0251] In cells treated with the 1st generation left ZFN (47171), ZFN activity at the SNP-containing allele was only 39-44% as high as activity at the wild type allele. In comparison, in cells treated with the 2nd generation left ZFN (71557), ZFN activity at the SNP-containing allele was 91-108% as high as activity at the wild type allele.

    Example 3

    Use of a Polycationic Peptide Tag Increases ZFN Activity

    [0252] The ZFNs including a polycationic peptide tag were examined for cleavage activity. The peptide used was the 3 Flag Tag (see PCT Publication No. WO2001027293), comprising the amino acid sequence NtermDYKDHDG-DYKDHDI-DYKDDDDK (SEQ ID NO:71). The sequence encoding the 3 Flag Tag is fused to the ZFN fusion protein at the N-terminus of the protein (see, Table 1).

    [0253] ZFNs for this study were made against 7 ultra-conserved DNA targets that are conserved between mouse, NHP and human (see Bejerano et al (2004) Science 302(5675):1321-1325) to control for the cellular origin of the cells being tested. 74 ZFN pairs were made against the ultra-conserved DNA targets and were tested for activity in K562 cells either with or without the 3 Flag tag.

    [0254] The results (FIG. 4A) demonstrate that the presence of the polycationic 3 Flag tag was very beneficial for ZFN cleavage activity (as determined by Cell assay to measure % indels), and in these ZFN pairs comprising the 3 Flag Tag, activity was increased by an average of 4.1 as compared to the ZFNs lacking the Flag Tag (FIG. 4B). As shown in FIG. 4C, addition of the 3 Flag Tag led to a 2-3 increase in ZFN activity.

    Example 4

    Addition of a WPRE Regulatory Element

    [0255] WPRE has been found to increase the activity of ZFNs, both in vitro (FIG. 5A, see U.S. Patent Publication 2016-0326548) and in vivo after delivery by LNPs (FIG. 5B, see U.S. Patent Publication No. US-2018-0185516-A1) or by AAV (FIG. 5C, see U.S. Patent Publication 2016-0326548).

    [0256] In its natural form WPRE contains a partial open reading frame (ORF) for the WHV-X protein. The fully expressed WHV-X protein in the context of other viral elements like the WHV (We2) enhancer has been associated with a higher risk of hepatocarcinoma in woodchucks and mice (Hohne et. al (1990) EMBO J 9(4):1137-45; Flajolet et. al (1998) J Virol 72(7):6175-80). The WHV-X protein does not appear to be directly oncogenic, but some studies suggest that under certain circumstances it can act as a weak cofactor for the generation of liver cancers associated with infection by hepadnaviruses (hepatitis B virus for man; woodchuck hepatitis virus for woodchucks). The WPRE sequence used contains a partial open reading frame for WHV-X protein, but does not contain the We2 enhancer, which is thought to amplify expression of the WHV-X protein. Further, the WPRE sequence is placed 3 of the stop codon and out of frame with promoter and therapeutic transgene; thus no translation of this sequence is expected even if stop codon read-through occurred.

    [0257] Thus, the WPRE element was added to the polynucleotides described herein, typically 3 to the nuclease coding sequence (FIG. 7). The WPRE element that is used can be WPREmut6 (Zanta-Boussif, ibid), derived from the J02442 variant, shown below:

    TABLE-US-00006 J02442WPREmut6: (SEQIDNO:42) 5 AATCAACCTCTGGATTACAAAATTTGTGAAAGATTGACTGATATTCTT AACTATGTTGCTCCTTTTACGCTGTGTGGATATGCTGCTTTAATGCCTCTG TATCATGCTATTGCTTCCCGTACGGCTTTCGTTTTCTCCTCCTTGTATAAA TCCTGGTTGCTGTCTCTTTATGAGGAGTTGTGGCCCGTTGTCCGTCAACGT GGCGTGGTGTGCTCTGTGTTTGCTGACGCAACCCCCACTGGCTGGGGCATT GCCACCACCTGTCAACTCCTTTCTGGGACTTTCGCTTTCCCCCTCCCGATC GCCACGGCAGAACTCATCGCCGCCTGCCTTGCCCGCTGCTGGACAGGGGCT AGGTTGCTGGGCACTGATAATTCCGTGGTGTTGTCGGGGAAATCATCGTCC TTTCCTTGGCTGCTCGCCTGTGTTGCCAACTGGATCCTGCGCGGGACGTCC TTCTGCTACGTCCCTTCGGCTCTCAATCCAGCGGACCTCCCTTCCCGAGGC CTTCTGCCGGTTCTGCGGCCTCTCCCGCGTCTTCGCTTTCGGCCTCCGACG AGTCGGATCTCCCTTTGGGCCGCCTCCCCGCCTG.

    [0258] In some embodiments, the WPRE elements is a truncated construct comprising only the gamma and alpha elements. The sequence of WPRE3 is shown below:

    TABLE-US-00007 WPRE3: (SEQIDNO:68) GATAATCAACCTCTGGATTACAAAATTTGTGAAAGATTGACTGGTATTCTT AACTATGTTGCTCCTTTTACGCTATGTGGATACGCTGCTTTAATGCCTTTG TATCATGCTATTGCTTCCCGTATGGCTTTCATTTTCTCCTCCTTGTATAAA TCCTGGTTAGTTCTTGCCACGGCGGAACTCATCGCCGCCTGCCTTGCCCGC TGCTGGACAGGGGCTCGGCTGTTGGGCACTGACAATTCCGTGG.

    [0259] In some embodiments, the J04514.1 variant is used and the mut6 variants are added into the sequence, as shown below:

    TABLE-US-00008 J04514.1WPREmut6: (SEQIDNO:69) AATCAACCTCTGGATTACAAAATTTGTGAAAGATTGACTGGTATTCTTAA CTATGTTGCTCCTTTTACGCTATGTGGATACGCTGCTTTAATGCCTTTGT ATCATGCTATTGCTTCCCGTATGGCTTTCATTTTCTCCTCCTTGTATAAA TCCTGGTTGCTGTCTCTTTATGAGGAGTTGTGGCCCGTTGTCAGGCAACG TGGCGTGGTGTGCACTGTGTTTGCTGACGCAACCCCCACTGGTTGGGGCA TTGCCACCACCTGTCAGCTCCTTTCCGGGACTTTCGCTTTCCCCCTCCCT ATTGCCACGGCGGAACTCATCGCCGCCTGCCTTGCCCGCTGCTGGACAGG GGCTCGGCTGTTGGGCACTGACAATTCCGTGGTGTTGTCGGGGAAATCAT CGTCCTTTCCTTGGCTGCTCGCCTGTGTTGCCACCTGGATTCTGCGCGGG ACGTCCTTCTGCTACGTCCCTTCGGCCCTCAATCCAGCGGACCTTCCTTC CCGCGGCCTGCTGCCGGCTCTGCGGCCTCTTCCGCGTCTTCGCCTTCGCC CTCAGACGAGTCGGATCTCCCTTTGGGCCGCCTCCCCGCCTG

    [0260] All three of the WPRE variants lack the ability to express the WHV X gene, and may be used interchangeably in the expression constructs described herein.

    Example 5

    Addition of a 5 UTR

    [0261] In 1994, Krieg and Melton (Nucl. Acid. Res 12(18):7057) described the 5 untranslated region of the Xenopus beta-globin gene and recognized its potential as an mRNA stabilizing sequence. Thus, the sequence for this element ([TG]CTTGTTCTTTTTGCAGAAGCTCAGAATAAACGCTCAACTTTGGCAGAT (SEQ ID NO:1), wherein TG is optional abbreviated glb) was tested in the 5 untranslated region of the nuclease-encoding expression cassette. Constructs were tested in K562 cells as described above except that cells were assayed at 24 hours post transfection.

    [0262] As shown in FIG. 9, addition of a novel 5UTR led to 2-3 increase in ZFN activity.

    Example 6

    Combinations of Enhancements

    [0263] ZFNs including a 3 Flag tag (3 Flag), a Xenopus -glb (XBG) and/or a WPRE element were tried in various combinations in iPSC derived human hepatocytes. The ZFNs used were 42877/47931 and they were delivered via AAV6. The cells were harvested 6 days post transduction and activity measured against the albumin target.

    [0264] The results demonstrated that enhancement of ZFN activity in the presence of all three elements in comparison with the initial vector (see FIG. 6).

    [0265] Further, a series of 8 expression constructs were thus constructed including the ZFN without or with various combinations all the different elements described above (see FIG. 7A showing variants V1 through V8). All variants were used in an AAV 6 vector and used with an ApoE-hAAT promoter (Okuyama et al (1996) Hum Gene Ther 7(5):637-45). These vectors also comprised a human beta-globin-immunoglobulin chimeric intron sequence described as a chimeric intron composed of the 5-donor site from the first intron of the human -globin gene and the branch and 3-acceptor site from the intron of an immunoglobulin gene heavy chain variable region (Promega). The NLS used in these constructs was from SV40.

    [0266] The vectors were then tested for cleavage activity of the delivered ZFN pair (42877/47931) where both ZFNs were delivered in the same variant architecture.

    [0267] As shown in FIG. 8, two of the variant architectures, Variant 4 and Variant 8, both of which included FLAG sequences (Table 1), provided superior results as compared to the other variants, including vector architecture currently in use. These experiments were carried out in HepG2 cells using 300,000 MOI of AAV comprising the different vectors.

    [0268] One albumin-specific ZFN pair made comprising a combination of the various enhancements is the 71557/71728 pair as described above. FIG. 7B depicts a schematic of the AAVs that encode these ZFNs. The elements of the pair are shown in the tables and sequences below. It will be apparent that any of the elements may be substitute with analogous sequences, for example a WPRE sequence known in the art or as shown in Example 4 above in place of the WPRE sequence below.

    TABLE-US-00009 TABLE4 ElementsofSB71557AAV(SEQIDNO:43) Nucleotide Position- Feature/ SEQID annotation Description NO: Sequence I-130 5 ITR 44 CTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCAAAGCCCGGG [plaintext CGTCGGGCGACCTTTGGTCGCCCGGCCTCAGTGAGCGAGCGAGCG in CGCAGAGAGGGAGTGGCCAACTCCATCACTAGGGGTTCCT brackets] 156-476 ApoE 45 AGGCTCAGAGGCACACAGGAGTTTCTGGGCTCACCCTGCCCCCTT (Enhancer) CCAACCCCTCAGTTCCCATCCTCCAGCAGCTGTTTGTGTGCTGCC underlined TCTGAAGTCCACACTGAACAAACTTCAGCCTACTCATGTCCCTAA AATGGGCAAACATTGCAAGCAGCAAACAGCAAACACACAGCCCTC CCTGCCTGCTGACCTTGGAGCTGGGGCAGAGGTCAGAGACCTCTC TGGGCCCATGCCACCTCCAACATCCACTCGACCCCTTGGAATTTC GGTGGAGAGGAGCAGAGGTTGTCCTGGCGTGGTTTAGGTAGTGTG AGAGGG 485-877 hAAT 46 GATCTTGCTACCAGTGGAACAGCCACTAAGGATTCTGCAGTGAGA (Promoter) GCAGAGGGCCAGCTAAGTGGTACTCTCCCAGAGACTGTCTGACTC italics ACGCCACCCCCTCCACCTTGGACACAGGACGCTGTGGTTTCTGAG CCAGGTACAATGACTCCTTTCGGTAAGTGCAGTGGAAGCTGTACA CTGCCCAGGCAAAGCGTCCGGGCAGCGTAGGCGGGCGACTCAGAT CCCAGCCAGTGGACTTAGCCCCTGTTTGCTCCTCCGATAACTGGG GTGACCTTGGTTAATATTCACCAGCAGCCTCCCCCGTTGCCCCTC TGGATCCACTGCTTAAATACGGACGAGGACAGGGCCCTGTCTCCT CAGCTTCAGGCACCACCACTGACCTGGGACAGT 886-933 5 UTR 47 CTTGTTCTTTTTGCAGAAGCTCAGAATAAACGCTCAACTTTGGCA Bold GAT 943-1075 Human 48 GTAAGTATCAAGGTTACAAGACAGGTTTAAGGAGACCAATAGAAA globin/ CTGGGCTTGTCGAGACAGAGAAGACTCTTGCGTTTCTGATAGGCA IgG CCTATTGGTCTTACTGACATCCACTTTGCCTTTCTCTCCACAG chimeric intron (Intron) double underlined 1086-1154 [00001]embedded image 49 GACTACAAAGACCATGACGGTGATTATAAAGATCATGACATCGAT TACAAGGATGACGATGACAAG 1161-1181 Nuclear 50 CCAAGAAGAAGAGGAAGGTC localization signal Bolditalic 1200-1631 ZFP 51 GCCGCTATGGCTGAGAGGCCCTTCCAGTGTCGAATCTGCATGCAG 71557 AACTTCAGTCAGTCCGGCAACCTGGCCCGCCACATCCGCACCCAC DNA- ACCGGCGAGAAGCCTTTTGCCTGTGACATTTGTGGGAGGAAATTT binding GCCCTGAAGCAGAACCTGTGTATGCATACCAAGATACACACGGGC domain GAGAAGCCCTTCCAGTGTCGAATCTGCATGCAGAAGTTTGCCTGG lowercase CAGTCCAACCTGCAGAACCATACCAAGATACACACGGGCGAGAAG CCCTTCCAGTGTCGAATCTGCATGCGTAACTTCAGTACCTCCGGC AACCTGACCCGCCACATCCGCACCCACACCGGCGAGAAGCCTTTT GCCTGTGACATTTGTGGGAGGAAATTTGCCCGCCGCTCCCACCTG ACCTCCCATACCAAGATACACCTGCGG 1638-2237 [00002]embedded image 52 CAGCTGGTGAAGAGCGAGCTGGAGGAGAAGAAGTCCGAGCTGCGG CACAAGCTGAAGTACGTGCCCCACGAGTACATCGAGCTGATCGAG ATCGCCAGGAACAGCACCCAGGACCGCATCCTGGAGATGAAGGTG ATGGAGTTCTTCATGAAGGTGTACGGCTACAGGGGAAAGCACCTG GGCGGAAGCAGAAAGCCTGACGGCGCCATCTATACAGTGGGCAGC CCCATCGATTACGGCGTGATCGTGGACACAAAGGCCTACAGCGGC GGCTACAATCTGCCTATCGGCCAGGCCGACGAGATGGAGAGATAC GTGGAGGAGAACCAGACCCGGGATAAGCACCTCAACCCCAACGAG TGGTGGAAGGTGTACCCTAGCAGCGTGACCGAGTTCAAGTTCCTG TTCGTGAGCGGCCACTTCAAGGGCAACTACAAGGCCCAGCTGACC AGGCTGAACCACATCACCAACTGCGACGGCGCCGTGCTGAGCGTG GAGGAGCTGCTGATCGGCGGCGAGATGATCAAAGCCGGCACCCTG ACACTGGAGGAGGTGCGGCGCAAGTTCAACAACGGCGAGATCAAC TTCAGATCTTGATAA 2250-2841 [00003]embedded image 53 AATCAACCTCTGGATTACAAAATTTGTGAAAGATTGACTGATATT CTTAACTATGTTGCTCCTTTTACGCTGTGTGGATATGCTGCTTTA ATGCCTCTGTATCATGCTATTGCTTCCCGTACGGCTTTCGTTTTC TCCTCCTTGTATAAATCCTGGTTGCTGTCTCTTTATGAGGAGTTG TGGCCCGTTGTCCGTCAACGTGGCGTGGTGTGCTCTGTGTTTGCT GACGCAACCCCCACTGGCTGGGGCATTGCCACCACCTGTCAACTC CTTTCTGGGACTTTCGCTTTCCCCCTCCCGATCGCCACGGCAGAA CTCATCGCCGCCTGCCTTGCCCGCTGCTGGACAGGGGCTAGGTTG CTGGGCACTGATAATTCCGTGGTGTTGTCGGGGAAATCATCGTCC TTTCCTTGGCTGCTCGCCTGTGTTGCCAACTGGATCCTGCGCGGG ACGTCCTTCTGCTACGTCCCTTCGGCTCTCAATCCAGCGGACCTC CCTTCCCGAGGCCTTCTGCCGGTTCTGCGGCCTCTCCCGCGTCTT CGCTTTCGGCCTCCGACGAGTCGGATCTCCCTTTGGGCCGCCTCC CCGCCTG 2848-3070 Polyadeny 54 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCG lation TGCCTTCCTTGACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCT signal AATAAAATGAGGAAATTGCATCGCATTGTCTGAGTAGGTGTCATT CTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATT GGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTAT 3088-3195 3 ITR 55 AGGAACCCCTAGTGATGGAGTTGGCCACTCCCTCTCTGCGCGCTC [Boldtext GCTCGCTCACTGAGGCCGCCCGGGCTTTGCCCGGGCGGCCTCAGT in GAGCGAGCGAGCGCGCAG brackets] [00004]embedded image [00005]embedded image [00006]embedded image

    TABLE-US-00010 TABLE5 ElementsofSB71728AAV(SEQIDNO:56) Nucleotide Position- Feature/ SEQID annotation Description NO: Sequence 1-130 5 ITR 44 CTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCAAAGCCCGGGCGTCG [plaintext GGCGACCTTTGGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGG inbrackets] GAGTGGCCAACTCCATCACTAGGGGTTCCT 156-476 ApoE 45 AGGCTCAGAGGCACACAGGAGTTTCTGGGCTCACCCTGCCCCCTTCCAAC (Enhancer) CCCTCAGTTCCCATCCTCCAGCAGCTGTTTGTGTGCTGCCTCTGAAGTCC underlined ACACTGAACAAACTTCAGCCTACTCATGTCCCTAAAATGGGCAAACATTG CAAGCAGCAAACAGCAAACACACAGCCCTCCCTGCCTGCTGACCTTGGAG CTGGGGCAGAGGTCAGAGACCTCTCTGGGCCCATGCCACCTCCAACATCC ACTCGACCCCTTGGAATTTCGGTGGAGAGGAGCAGAGGTTGTCCTGGCGT GGTTTAGGTAGTGTGAGAGGG 485-877 hAAT 46 GATCTTGCTACCAGTGGAACAGCCACTAAGGATTCTGCAGTGAGAGCAGA (Promoter) GGGCCAGCTAAGTGGTACTCTCCCAGAGACTGTCTGACTCACGCCACCCC italics CTCCACCTTGGACACAGGACGCTGTGGTTTCTGAGCCAGGTACAATGACT CCTTTCGGTAAGTGCAGTGGAAGCTGTACACTGCCCAGGCAAAGCGTCCG GGCAGCGTAGGCGGGCGACTCAGATCCCAGCCAGTGGACTTAGCCCCTGT TTGCTCCTCCGATAACTGGGGTGACCTTGGTTAATATTCACCAGCAGCCT CCCCCGTTGCCCCTCTGGATCCACTGCTTAAATACGGACGAGGACAGGGC CCTGTCTCCTCAGCTTCAGGCACCACCACTGACCTGGGACAGT 886-933 5 UTR 47 CTTGTTCTTTTTGCAGAAGCTCAGAATAAACGCTCAACTTTGGCAGAT Bold 943-1075 Human 48 GTAAGTATCAAGGTTACAAGACAGGTTTAAGGAGACCAATAGAAACTGGG globin/ CTTGTCGAGACAGAGAAGACTCTTGCGTTTCTGATAGGCACCTATTGGTC IgG TTACTGACATCCACTTTGCCTTTCTCTCCACAG chimeric intron (Intron) double underlined 1086-1154 [00007]embedded image 49 GACTACAAAGACCATGACGGTGATTATAAAGATCATGACATCGATTACAA GGATGACGATGACAAG 1161-1181 Nuclear 50 CCCAAGAAGAAGAGGAAGGTC localization signal Bolditalic 1200-1715 ZFP71728 57 GCCGCTATGGCTGAGAGGCCCTTCCAGTGTCGAATCTGCATGCGTAACTT DNA- CAGTCAGTCCTCCGACCTGTCCCGCCACATCCGCACCCACACCGGCGAGA binding AGCCTTTTGCCTGTGACATTTGTGGGAGGAAATTTGCCCTGAAGCACAAC domain CTGCTGACCCATACCAAGATACACACGGGCGAGAAGCCCTTCCAGTGTCG lowercase AATCTGCATGCAGAACTTCAGTGACCAGTCCAACCTGCGCGCCCACATCC GCACCCACACCGGCGAGAAGCCTTTTGCCTGTGACATTTGTGGGAGGAAA TTTGCCCGCAACTTCTCCCTGACCATGCATACCAAGATACACACCGGAGA GCGCGGCTTCCAGTGTCGAATCTGCATGCGTAACTTCAGTCTGCGCCACG ACCTGGAGCGCCACATCCGCACCCACACCGGCGAGAAGCCTTTTGCCTGT GACATTTGTGGGAGGAAATTTGCCCACCGCTCCAACCTGAACAAGCATAC CAAGATACACCTGCGG 1722-2315 [00008]embedded image 58 CAGCTGGTGAAGAGCGAGCTGGAGGAGAAGAAGTCCGAGCTGCGGCACAA GCTGAAGTACGTGCCCCACGAGTACATCGAGCTGATCGAGATCGCCAGGA ACAGCACCCAGGACCGCATCCTGGAGATGAAGGTGATGGAGTTCTTCATG AAGGTGTACGGCTACAGGGGAAAGCACCTGGGCGGAAGCAGAAAGCCTGA CGGCGCCATCTATACAGTGGGCAGCCCCATCGATTACGGCGTGATCGTGG ACACAAAGGCCTACAGCGGCGGCTACAATCTGAGCATCGGCCAGGCCGAC GAGATGCAGAGATACGTGAAGGAGAACCAGACCCGGAATAAGCACATCAA CCCCAACGAGTGGTGGAAGGTGTACCCTAGCAGCGTGACCGAGTTCAAGT TCCTGTTCGTGAGCGGCCACTTCAAGGGCAACTACAAGGCCCAGCTGACC AGGCTGAACCGCAAAACCAACTGCAATGGCGCCGTGCTGAGCGTGGAGGA GCTGCTGATCGGCGGCGAGATGATCAAAGCCGGCACCCTGACACTGGAGG AGGTGCGGCGCAAGTTCAACAACGGCGAGATCAACTTCTGATAA 2328-2919 [00009]embedded image 53 AATCAACCTCTGGATTACAAAATTTGTGAAAGATTGACTGATATTCTTAA CTATGTTGCTCCTTTTACGCTGTGTGGATATGCTGCTTTAATGCCTCTGT ATCATGCTATTGCTTCCCGTACGGCTTTCGTTTTCTCCTCCTTGTATAAA TCCTGGTTGCTGTCTCTTTATGAGGAGTTGTGGCCCGTTGTCCGTCAACG TGGCGTGGTGTGCTCTGTGTTTGCTGACGCAACCCCCACTGGCTGGGGCA TTGCCACCACCTGTCAACTCCTTTCTGGGACTTTCGCTTTCCCCCTCCCG ATCGCCACGGCAGAACTCATCGCCGCCTGCCTTGCCCGCTGCTGGACAGG GGCTAGGTTGCTGGGCACTGATAATTCCGTGGTGTTGTCGGGGAAATCAT CGTCCTTTCCTTGGCTGCTCGCCTGTGTTGCCAACTGGATCCTGCGCGGG ACGTCCTTCTGCTACGTCCCTTCGGCTCTCAATCCAGCGGACCTCCCTTC CCGAGGCCTTCTGCCGGTTCTGCGGCCTCTCCCGCGTCTTCGCTTTCGGC CTCCGACGAGTCGGATCTCCCTTTGGGCCGCCTCCCCGCCTG 2926-3148 Polyadenyl 54 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCT ationsignal TCCTTGACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGA GGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCTGGGGGGTG GGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAAGACAATAGCAGGCAT GCTGGGGATGCGGTGGGCTCTAT 3166-3273 3 ITR 55 AGGAACCCCTAGTGATGGAGTTGGCCACTCCCTCTCTGCGCGCTCGCTCG [Boldtext CTCACTGAGGCCGCCCGGGCTTTGCCCGGGCGGCCTCAGTGAGCGAGCGA in GCGCGCAG brackets] [00010]embedded image [00011]embedded image [00012]embedded image

    [0269] A series of transgene vectors (F9, IDS and IDUA) were made to insert into the albumin gene using the ZFN pair shown above (71557/71728), see FIG. 11 depicting the results for the hIDS insertion. The vectors were AAV vectors and all comprised regions of homology flanking the ZFN cleavage site (left homology arm: LA, and right homology arm: RA). The vectors further comprised splice acceptor sequences (SA) and polyA signal sequences (polyA). Finally, all comprised 5 and 3 AAV ITR sequences. The elements and sequences of the Factor 9 exon 2-9 AAV transgene donor are shown below.

    TABLE-US-00011 TABLE6 ElementsofFactor9AAV(SEQIDNO:59) Feature SEQ Position Description IDNO Seqence 1-130 5 ITR 44 CTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCAAAGCCCGGGCGTCG [plaintextin GGCGACCTTTGGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGG brackets] GAGTGGCCAACTCCATCACTAGGGGTTCCT 271-550 LA:Left 60 TTTATTCTATTTTCCCAGTAAAATAAAGTTTTAGTAAACTCTGCATCTTT homologyarm AAAGAATTATTTTGGCATTTATTTCTAAAATGGCATAGTATTTTGTATTT italics GTGAAGTCTTACAAGGTTATCTTATTAATAAAATTCAAACATCCTAGGTA AAAAAAAAAGGTCAGAATTGTTTAGTGACTGTAATTTTCTTTTGCGC ACTAAGGAAAGTGCAAAGTAACTTAGAGTGACTGAAACTTCACAGAATAG GGTTGAAGATTGAATTCATAACTATCCCAA 557-584 SA:Splice 61 ACTAAAGAATTATTCTTTTACATTTCAG acceptor Bold 585-1882 hF9exons2- 62 TTTTTCTTGATCATGAAAACGCCAACAAAATCCTGAACCGGCCCAAGCGG 8,codon TACAACTCAGGCAAGCTGGAAGAGTTCGTGCAGGGCAACCTGGAACGGGA optimized GTGCATGGAAGAGAAGTGCAGCTTCGAGGAAGCCCGGGAGGTGTTCGAGA underlined ACACCGAGCGGACCACCGAGTTCTGGAAGCAGTACGTGGACGGCGACCAG TGCGAGTCAAACCCCTGCCTGAACGGCGGCAGCTGCAAGGACGATATCAA CAGCTACGAGTGCTGGTGCCCCTTCGGCTTCGAGGGCAAGAACTGCGAGC TGGACGTGACCTGCAACATCAAGAACGGCCGCTGCGAGCAGTTCTGCAAG AACAGCGCCGACAACAAGGTGGTGTGCTCATGCACTGAGGGCTACCGGCT GGCCGAGAACCAGAAGAGCTGCGAGCCCGCCGTGCCCTTCCCCTGCGGCA GAGTGTCCGTGAGCCAGACCAGCAAGCTGACCAGGGCCGAGGCCGTGTTC CCTGACGTGGACTACGTGAACTCAACCGAGGCCGAGACAATCCTGGACAA CATCACCCAGAGCACCCAGTCCTTCAACGACTTCACCCGGGTGGTGGGCG GCGAGGACGCCAAGCCCGGCCAGTTCCCTTGGCAGGTGGTGCTGAACGGC AAGGTGGACGCCTTCTGCGGCGGCTCAATCGTGAACGAGAAGTGGATCGT GACAGCCGCCCACTGCGTGGAGACAGGCGTGAAGATCACCGTGGTGGCCG GCGAACACAATATCGAGGAAACCGAGCACACCGAGCAGAAACGGAACGTG ATCCGGATTATCCCCCACCACAACTACAACGCCGCCATCAACAAGTACAA CCACGATATCGCCCTGCTGGAACTGGACGAGCCTCTGGTGCTGAATTCAT ACGTGACCCCCATCTGTATCGCCGACAAAGAGTACACCAACATCTTTCTG AAGTTCGGCAGCGGCTACGTGTCCGGCTGGGGCAGGGTGTTCCACAAGGG CCGCAGCGCCCTGGTGCTGCAGTACCTGCGGGTGCCCCTGGTGGACAGAG CCACCTGCCTGCGGTCAACCAAGTTCACCATCTACAACAACATGTTCTGC GCCGGCTTCCACGAGGGCGGCAGGGACAGCTGCCAGGGCGACAGCGGCGG ACCCCACGTGACCGAGGTGGAGGGCACCAGCTTTCTGACCGGCATCATCT CATGGGGCGAGGAATGCGCCATGAAGGGCAAGTACGGAATCTACACTAAG GTGTCAAGATACGTGAACTGGATCAAAGAGAAAACCAAGCTGACCTGA 1890-2114 polyA 63 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCT lowercase TCCTTGACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGA GGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCTGGGGGGTG GGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAAGACAATAGCAGGCAT GCTGGGGATGCGGTGGGCTCTATGG 2121-2220 [00013]embedded image 64 CTATCCATTGCACTATGCTTTATTTAAAAACCACAAAACCTGTGCTGTTG ATCTCATAAATAGAACTTGTATTTATATTTATTTTCATTTTAGTCTGTCT 2367-2474 3 ITR 55 AGGAACCCCTAGTGATGGAGTTGGCCACTCCCTCTCTGCGCGCTCGCTCG [Bold CTCACTGAGGCCGCCCGGGCTTTGCCCGGGCGGCCTCAGTGAGCGAGCGA bracketed] GCGCGCAG [00014]embedded image [00015]embedded image

    [0270] The elements and sequences of the IDS AAV transgene donor are shown below:

    TABLE-US-00012 TABLE7 ElementsofIDSAAV(SEQIDNO:65) Feature SEQ Position Description IDNO Sequence 1-130 5' ITR 44 CTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCAAAGCCCGGGCGTCG [plaintextin GGCGACCTTTGGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGG brackets] GAGTGGCCAACTCCATCACTAGGGGTTCCT 271-550 LA:Left 60 TTTATTCTATTTTCCCAGTAAAATAAAGTTTTAGTAAACTCTGCATCTTT homologyarm AAAGAATTATTTTGGCATTTATTTCTAAAATGGCATAGTATTTTGTATTT italics GTGAAGTCTTACAAGGTTATCTTATTAATAAAATTCAAACATCCTAGGTA GGTCAGAATTGTTTAGTGACTGTAATTTTCTTTTGCGC ACTAAGGAAAGTGCAAAGTAACTTAGAGTGACTGAAACTTCACAGAATAG GGTTGAAGATTGAATTCATAACTATCCCAA 557-584 SA:Splice 61 ACTAAAGAATTATTCTTTTACATTTCAG acceptor Bold 587-2161 hIDScodon 66 AGCGAAACCCAGGCCAACTCAACTACAGATGCGCTTAACGTCCTGCTCAT optimized CATCGTGGACGATTTGCGGCCGTCGCTTGGCTGCTATGGAGATAAGCTCG underlined TCCGCTCGCCGAACATCGATCAGTTGGCCTCACACTCACTGCTTTTCCAA AATGCGTTTGCGCAGCAGGCTGTCTGTGCACCTTCAAGAGTCTCATTCTT GACCGGGCGACGCCCTGACACAACGCGGCTGTACGACTTCAACAGCTACT GGAGAGTCCACGCGGGTAACTTTTCAACTATCCCACAGTACTTTAAAGAG AACGGATACGTGACAATGAGCGTGGGAAAGGTCTTTCACCCCGGCATCTC CTCGAATCACACCGACGATTCGCCCTACTCGTGGTCGTTTCCTCCCTACC ATCCTTCGAGCGAGAAGTATGAGAACACGAAAACTTGTCGCGGACCCGAC GGAGAGCTGCACGCTAATCTGCTGTGTCCGGTGGATGTCTTGGACGTGCC CGAGGGAACGCTCCCCGACAAGCAGTCAACGGAGCAGGCGATTCAGTTGC TGGAGAAGATGAAAACAAGCGCGTCGCCTTTCTTCCTCGCCGTGGGGTAT CACAAGCCCCATATTCCTTTCCGCTACCCGAAGGAGTTCCAGAAACTTTA TCCTTTGGAAAACATCACTTTGGCACCGGACCCGGAAGTCCCCGACGGTC TGCCACCCGTGGCCTACAATCCCTGGATGGATATCAGGCAGAGGGAAGAT GTGCAGGCACTCAACATCTCAGTCCCCTACGGGCCTATTCCAGTCGATTT TCAACGCAAGATTCGGCAGTCGTATTTTGCGTCGGTGTCCTACCTCGATA CGCAAGTAGGTCGACTTCTGAGCGCGCTTGATGACCTTCAGCTGGCAAAT TCCACAATCATCGCCTTTACGTCGGACCATGGGTGGGCGTTGGGAGAGCA TGGAGAGTGGGCAAAGTATAGCAATTTTGATGTAGCAACGCACGTGCCCC TGATTTTCTACGTGCCGGGTAGAACGGCCTCGCTTCCCGAGGCAGGCGAA AAACTTTTTCCCTATCTCGATCCATTCGACTCGGCGAGCCAGCTTATGGA ACCGGGCAGACAATCCATGGACTTGGTAGAATTGGTGTCCCTTTTTCCGA CCCTCGCCGGGTTGGCGGGCTTGCAAGTACCCCCTAGATGCCCTGTACCG AGCTTCCATGTGGAACTCTGCCGCGAAGGGAAAAACCTCCTCAAACACTT TCGGTTCAGGGACCTTGAGGAGGACCCCTATCTGCCAGGGAATCCGCGAG AGTTGATTGCCTATTCCCAGTATCCGCGACCCAGCGATATTCCTCAATGG AACTCCGATAAGCCCTCCCTCAAAGACATCAAGATTATGGGGTACTCGAT CAGGACCATCGACTATCGCTACACAGTGTGGGTAGGGTTCAATCCTGACG AATTCCTCGCGAACTTTTCGGACATCCACGCTGGTGAGCTGTATTTCGTA GACTCGGACCCGTTGCAAGATCACAATATGTATAATGATTCCCAAGGAGG AGATTTGTTCCAGCTGCTCATGCCG 2174-2398 polyA 63 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCT lowercase TCCTTGACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGA GGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCTGGGGGGTG GGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAAGACAATAGCAGGCAT GCTGGGGATGCGGTGGGCTCTATGG 2405-2504 RA:Right 64 CTATCCATTGCACTATGCTTTATTTAAAAACCACAAAACCTGTGCTGTTG homologyarm ATCTCATAAATAGAACTTGTATTTATATTTATTTTCATTTTAGTCTGTCT Double underlined 2651-2758 3 ITR 55 AGGAACCCCTAGTGATGGAGTTGGCCACTCCCTCTCTGCGCGCTCGCTCG [Bold CTCACTGAGGCCGCCCGGGCTTTGCCCGGGCGGCCTCAGTGAGCGAGCGA bracketed] GCGCGCAG [00016]embedded image [00017]embedded image

    [0271] The elements and sequences of the IDUA AAV transgene donor are shown below:

    TABLE-US-00013 TABLE8 ElementsofIDUAAAV(SEQIDNO:72) Feature SEQ Position Description IDNO Sequence 1-130 5 ITR 44 CTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCAAAGCCCGGGCGTCG [plaintextin GGCGACCTTTGGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGG brackets] GAGTGGCCAACTCCATCACTAGGGGTTCCT 271-560 LA:Left 60 TTTATTCTATTTTCCCAGTAAAATAAAGTTTTAGTAAACTCTGCATCTTT homologyarm AAAGAATTATTTTGGCATTTATTTCTAAAATGGCATAGTATTTTGTATTT italics GTGAAGTCTTACAAGGTTATCTTATTAATAAAATTCAAACATCCTAGGTA AAAAAAAAAGGTCAGAATTGTTTAGTGACTGTAATTTTCTTTTGCGC ACTAAGGAAAGTGCAAAGTAACTTAGAGTGACTGAAACTTCACAGAATAG GGTTGAAGATTGAATTCATAACTATCCCAA 557-584 SA:Splice 61 ACTAAAGAATTATTCTTTTACATTTCAG acceptor Bold 587-2458 hIDUA,codon 67 CACTTGGTCCACGTCGACGCTGCCAGAGCCCTGTGGCCGCTTCGAAGATT optimized TTGGAGGTCAACGGGTTTCTGTCCTCCCCTTCCCCACTCGCAAGCAGATC underlined AGTATGTACTGTCATGGGATCAACAGCTTAACCTCGCCTATGTCGGAGCA GTGCCTCACCGCGGGATCAAGCAAGTAAGGACACATTGGCTCCTTGAACT CGTCACCACGAGAGGATCGACGGGAAGGGGGCTTTCGTACAACTTCACTC ATCTCGATGGCTATTTGGATCTCCTCCGCGAGAATCAGTTGTTGCCAGGC TTCGAATTGATGGGATCGGCGAGCGGGCACTTTACAGACTTCGAGGACAA GCAGCAAGTGTTTGAGTGGAAGGACCTCGTGTCGTCGCTCGCGAGGAGAT ACATTGGTCGCTACGGTTTGGCGCATGTGTCAAAGTGGAACTTCGAAACG TGGAACGAGCCCGATCATCACGATTTTGACAACGTGTCAATGACCATGCA GGGTTTCCTTAACTATTACGACGCCTGTTCCGAGGGATTGAGGGCAGCAT CACCGGCGCTTCGGCTGGGAGGGCCTGGTGATAGCTTTCATACACCACCT CGATCGCCACTTTCGTGGGGGCTGCTGCGCCATTGTCACGATGGTACGAA CTTCTTCACCGGGGAAGCGGGGGTACGGCTTGATTACATCAGCCTCCACC GAAAGGGAGCGCGGTCAAGCATCTCGATTCTGGAGCAGGAGAAGGTAGTC GCTCAGCAGATCCGGCAACTCTTTCCCAAGTTCGCAGACACACCTATCTA CAATGATGAGGCAGACCCACTTGTGGGATGGTCCCTTCCGCAGCCATGGC GCGCAGATGTGACTTATGCCGCGATGGTAGTGAAAGTCATCGCCCAGCAC CAGAATCTGCTTCTTGCGAATACGACCAGCGCGTTTCCTTACGCGCTTTT GTCGAACGATAATGCCTTCCTGTCATATCACCCCCATCCGTTTGCGCAGA GGACTCTTACGGCGCGATTCCAAGTGAATAACACCAGACCGCCGCACGTG CAGCTGTTGCGAAAACCCGTGTTGACTGCGATGGGGCTTCTGGCGTTGCT TGATGAGGAACAACTCTGGGCTGAAGTGTCCCAGGCGGGGACAGTACTTG ATAGCAATCATACAGTAGGCGTGTTGGCGTCGGCGCACCGACCGCAGGGA CCCGCGGATGCTTGGAGGGCAGCGGTCCTGATCTACGCCTCGGACGATAC TAGGGCACATCCCAACAGATCGGTCGCTGTCACCCTTCGCCTCAGAGGGG TCCCGCCTGGTCCCGGCTTGGTATACGTCACTAGATATCTCGACAATGGA CTGTGCAGCCCCGACGGAGAGTGGCGGAGGCTGGGACGGCCGGTGTTTCC GACAGCCGAGCAGTTTAGACGGATGAGGGCCGCTGAGGACCCCGTGGCAG CGGCACCGAGGCCCCTCCCGGCAGGAGGTCGCCTCACTCTTCGACCGGCA CTGCGGCTGCCGTCCCTTCTGCTCGTACACGTCTGCGCGCGACCCGAAAA GCCGCCTGGACAGGTAACCAGGCTCAGGGCGCTCCCCTTGACGCAGGGGC AGTTGGTACTTGTCTGGTCGGACGAACACGTGGGGTCCAAATGCTTGTGG ACGTATGAAATTCAGTTTTCCCAAGACGGGAAAGCGTACACTCCGGTGTC GCGCAAACCCTCCACGTTCAACCTCTTCGTCTTTTCCCCAGACACGGGAG CCGTATCAGGGTCGTACCGAGTCAGAGCCCTCGATTATTGGGCGAGGCCT GGGCCGTTCTCGGACCCTGTACCATACTTGGAAGTGCCGGTGCCCAGGGG ACCGCCCTCGCCTGGTAATCCT 2471-2695 polyA 63 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCT lowercase TCCTTGACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGA GGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCTGGGGGGTG GGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAAGACAATAGCAGGCAT GCTGGGGATGCGGTGGGCTCTATGG 2702-2801 RA:Right 64 CTATCCATTGCACTATGCTTTATTTAAAAACCACAAAACCTGTGCTGTTG homologyarm ATCTCATAAATAGAACTTGTATTTATATTTATTTTCATTTTAGTCTGTCT Double underlined 2948-3055 3 ITR 55 AGGAACCCCTAGTGATGGAGTTGGCCACTCCCTCTCTGCGCGCTCGCTCG [Bold CTCACTGAGGCCGCCCGGGCTTTGCCCGGGCGGCCTCAGTGAGCGAGCGA bracketed] GCGCGCAG [00018]embedded image [00019]embedded image [00020]embedded image

    [0272] The albumin-specific 71557/71728 pair is used to cleave the albumin locus in the target human cells such that in the presence of one of the transgene donor AAVs (AAV-F.IX, AAV-IDS, AAV-IDUA), the transgene will integrate into the albumin locus through homology directed targeted integration. Upon integration, expression of the transgene is regulated by the albumin promoter.

    [0273] The 71557/71728 ZFNs were compared to the 47171/47898 ZFN pair for cleaving the albumin locus in HepG2 cells and inserting the FIX transgene according to standard protocols. In brief, HepG2 cells were transduced with ZFN lots, each at an MOI of 1.2510.sup.6 vg/cell in a total volume of 500 L. The cells were incubated at 37 C./5% CO2 incubator overnight (12 to 24 hours). The next day, the FIX donor was transduced with FIX Donor at an MOI of 2.5106 vg/cell in a total volume of 500 L. At day 9, the media was tested for FIX protein by ELISA using a VisuLize FIX Antigen Kit (Affinity Biologicals) according to manufacturer's instructions.

    [0274] The results (see FIG. 10C) indicate that in this assay, insertion of the FIX donor using the 71557/71728 ZFNs resulted in nearly 3 times more FIX production than when the 47171/47898 pair was used.

    [0275] In a similar manner, the 71557/71728 ZFNs were compared to the 47171/47898 ZFN pair for cleaving the albumin locus in HepG2 cells and inserting the IDUA transgene according to standard protocols. The results (FIG. 14) demonstrate that both pairs are able to cause ZFN-directed targeted integration of the IDUA transgene into the albumin locus, and the transgene is able to be expressed such that IDUA activity is present in the cell supernatant.

    Example 7

    In Vivo Cleavage and Targeted Integration

    [0276] The constructs described herein were also tested in vivo.

    Animal Study Design

    [0277] 42 male wild type C57BL/6 mice at least 6-8 weeks old were purchased from Charles River Laboratories, Inc., Wilmington, Mass. Mice handling, injection and samples collection were performed by Experimur (Chicago Ill.) according to standard protocols related to animal husbandry. Mice were held in quarantine at Experimur for at least 1 week prior to treatment initiation.

    [0278] The AAV were prepared by Sangamo Therapeutics and were stored as received at 70 C. until use. Five engineered AAV2/6 vectors were used in this study; two AAV vectors encoding two ZFNs with standard architecture (ZFN Standard); two AAV vectors encode the two ZFNs with improved architecture (ZFN Improved, e.g. ZFN standard+5UTR, 3 FLAG and WPREmut6); and one AAV vector encoding the promoterless hIDS transgene DNA template (donor) flanked by mouse albumin intron 1 homology arms.

    [0279] The AAV2/6 vectors were diluted into formulation buffer (PBS supplemented with 35 mM NaCl and 5% glycerol [pH 7.1]) to the doses shown in Table 1. The mice between 6 and 9 weeks of age were randomly assigned to groups 1-7. The mice in groups 1 were injected i.v. with vehicle, i.e., formulation buffer, and mice in groups 2-7 were injected i.v. with a combination of vectors at different doses as shown in Table 9 below. The total dose volume injection was 200 L per mouse.

    TABLE-US-00014 TABLE 9 Group designation and dose Each ZFN Dose Donor Dose No of level (vg/ level (vg/ Group Group Designation animals mouse) mouse) 1 Formulation 6 0 0 buffer 2 ZFN Std Low Dose 6 2.00E+10 1.60E+11 3 ZFN Std Mid Dose 6 6.00E+10 4.80E+11 4 ZFN Std High Dose 6 2.00E+11 1.60E+12 5 ZFN Improved Low 6 2.00E+10 1.60E+11 Dose 6 ZFN Improved Mid 6 6.00E+10 4.80E+11 Dose 7 ZFN Improved High 6 2.00E+11 1.60E+12 Dose

    AAV Vector Constructs and Packaging

    [0280] The heterodimeric ZFNs targeting intron 1 of the mouse albumin locus containing the obligate heterodimer ELD/KKR mutations in the FokI domain1. For the mouse in vivo study, standard ZFNs (48641 and 31523) or improved ZFNs (48641 and 31523 with 5UTR, N-terminal 3 FLAG and 3WPREmut6) were used. For human in vitro study, standard ZFNs (47171 and 47898) or ZFN2.0 (71557 and 71728 with 5UTR, N-terminal 3 FLAG and 3WPREmut6) were used. The hIDS donor construct has been previously described (Sharma et al (2015) Blood 126, 1777-1784). The hIDS donor construct contains an hIDS cDNA lacking the endogenous IDS signal peptide, a hF9 splice acceptor sequence, and arms of homology to the mouse or human albumin target site of approximately 600 bp in length in total. Recombinant AAV2/6 vectors (comprised of AAV2 ITRs and the AAV6 capsid) were produced by triple transfection of 293 cells in 10-chamber CELLSTACK culture chambers (Corning), purified by cesium chloride density gradient centrifugation followed by dialysis, and titered as previously described (Sharma, ibid).

    Tissue Collection

    [0281] Mice were euthanized on day 56 in a CO.sub.2 fume chamber at a flow rate of 2 L/min for 3 min. Liver samples were collected and dissected into 3 parts: one part for histopathologic analysis in 10% neutral-buffered formalin and the remaining parts were snap frozen and stored at 70 C. until processing for assessment of IDS enzymatic activity, RNA extraction, western blotting and gene modification.

    Indel Detection in Liver by Next-Generation Sequencing

    [0282] Genomic DNA from mouse liver samples was extracted using AllPrep DNA/RNA/Protein Mini Kit (Qiagen) following manufacture's protocol. iPS-derived hepatocytes gDNA was extracted using QIAamp DNA Micro Kit (Qiagen) following manufacture's protocol. ZFN target site was amplified by PCR using primers described in Table 10. PCR products were sequenced using MiSeq (Illumina) and analyzed as described previously (Laoharawee, K. et al. (2018) Mol. Ther. 26, 1127-1136).

    TABLE-US-00015 TABLE10 PrimersforMiSeqanalysis SEQ.ID Designation Sequence NO: MouseAlbFw ACACGACGCTCTTCCGATCTNN 34 NNTTGAGTTTGAATGCACAGAT MouseAlb GACGTGTGCTCTTCCGATCTNN Rev NNGAAACAGGGAGAGAAAAACC 35 HumanAlb ACACGACGCTCTTCCGATCTNN 36 Fw NNGCACTAAGGAAAGTGCAAAG HumanAlb GACGTGTGCTCTTCCGATCTNNNN Rev AACCAAGAAGACAGACTAAAATG 37

    RT-qPCR

    [0283] Total RNA from liver samples was extracted using AllPrep DNA/RNA/Protein Mini Kit (Qiagen) following manufacture's protocol. cDNA was generated using SuperScript III First-Strand Synthesis SuperMix (Thermo Fisher Scientific) following manufacture's protocol. qPCR was performed utilizing TaqMan Universal PCR Master Mix (Thermo Fisher Scientific). See Table 11 for primers and probes sequence. Data were normalized to the actin.

    TABLE-US-00016 TABLE11 RT-qPCRprimersandprobes Designation Sequence SEQ.IDNO: MouseALBex1Fw CAGGGGTGTGTTTCGTCGAG 38 HumanIDSRev ATGAGCAGGACGTTAAGCGC 39 HumanIDS FAM-AAACCCAGGCCAACTC TaqMan AACT-BHQ 40 MouseActin NA(ThermoFisher, NA Mm01205647_g1)

    Western Blotting

    [0284] Total protein extract was prepared from liver samples as described before3. Protein concentration was determined using the Pierce bicinchoninic acid (BCA) Protein Assay Kit (Thermo Fisher Scientific) prior to IDS detection by western blot. Antibody used were IDS (AF2449; R&D Systems) and glyceraldehyde 3-phosphate dehydrogenase (GAPDH) (A00191-40, GeneScript).

    IDS Assay

    [0285] 1 ug of total liver protein extract or 1:3 dilution of iPS-derived hepatocytes conditional medium were used for the assay as described previously (Laoharawee, K. et al., ibid).

    [0286] Liver samples were collected from the treated animals 56 days post injection and albumin cleavage activity measured as described above. In addition, transgene expression was analyzed by reverse-transcribing liver mRNA and subjecting the product to qPCR using TaqMan primer-probe pair covering junction between endogenous mouse Albumin exon 1 and transgenic human IDS. Western blot of IDS was also conducted where liver total protein extract was hybridized with human-specific IDS antibody (GAPDH served as loading control).

    [0287] As shown in FIGS. 10A and 10B, the AAV vectors including the modifications (5UTR, FLAG, mut6WPRE) described herein cleaved the albumin gene in vivo up to a 7-fold increase as compared to AAV vectors without the modifications. Similarly, the modified ZFNs were able to cause an increase in the integration of a F.IX donor (see FIG. 10C).

    [0288] Furthermore, as shown in FIGS. 11 to 13, the donor IDS transgene when the modified ZFN-encoding AAV vectors were used for targeted integration, the expression of the donor transgene (IDS) was increased 18-fold in vivo as compared to integration mediated by unmodified ZFN-encoding AAV vectors (FIGS. 11 and 12) and enzymatic activity (of IDS) in plasma also increased. FIG. 11A shows a schematic of the three different donors used in this study: SB-IDS, SB-F9 and SB-IDUA. The modified ZFNs caused an increased activity against the albumin target in primary hepatocytes as shown in FIG. 11B, where the improved ZFNs (ZFN 2.0) caused an 34 fold increase in indel percent at the mid dose and a 22 fold increase in activity at the high dose as compared to the original ZFN pair (Current). When these ZFNs are paired with the IDS donor, an increase in IDS activity was detected in the cell supernatant by 5 fold in a medium dose and 21 fold at a higher dose for the improved (ZFN 2.0) ZFNs as compared to the standard ZFNs (Current).

    IDUA Activity Assay

    [0289] IDUA activity is measured according to methods known in the art. For example, one exemplary assay is as follows: The activity of -L-iduronidase was determined by a fluorometric assay using 4-methylumbelliferyl -L-iduronide (Glycosynth) as the substrate according to the established assay condition (Whitley 1987 ibid, (Whitley 1986, ibid). The 4MU-iduronide substrate was diluted with sodium formate buffer, 0.4 M, pH 3.5 in the narrow, well-established optimal range of pH (Hopwood et al (1979), Clin Chim Acta. 92:257-265, Whitley 1986 ibid), and at selected substrate concentrations. Then, 25 L aliquots of substrate were mixed with 25 L of biological sample (e.g. plasma, leukocytes, tissue homogenates). The mixture was incubated at 37 C. for 30 min, and 200 L glycine carbonate buffer (pH 10.4) was added to quench the reaction. -L-iduronidase catalyzed the cleavage of the non-fluorescent substrate (4MU-iduronide) into a fluorescent product (4-MU). 4-Methylumbelliferone (4-MU, Sigma) was used to make the standard curve. The resulting fluorescence was measured using a Bio-Tek plate reader with excitation at 355 nm and emission at 460 nm. -L-iduronidase enzyme activity was expressed in units (nmol converted to product per hour) per mg protein as determined with a Pierce protein assay kit (Fisher). All reactions were run in triplicate.

    [0290] The data demonstrate that optimization of the AAV-ZFN expression constructs produces surprising and unexpected advantages in genome editing (including up to 7-fold increase in cleavage and up to an 18-fold increase in transgene expression), both in vitro and in in vivo genome editing constructs for correction of monogenic disease. Thus, by optimizing the elements that make up the ZFN expression vector, enhancements in overall ZFN activity and/or specificity are realized in vitro and in vivo. These methods can be used with any transgene donor (for example, IDS, IDUA and F.IX) for insertion into the albumin locus. Expression and secretion of the protein encoded by the transgene allows for in vivo production for a subject in need thereof.

    [0291] All patents, patent applications and publications mentioned herein are hereby incorporated by reference in their entirety.

    [0292] Although disclosure has been provided in some detail by way of illustration and example for the purposes of clarity of understanding, it will be apparent to those skilled in the art that various changes and modifications can be practiced without departing from the spirit or scope of the disclosure. Accordingly, the foregoing descriptions and examples should not be construed as limiting.