METHODS AND COMPOSITIONS FOR TREATING INFLAMMATORY OR AUTOIMMUNE DISEASES OR CONDITIONS USING CALCITONIN RECEPTOR ACTIVATORS

20190233527 ยท 2019-08-01

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention provides methods for treating inflammatory or autoimmune disease using calcitonin receptor activators, such as calcitonin receptor activating antibodies, among others. The invention also features compositions containing calcitonin receptor activators, methods of diagnosing patients with calcitonin receptor-associated inflammatory or autoimmune disease, and methods of predicting the response of an inflammatory or autoimmune disease or condition in a subject to treatment with calcitonin receptor activators.

    Claims

    1. A method of treating a human subject identified as having an IL-6-associated inflammatory or autoimmune disease or condition, the method comprising administering to the subject an amount of a peptide or small molecule calcitonin receptor agonist effective to reduce IL-6 secretion by macrophages, thereby treating the subject.

    2. (canceled)

    3. The method of claim 1, wherein the inflammatory or autoimmune disease or condition is rheumatoid arthritis, multiple sclerosis, asthma, fibrosis, systemic lupus erythematosus, myasthenia gravis, Sjogren's syndrome, systemic sclerosis, or vasculitis.

    Description

    DETAILED DESCRIPTION

    [0135] Described herein are compositions and methods for the treatment of an inflammatory or autoimmune disease or condition in a subject (e.g., a mammalian subject, such as a human) by administering calcitonin receptor activators. Calcitonin receptor activators include activators specific to a calcitonin receptor (e.g., calcitonin receptor-specific activating antibodies) and non-specific activators that could potentially affect other proteins due to their having shared binding partners or signaling pathways with a calcitonin receptor. These methods and compositions provide new mechanistic approaches for treating inflammatory or autoimmune diseases or conditions.

    Calcitonin Receptor and AMY1 Receptor

    [0136] Calcitonin receptor (CALCR, Entrez Gene ID 799) is a G protein-coupled receptor (GPCR) that associates with Receptor Activity Modifying Protein 1 (RAMP1, Entrez Gene ID 10267) to sense calcitonin, amylin, and CGRP via G-protein signaling, subsequently activating adenylate cyclase. RAMP1 is a single-pass transmembrane protein that helps shuttle CALCR to the plasma membrane where it serves as a co-receptor protein forming the AMY1 receptor. GPCRs are integral membrane proteins that possess seven membrane-spanning domains or transmembrane helices. The GPCRs are activated by external signal in the form of a ligand or other signal mediator, which creates a conformational change in the receptor, causing the activation of a G protein. This triggers the activation of signal transduction pathways, and eventually leads to cellular responses.

    [0137] The present invention relates to the discovery that, contrary to the conventional wisdom that calcitonin receptors are exclusively neuronal proteins, CALCR and RAMP1 are highly expressed in M2 macrophages from human patients. Providing calcitonin receptor agonist to macrophages polarized to an M2 phenotype and stimulated with LPS to initiate polarization to the M1 state reduces the production and/or secretion of IL-6, a pro-inflammatory cytokine normally secreted by M1 macrophages. Additionally, calcitonin receptor agonism decreased interferon gamma (IFN) production in M1 macrophages.

    [0138] These findings indicate that activation of the calcitonin receptor pathway may help to reduce the production of pro-inflammatory cytokines and protect the host from excessive, aberrant immune responses. Through this mechanism, activation of a calcitonin receptor can reduce inflammation, induce tolerance, and be used as a therapeutic strategy for treating inflammatory and autoimmune diseases or conditions.

    Calcitonin Receptor Activators

    [0139] Calcitonin receptor activators described herein can increase or activate calcitonin receptor function or signaling in order to treat inflammatory or autoimmune diseases or conditions. Calcitonin receptor activators can be grouped into categories based on their mechanism of action and their effect on calcitonin receptor: 1) calcitonin receptor-specific activators (e.g., activators that activate only calcitonin receptor function or signaling, such as calcitonin receptor-specific activating antibodies) and 2) calcitonin receptor function activators (e.g., activators that agonize calcitonin receptor or promote or increase calcitonin receptor interaction with a binding partner, e.g., soluble calcitonin receptor binding partners).

    [0140] Calcitonin Receptor-Specific Activators

    [0141] In some embodiments, the calcitonin receptor activator is a calcitonin receptor-specific activator. Calcitonin receptor-specific activators selectively increase or activate calcitonin receptor function, expression, or signaling without directly affecting other proteins (e.g., other GPCRs). Calcitonin receptor-specific activators include calcitonin receptor-specific activating antibodies or antigen binding fragments thereof (e.g., agonist antibodies, e.g., CALCR-specific activating antibodies or antigen binding fragments thereof, RAMP1-specific activating antibodies or antigen binding fragments thereof, and AMY1 receptor-specific activating antibodies or antigen binding fragments thereof). Calcitonin receptor-specific activators can increase calcitonin receptor function, expression, or signaling by 5% or more (e.g., 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99%, or more).

    [0142] In some embodiments, the calcitonin receptor antibody is a calcitonin receptor-specific activating antibody or an antigen binding fragment thereof that binds to a calcitonin receptor (e.g., CALCR, RAMP1, or the AMY1 receptor (CALCR and RAMP1)) and increases or activates calcitonin receptor function. Calcitonin receptor-specific activating antibodies include antibodies that bind to the calcitonin receptor and exhibit one or more of the following activities: (a) agonizes the calcitonin receptor (e.g., agonizes the AMY1 receptor); (b) agonizes CALCR; (c) agonizes RAMP1; (d) binds to one or more of amino acids 43-171 of the N-terminal extracellular domain of CALCR; or (e) binds to one or more of amino acids 27-117 of the extracellular domain of RAMP1. Antibodies having one or more of these functional properties are routinely screened and selected once the desired functional property is identified herein (e.g., by screening of phage display or other antibody libraries).

    [0143] Calcitonin Receptor Function Activators

    [0144] In some embodiments, the calcitonin receptor activator is a calcitonin receptor function activator. Calcitonin receptor function activators increase or activate calcitonin receptor function by increasing calcitonin receptor expression or activation or promoting interaction with a calcitonin receptor binding partner. Calcitonin receptor function activators include calcitonin receptor-specific activators that increase or activate calcitonin receptor function or expression (e.g., calcitonin receptor-specific activating antibodies or antigen binding fragments thereof) and soluble calcitonin receptor binding partners or fragments thereof (e.g., calcitonin, CGRP neuropeptide, or amylin peptides, and calcitonin, CGRP neuropeptide, or amylin Fc-fusion proteins). Calcitonin receptor activators also include mRNAs that encode any of the aforementioned soluble calcitonin receptor binding partners.

    [0145] In some embodiments, the calcitonin receptor function activator is a soluble calcitonin receptor binding partner. In some embodiments, the calcitonin receptor binding partner is a soluble, signaling-capable calcitonin, CGRP neuropeptide, or amylin peptide (e.g., calcitonin, CGRP neuropeptide, or amylin, a calcitonin, CGRP neuropeptide, or amylin-derived sequence, or a fragment thereof that is capable of binding to and activating a calcitonin receptor (e.g., CALCR and/or RAMP1) or increasing calcitonin receptor signaling). In some embodiments, the soluble, full-length calcitonin receptor binding partner has the sequence of WT human calcitonin (CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP), or has at least 85% sequence identity (e.g., 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to the amino acid sequence of WT calcitonin. In some embodiments, the soluble calcitonin receptor binding partner has the sequence of wild-type CGRP neuropeptide (ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF), or has at least 85% sequence identity (e.g., 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to the amino acid sequence of WT human CGRP neuropeptide. In some embodiments, the soluble calcitonin receptor binding partner has the sequence of wild-type amylin (MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRL ANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL), or has at least 85% sequence identity (e.g., 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to the amino acid sequence of WT human amylin. In some embodiments, the soluble calcitonin receptor binding partner is a fragment of the full-length calcitonin receptor binding partner (e.g., a fragment of calcitonin, CGRP neuropeptide, or amylin) that retains the ability to bind to calcitonin receptor. A fragment of a calcitonin receptor binding partner may be made up of the minimal amino acid sequence necessary to bind to calcitonin receptor. In some embodiments, the calcitonin receptor binding partner (e.g., calcitonin, CGRP neuropeptide, or amylin, a calcitonin, CGRP neuropeptide, or amylin-derived sequence, or a fragment thereof) is fused (e.g., linked or conjugated) to an Fc domain, albumin, or other protein scaffold. In some embodiments, the calcitonin receptor binding partner is PEGylated or formulated local injection or depot injection.

    [0146] To activate calcitonin receptor function, the soluble calcitonin receptor binding partner or a fragment thereof must retain the ability to bind to a calcitonin receptor (e.g., CALCR and/or RAMP1). The soluble calcitonin receptor binding partner or a fragment thereof can bind to an endogenous calcitonin receptor (e.g., a calcitonin receptor expressed by immune cells). The soluble calcitonin receptor binding partner or a fragment thereof binds to a calcitonin receptor and exhibits one or more of the following activities: (a) agonizes the calcitonin receptor (e.g., agonizes the AMY1 receptor); (b) agonizes CALCR; (c) agonizes RAMP1; (d) binds to one or more of amino acids 43-171 of the N-terminal extracellular domain of CALCR; or (e) binds to one or more of amino acids 27-117 of the extracellular domain of RAMP1. For improved stability or increased half-life, the soluble calcitonin receptor binding partner or a fragment thereof can be linked to the Fc region of an antibody (e.g., synthesized as an Fc-fusion protein) or fused to albumin or another protein scaffold. Soluble calcitonin receptor binding partners or fragments thereof can be evaluated using standard experimental methods to determine whether they possess one or more of these functional properties. In some embodiments, the soluble calcitonin receptor binding partner (e.g., calcitonin, CGRP neuropeptide, amylin, or a fragment or Fc fusion thereof) is PEGylated or formulated for local injection or depot injection.

    [0147] In some embodiments, the calcitonin receptor function activator is an mRNA that encodes any of the aforementioned soluble calcitonin receptor binding partners (e.g., calcitonin, CGRP neuropeptide, amylin, or a fragment or Fc fusion thereof).

    [0148] In some embodiments, the calcitonin receptor function activator is a peptide analog of amylin, such as pramlintide. In some embodiments, the calcitonin function activator is salmon calcitonin (DrugBank DB00017). In some embodiments, the calcitonin function activator is KBP-042 or KBP-089.

    [0149] Agent Modalities

    [0150] A calcitonin receptor activator can be selected from a number of different modalities. A calcitonin receptor activator can be a nucleic acid molecule (e.g., DNA molecule or RNA molecule, e.g., mRNA), small molecule, or a polypeptide (e.g., a soluble calcitonin receptor binding partner or a fragment thereof, or an antibody molecule, e.g., an antibody or antigen binding fragment thereof). A calcitonin receptor activator can also be a viral vector expressing a calcitonin receptor activator (e.g., a soluble calcitonin receptor binding partner) or a cell infected with a viral vector. Any of these modalities can be a calcitonin receptor activator directed to target (e.g., to increase or activate) calcitonin receptor function, calcitonin receptor expression, calcitonin receptor binding, or calcitonin receptor signaling.

    [0151] The nucleic acid molecule, small molecule, peptide, polypeptide, or antibody molecule can be modified. For example, the modification can be a chemical modification, e.g., conjugation to a marker, e.g., fluorescent marker or a radioactive marker. In other examples, the modification can include conjugation to a molecule that enhances the stability or half-life of the calcitonin receptor activator (e.g., an Fc domain of an antibody or serum albumin, e.g., human serum albumin). The modification can also include conjugation to an antibody to target the agent to a particular cell or tissue. Additionally, the modification can be a chemical modification, packaging modification (e.g., packaging within a nanoparticle or microparticle), or targeting modification to prevent the agent from crossing the blood brain barrier.

    [0152] Small Molecules

    [0153] Numerous small molecule calcitonin receptor activators useful in the methods of the invention are described herein and additional small molecule calcitonin receptor activators useful as therapies for inflammatory or autoimmune disease or condition can also be identified through screening based on their ability to reduce or inhibit calcitonin receptor function or signaling. Small molecules include, but are not limited to, small peptides, peptidomimetics (e.g., peptoids), amino acids, amino acid analogs, synthetic polynucleotides, polynucleotide analogs, nucleotides, nucleotide analogs, organic and inorganic compounds (including heterorganic and organometallic compounds) generally having a molecular weight less than about 5,000 grams per mole, e.g., organic or inorganic compounds having a molecular weight less than about 2,000 grams per mole, e.g., organic or inorganic compounds having a molecular weight less than about 1,000 grams per mole, e.g., organic or inorganic compounds having a molecular weight less than about 500 grams per mole, and salts, esters, and other pharmaceutically acceptable forms of such compounds.

    [0154] Calcitonin receptor activators can be used to treat a disorder or condition described herein. A pharmaceutical composition including the calcitonin receptor activator can be formulated for treatment of an inflammatory or autoimmune disease or condition described herein. In some embodiments, a pharmaceutical composition that includes the calcitonin receptor activator is formulated for local administration, e.g., to the affected site in a subject.

    [0155] Polypeptides

    [0156] In some embodiments, a calcitonin receptor activator described herein is a calcitonin receptor activator polypeptide (e.g., a neuropeptide) or an analog thereof. For example, a calcitonin receptor activator described herein is soluble calcitonin receptor binding partner (e.g., calcitonin, CGRP neuropeptide, or amylin) or an analog or fragment thereof.

    [0157] The calcitonin receptor activator can be a soluble calcitonin receptor binding partner or a fragment thereof. In some embodiments, the soluble calcitonin receptor binding partner or a fragment thereof is calcitonin, CGRP neuropeptide, or amylin, or peptide having a calcitonin, CGRP neuropeptide, or amylin-derived sequence. In some embodiments, the soluble calcitonin, CGRP neuropeptide, or amylin has the sequence of calcitonin, CGRP neuropeptide, or amylin, or has at least 85% sequence identity (e.g., 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to the amino acid sequence of wild-type human calcitonin, CGRP neuropeptide, or amylin. In some embodiments, the soluble calcitonin receptor binding partner is a fragment of the full-length calcitonin receptor binding partner that retains the ability to bind to calcitonin receptor. A fragment of a calcitonin receptor binding partner may be made up of the minimal amino acid sequence necessary to bind to calcitonin receptor. In some embodiments, the soluble calcitonin, CGRP neuropeptide, or amylin neuropeptide is an Fc-fusion peptide, or fused to albumin or other protein scaffold.

    [0158] Percent identity in the context of two or more polypeptide sequences or nucleic acids, refers to two or more sequences that are the same. Two sequences are substantially identical if two sequences have a specified percentage of amino acid residues or nucleotides that are the same (e.g., at least 60% identity, e.g., at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity, e.g., over a specified region, or, when not specified, over the entire sequence), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using a sequence comparison algorithms or by manual alignment and visual inspection. In some cases, the identity (or substantial identity) exists over a region that is at least about 50 nucleotides (or 10 amino acids) in length, or more preferably over a region that is 100 to 500 or 1000 or more nucleotides (or 20, 50, 200 or more amino acids) in length.

    [0159] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters. Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman, Adv. Appl. Math. 2:482c, 1970, by the homology alignment algorithm of Needleman and Wunsch, J. Mol. Biol. 48:443, 1970, by the search for similarity method of Pearson and Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444, 1988, by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by manual alignment and visual inspection (see, e.g., Brent et al., Current Protocols in Molecular Biology, 2003).

    [0160] Two examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., Nuc. Acids Res. 25:3389, 1977; and Altschul et al., J. Mol. Biol. 215:403, 1990, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information.

    [0161] The percent identity between two amino acid sequences can also be determined using the algorithm of E. Meyers and W. Miller, Comput. Appl. Biosci. 4:11, 1988) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. In addition, the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch, J. Mol. Biol. 48:444, 1970) algorithm which has been incorporated into the GAP program in the GCG software package (available at www.gcg.com), using either a Blossom 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.

    [0162] Methods of making a therapeutic polypeptide are routine in the art. See, in general, Smales & James (Eds.), Therapeutic Proteins: Methods and Protocols (Methods in Molecular Biology), Humana Press 2005; and Crommelin, Sindelar & Meibohm (Eds.), Pharmaceutical Biotechnology: Fundamentals and Applications, Springer 2013.

    [0163] Some methods for producing a calcitonin receptor activator polypeptide involve expression in mammalian cells, although recombinant proteins can also be produced using insect cells, yeast, bacteria, or other cells under the control of appropriate promoters. Mammalian expression vectors may include nontranscribed elements such as an origin of replication, a suitable promoter and enhancer, and other 5 or 3 flanking nontranscribed sequences, and 5 or 3 nontranslated sequences such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and termination sequences. DNA sequences derived from the SV40 viral genome, for example, SV40 origin, early promoter, enhancer, splice, and polyadenylation sites may be used to provide the other genetic elements required for expression of a heterologous DNA sequence. Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are described in Green & Sambrook, Molecular Cloning: A Laboratory Manual (Fourth Edition), Cold Spring Harbor Laboratory Press 2012.

    [0164] Various mammalian cell culture systems can be employed to express and manufacture recombinant protein. Examples of mammalian expression systems include CHO cells, COS cells, HeLA and BHK cell lines. Processes of host cell culture for production of protein therapeutics are described in Zhou and Kantardjieff (Eds.), Mammalian Cell Cultures for Biologics Manufacturing (Advances in Biochemical Engineering/Biotechnology), Springer 2014.

    [0165] Purification of protein therapeutics is known and is described, e.g., in Franks, Protein Biotechnology: Isolation, Characterization, and Stabilization, Humana Press 2013; and in Cutler, Protein Purification Protocols (Methods in Molecular Biology), Humana Press 2010.

    [0166] Formulation of protein therapeutics is known and is described, e.g., in Meyer (Ed.), Therapeutic Protein Drug Products: Practical Approaches to formulation in the Laboratory, Manufacturing, and the Clinic, Woodhead Publishing Series 2012.

    [0167] Antibodies

    [0168] The calcitonin receptor activator can be an antibody or antigen binding fragment thereof. For example, a calcitonin receptor activator described herein is an antibody that increases or activates the activity and/or function of a calcitonin receptor (e.g., CALCR or RAMP1) through binding to a calcitonin receptor to agonize calcitonin receptor.

    [0169] The making and use of therapeutic antibodies against a target antigen (e.g., a calcitonin receptor) is known in the art. See, for example, the references cited herein above, as well as Zhiqiang An (Editor), Therapeutic Monoclonal Antibodies: From Bench to Clinic. 1st Edition. Wiley 2009, and also Greenfield (Ed.), Antibodies: A Laboratory Manual. (Second edition) Cold Spring Harbor Laboratory Press 2013, for methods of making recombinant antibodies, including antibody engineering, use of degenerate oligonucleotides, 5-RACE, phage display, and mutagenesis; antibody testing and characterization; antibody pharmacokinetics and pharmacodynamics; antibody purification and storage; and screening and labeling techniques.

    [0170] Nucleic Acids

    [0171] Synthetic mRNA

    [0172] In some embodiments, the calcitonin receptor activator is an mRNA molecule, e.g., a synthetic mRNA molecule encoding a calcitonin receptor activator (e.g., a soluble calcitonin receptor binding partner or a fragment thereof, e.g., soluble calcitonin, CGRP neuropeptide, or amylin). The mRNA molecule may increase the level (e.g., protein and/or mRNA level) and/or activity or function of a calcitonin receptor activator (e.g., a soluble calcitonin receptor binding partner or fragments thereof, e.g., soluble calcitonin, CGRP neuropeptide, or amylin), e.g., a positive regulator of function. For example, the mRNA molecule encodes a polypeptide having at least 50% (e.g., at least 50%, 60%, 70%, 80%, 90%, 95%, 97%, 99%, or greater) identity to the amino acid sequence a calcitonin receptor binding partner (e.g., calcitonin, CGRP neuropeptide, or amylin). In other examples, the mRNA molecule has at least 50% (e.g., at least 50%, 60%, 70%, 80%, 90%, 95%, 97%, 99%, or greater) identity to the nucleic acid sequence of a calcitonin receptor binding partner (e.g., calcitonin, CGRP neuropeptide, or amylin). The mRNA molecule can encode an amino acid sequence differing by no more than 30 (e.g., no more than 30, 20, 10, 5, 4, 3, 2, or 1) amino acids to the amino acid sequence of a calcitonin receptor binding partner (e.g., calcitonin, CGRP neuropeptide, or amylin). The mRNA molecule can have a sequence encoding a fragment of a calcitonin receptor binding partner (e.g., calcitonin, CGRP neuropeptide, or amylin). For example, the fragment includes 10-20, 20-40, 40-60, 60-80, 80-100, 100-120, 120-140, 140-160, 160-180, 180-200, 200-250, 250-300, 300-400, 400-500, 500-600, or more amino acids in length. In embodiments, the fragment is a functional fragment, e.g., having at least 20%, e.g., at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or greater, of an activity of a full length calcitonin receptor binding partner (e.g., calcitonin, CGRP neuropeptide, or amylin). In embodiments, the mRNA molecule increases the level and/or activity or function of or encodes a calcitonin receptor binding partner (e.g., calcitonin, CGRP neuropeptide, or amylin).

    [0173] The synthetic mRNA molecule can be modified, e.g., chemically. The mRNA molecule can be chemically synthesized or transcribed in vitro. The mRNA molecule can be disposed on a plasmid, e.g., a viral vector, bacterial vector, or eukaryotic expression vector. In some examples, the mRNA molecule can be delivered to cells by transfection, electroporation, or transduction (e.g., adenoviral or lentiviral transduction).

    [0174] In some embodiments, the modified RNA encoding a calcitonin receptor binding partner (e.g., calcitonin, CGRP neuropeptide, or amylin), or another gene of interest described herein has modified nucleosides or nucleotides. Such modifications are known and are described, e.g., in WO 2012/019168. Additional modifications are described, e.g., in WO2015038892; WO2015038892; WO2015089511; WO2015196130; WO2015196118 and WO2015196128A2.

    [0175] In some embodiments, the modified RNA encoding a polypeptide of interest described herein has one or more terminal modifications, e.g., a 5Cap structure and/or a poly-A tail (e.g., of between 100-200 nucleotides in length). The 5 cap structure may be selected from the group consisting of CapO, CapI, ARCA, inosine, NI-methyl-guanosine, 2fluoro-guanosine, 7-deaza-guanosine, 8-oxo-guanosine, 2-amino-guanosine, LNA-guanosine, and 2-azido-guanosine. In some cases, the modified RNAs also contain a 5 UTR including at least one Kozak sequence, and a 3 UTR. Such modifications are known and are described, e.g., in WO2012135805 and WO2013052523. Additional terminal modifications are described, e.g., in WO2014164253 and WO2016011306. WO2012045075 and WO2014093924

    [0176] Chimeric enzymes for synthesizing capped RNA molecules (e.g., modified mRNA) which may include at least one chemical modification are described in WO2014028429.

    [0177] In some embodiments, a modified mRNA may be cyclized, or concatemerized, to generate a translation competent molecule to assist interactions between poly-A binding proteins and 5-end binding proteins. The mechanism of cyclization or concatemerization may occur through at least 3 different routes: 1) chemical, 2) enzymatic, and 3) ribozyme catalyzed. The newly formed 5-/3-linkage may be intramolecular or intermolecular. Such modifications are described, e.g., in WO2013151736.

    [0178] Methods of making and purifying modified RNAs are known and disclosed in the art. For example, modified RNAs are made using only in vitro transcription (IVT) enzymatic synthesis. Methods of making IVT polynucleotides are known in the art and are described in WO2013151666, WO2013151668, WO2013151663, WO2013151669, WO2013151670, WO2013151664, WO2013151665, WO2013151671, WO2013151672, WO2013151667 and WO2013151736.S Methods of purification include purifying an RNA transcript including a polyA tail by contacting the sample with a surface linked to a plurality of thymidines or derivatives thereof and/or a plurality of uracils or derivatives thereof (polyT/U) under conditions such that the RNA transcript binds to the surface and eluting the purified RNA transcript from the surface (WO2014152031); using ion (e.g., anion) exchange chromatography that allows for separation of longer RNAs up to 10,000 nucleotides in length via a scalable method (WO2014144767); and subjecting a modified mRNA sample to DNAse treatment (WO2014152030).

    [0179] Formulations of modified RNAs are known and are described, e.g., in WO2013090648. For example, the formulation may be, but is not limited to, nanoparticles, poly(lactic-co-glycolic acid) (PLGA) microspheres, lipidoids, lipoplex, liposome, polymers, carbohydrates (including simple sugars), cationic lipids, fibrin gel, fibrin hydrogel, fibrin glue, fibrin sealant, fibrinogen, thrombin, rapidly eliminated lipid nanoparticles (reLNPs) and combinations thereof.

    [0180] Modified RNAs encoding polypeptides in the fields of human disease, antibodies, viruses, and a variety of in vivo settings are known and are disclosed in for example, Table 6 of International Publication Nos. WO2013151666, WO2013151668, WO2013151663, WO2013151669, WO2013151670, WO2013151664, WO2013151665, and WO2013151736; Tables 6 and 7 of International Publication No. WO2013151672; Tables 6, 178 and 179 of International Publication No. WO2013151671; Tables 6, 185 and 186 of International Publication No. WO2013151667. Any of the foregoing may be synthesized as an IVT polynucleotide, chimeric polynucleotide or a circular polynucleotide, and each may include one or more modified nucleotides or terminal modifications.

    [0181] Viral Vectors

    [0182] The calcitonin receptor activator can be delivered by a viral vector (e.g., a viral vector expressing a calcitonin receptor activator). Viral vectors can be used to express a transgene encoding a soluble calcitonin receptor binding partner or a fragment thereof (e.g., calcitonin, CGRP neuropeptide, or amylin). A viral vector may be administered to a cell or to a subject (e.g., a human subject or animal model) to increase expression of a soluble calcitonin receptor binding partner or a fragment thereof (e.g., calcitonin, CGRP neuropeptide, or amylin). Viral vectors can also be used to express a neurotoxin from Table 8. A viral vector expressing a neurotoxin from Table 8 can be administered to a cell or to a subject (e.g., a human subject or animal model) to decrease or block neurotransmission. Viral vectors can be directly administered (e.g., injected) to a lymph node, lymphoid organ, gut, spleen, skin, airway, wound, or site of inflammation to treat inflammatory or autoimmune disease or condition.

    [0183] Viral genomes provide a rich source of vectors that can be used for the efficient delivery of exogenous genes into a mammalian cell. Viral genomes are particularly useful vectors for gene delivery because the polynucleotides contained within such genomes are typically incorporated into the nuclear genome of a mammalian cell by generalized or specialized transduction. These processes occur as part of the natural viral replication cycle, and do not require added proteins or reagents in order to induce gene integration. Examples of viral vectors include a retrovirus (e.g., Retroviridae family viral vector), adenovirus (e.g., Ad5, Ad26, Ad34, Ad35, and Ad48), parvovirus (e.g., adeno-associated viruses), coronavirus, negative strand RNA viruses such as orthomyxovirus (e.g., influenza virus), rhabdovirus (e.g., rabies and vesicular stomatitis virus), paramyxovirus (e.g., measles and Sendai), positive strand RNA viruses, such as picornavirus and alphavirus, and double stranded DNA viruses including adenovirus, herpesvirus (e.g., Herpes Simplex virus types 1 and 2, Epstein-Barr virus, cytomegalovirus, replication deficient herpes virus), and poxvirus (e.g., vaccinia, modified vaccinia Ankara (MVA), fowlpox and canarypox). Other viruses include Norwalk virus, togavirus, flavivirus, reoviruses, papovavirus, hepadnavirus, human papilloma virus, human foamy virus, and hepatitis virus, for example. Examples of retroviruses include: avian leukosis-sarcoma, avian C-type viruses, mammalian C-type, B-type viruses, D-type viruses, oncoretroviruses, HTLV-BLV group, lentivirus, alpharetrovirus, gammaretrovirus, spumavirus (Coffin, J. M., Retroviridae: The viruses and their replication, Virology (Third Edition) Lippincott-Raven, Philadelphia, 1996). Other examples include murine leukemia viruses, murine sarcoma viruses, mouse mammary tumor virus, bovine leukemia virus, feline leukemia virus, feline sarcoma virus, avian leukemia virus, human T-cell leukemia virus, baboon endogenous virus, Gibbon ape leukemia virus, Mason Pfizer monkey virus, simian immunodeficiency virus, simian sarcoma virus, Rous sarcoma virus and lentiviruses. Other examples of vectors are described, for example, in U.S. Pat. No. 5,801,030, the teachings of which are incorporated herein by reference.

    [0184] Cell-Based Therapies

    [0185] A calcitonin receptor activator described herein can be administered to a cell in vitro (e.g., an immune cell), which can subsequently be administered to a subject (e.g., a human subject or animal model). The calcitonin receptor activator can be administered to the cell to effect an immune response (e.g., migration, proliferation, recruitment, lymph node homing, lymph node egress, differentiation, activation, polarization, cytokine production, degranulation, maturation, antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), antigen presentation, or calcitonin receptor expression) as described herein. Once the immune response is elicited, the cell can be administered to a subject (e.g., injected) to treat an inflammatory or autoimmune or disease or condition, or infection. The immune cell can be locally administered (e.g., administered to a lymph node or secondary or tertiary lymphoid organ, the spleen, barrier tissue, the skin, gut, an airway, a wound, a mucosal surface, or a site of inflammation or infection).

    [0186] A calcitonin receptor activator can also be administered to a cell in vitro (e.g., an immune cell, e.g., a macrophage) to alter gene expression in the cell. The calcitonin receptor activator can increase the expression of calcitonin receptor in an immune cell (e.g., a macrophage). The calcitonin receptor activator can be a polypeptide or nucleic acid (e.g., mRNA) described above. The calcitonin receptor activator can be an exogenous gene encoded by a plasmid that is introduced into the cell using standard methods (e.g., calcium phosphate precipitation, electroporation, microinjection, infection, lipofection, impalefection, laserfection, or magnetofection). The calcitonin receptor activator can be a viral vector (e.g., a viral vector expressing a calcitonin receptor activator) that is introduced to the cell using standard transduction methods. The plasmid or vector can also contain a reporter construct (e.g., a fluorescent reporter) that can be used to confirm expression of the transgene by the immune cell. After the immune cell has been contacted with a calcitonin receptor activator to increase gene expression, the cell can be administered to a subject (e.g., injected) to treat an inflammatory or autoimmune or disease or condition, or infection. The immune cell can be locally administered (e.g., administered to a lymph node or secondary or tertiary lymphoid organ, the spleen, barrier tissue, the skin, gut, an airway, a wound, a mucosal surface, or a site of inflammation or infection).

    [0187] The cell can be administered to a subject immediately after being contacted with a calcitonin receptor activator (e.g., within 5, 10, 15, 30, 45, or 60 minutes of being contacted with a calcitonin receptor activator), or 6 hours, 12 hours, 24 hours, 2 days, 3, days, 4 days, 5, days, 6 days, 7 days or more after being contacted with a calcitonin receptor activator. The method can include an additional step of evaluating the immune cell for an immune cell activity (e.g., migration, proliferation, recruitment, lymph node homing, lymph node egress, differentiation, activation, polarization, cytokine production, degranulation, maturation, ADCC, ADCP, or antigen presentation) or modulation of gene expression after contact with a calcitonin receptor activator and before administration to a subject.

    Blood Brain Barrier Permeability

    [0188] In some embodiments, the calcitonin receptor activators for use in the present invention are agents that are not capable of crossing, or that do not cross, the blood brain barrier (BBB) of a mammal, e.g., an experimental rodent (e.g., mouse or rat), dog, pig, non-human primate, or a human. The BBB is a highly selective semipermeable membrane barrier that separates the circulating blood from the brain extracellular fluid (e.g., cerebrospinal fluid) in the central nervous system (CNS). The BBB is made up of high-density endothelial cells, which are connected by tight junctions. These cells prevent most molecular compounds in the bloodstream (e.g., large molecules and hydrophilic molecules) from entering the brain. Water, some gases (e.g., oxygen and carbon dioxide), and lipid-soluble molecules (e.g., hydrophobic molecules, such as steroid hormones) can cross the BBB by passive diffusion. Molecules that are needed for neural function, such as glucose and amino acids, are actively transported across the BBB.

    [0189] A number of approaches can be used to render an agent BBB impermeable. These methods include modifications to increase an agent's size, polarity, or flexibility or reduce its lipophilicity, targeting approaches to direct an agent to another part of the body and away from the brain, and packaging approaches to deliver an agent in a form that does not freely diffuse across the BBB. These approaches can be used to render a BBB permeable calcitonin receptor activator impermeable, and they can also be used to improve the properties (e.g., cell-specific targeting) of a calcitonin receptor activator that does not cross the BBB. The methods that can be used to render an agent BBB impermeable are discussed in greater detail herein below.

    [0190] Formulation of BBB-Permeable Agents for Enhanced Cell Targeting

    [0191] One approach that can be used to render a calcitonin receptor activator BBB impermeable is to conjugate the agent to a targeting moiety that directs it somewhere other than the brain. The targeting moiety can be an antibody for a receptor expressed by the target cell (e.g., N-Acetylgalactosamine for liver transport; DGCR2, GBF1, GPR44 or SerpinB10 for pancreas transport; Secretoglobin, family 1A, member 1 for lung transport). The targeting moiety can also be a ligand of any receptor or other molecular identifier expressed on the target cell in the periphery. These targeting moieties can direct the calcitonin receptor activator of interest to its corresponding target cell, and can also prevent BBB crossing by directing the agent away from the BBB and increasing the size of the calcitonin receptor activator via conjugation of the targeting moiety.

    [0192] Calcitonin receptor activators can also be rendered BBB impermeable through formulation in a particulate delivery system (e.g., a nanoparticle, liposome, or microparticle), such that the agent is not freely diffusible in blood and cannot cross the BBB. The particulate formulation used can be chosen based on the desired localization of the calcitonin receptor activator (e.g., a lymph node, lymphoid organ, or site of inflammation), as particles of different sizes accumulate in different locations. For example, nanoparticles with a diameter of 45 nm or less enter the lymph node, while 100 nm nanoparticles exhibit poor lymph node trafficking. Some examples of the link between particle size and localization in vivo are described in Reddy et al., J Controlled Release 112:26 2006, and Reddy et al., Nature Biotechnology 25:1159 2007.

    [0193] Calcitonin receptor activators can be tested after the addition of a targeting moiety or after formulation in a particulate delivery system to determine whether or not they cross the BBB. Models for assessing BBB permeability include in vitro models (e.g., monolayer models, co-culture models, dynamic models, multi-fluidic models, isolated brain microvessels), in vivo models, and computational models as described in He et al., Stroke 45:2514 2014; Bickel, NeuroRx 2:15 2005; and Wang et al., Int J Pharm 288:349 2005. A calcitonin receptor activator that exhibits BBB impermeability can be used in the methods described herein.

    [0194] Modification of Existing Compounds to Render them BBB Impermeable

    [0195] There are multiple parameters that have been empirically derived in the field of medicinal chemistry to predict whether a compound will cross the BBB. The most common numeric value for describing permeability across the BBB is the log BB, defined as the logarithmic ratio of the concentration of a compound in the brain and in the blood. Empirical rules of thumb have been developed to predict BBB permeability, including rules regarding molecular size, polar surface area, sum of oxygen and nitrogen atoms, lipophilicity (e.g., partition coefficient between apolar solvent and water), lipoaffinity, molecular flexibility, and number of rotable bonds (summarized in Muehlbacher et al., J Comput Aided Mol Des. 25: 1095 2011; and Geldenhuys et al., Ther Deliv. 6: 961 2015). Some preferred limits on various parameters for BBB permeability are listed in Table 1 of Ghose et al., ACS Chem Neurosci. 3: 50 2012, which is incorporated herein by reference. Based on the parameters shown in the table, one of skill in the art could modify an existing calcitonin receptor activator to render it BBB impermeable.

    [0196] One method of modifying a calcitonin receptor activator to prevent BBB crossing is to add a molecular adduct that does not affect the target binding specificity, kinetics, or thermodynamics of the agent. Molecular adducts that can be used to render an agent BBB impermeable include polyethylene glycol (PEG), a carbohydrate monomer or polymer, a dendrimer, a polypeptide, a charged ion, a hydrophilic group, deuterium, and fluorine. Calcitonin receptor activators can be tested after the addition of one or more molecular adducts or after any other properties are altered to determine whether or not they cross the BBB. Models for assessing BBB permeability include in vitro models (e.g., monolayer models, co-culture models, dynamic models, multi-fluidic models, isolated brain microvessels), in vivo models, and computational models as described in He et al., Stroke 45:2514 2014; Bickel, NeuroRx 2:15 2005; and Wang et al., Int J Pharm 288:349 2005. A calcitonin receptor activator that exhibits BBB impermeability can be used in the methods described herein.

    [0197] Screening for or Development of BBB Impermeable Agents

    [0198] Another option for developing BBB impermeable agents is to find or develop new agents that do not cross the BBB. One method for finding new BBB impermeable agents is to screen for compounds that are BBB impermeable. Compound screening can be performed using in vitro models (e.g., monolayer models, co-culture models, dynamic models, multi-fluidic models, isolated brain microvessels), in vivo models, and computational models, as described in He et al., Stroke 45:2514 2014; Bickel, NeuroRx 2:15 2005; Wang et al., Int J Pharm 288:349 2005, and Czupalla et al., Methods Mol Biol 1135:415 2014. For example, the ability of a molecule to cross the blood brain barrier can be determined in vitro using a transwell BBB assay in which microvascular endothelial cells and pericytes are co-cultured separated by a thin macroporous membrane, see e.g., Naik et al., J Pharm Sci 101:1337 2012 and Hanada et al., Int J Mol Sci 15:1812 2014; or in vivo by tracking the brain uptake of the target molecule by histology or radio-detection. Compounds would be deemed appropriate for use as calcitonin receptor activators in the methods described herein if they do not display BBB permeability in the aforementioned models.

    Modulation of Immune Cells

    [0199] The methods described herein can be used to modulate an immune response in a subject or cell by administering to a subject or cell a calcitonin receptor activator in a dose (e.g., an effective amount) and for a time sufficient to modulate the immune response. These methods can be used to treat a subject in need of modulating an immune response, e.g., a subject with an inflammatory condition, an autoimmune disease or condition, or a chronic infection. One way to modulate an immune response is to modulate an immune cell activity. This modulation can occur in vivo (e.g., in a human subject or animal model) or in vitro (e.g., in acutely isolated or cultured cells, such as human cells from a patient, repository, or cell line, or rodent cells). The types of cells that can be modulated include T cells (e.g., peripheral T cells, cytotoxic T cells/CD8+ T cells, T helper cells/CD4+ T cells, memory T cells, regulatory T cells/Tregs, natural killer T cells/NKTs, mucosal associated invariant T cells, and gamma delta T cells), B cells (e.g., memory B cells, plasmablasts, plasma cells, follicular B cells/B-2 cells, marginal zone B cells, B-1 cells, regulatory B cells/Bregs), dendritic cells (e.g., myeloid DCs/conventional DCs, plasmacytoid DCs, or follicular DCs), granulocytes (e.g., eosinophils, mast cells, neutrophils, and basophils), monocytes, macrophages (e.g., peripheral macrophages or tissue resident macrophages), myeloid-derived suppressor cells, natural killer (NK) cells, innate lymphoid cells (e.g., ILC1s, ILC2s, and ILC3s), thymocytes, and megakaryocytes.

    [0200] The immune cell activities that can be modulated by administering to a subject or contacting a cell with an effective amount of a calcitonin receptor activator described herein include activation (e.g., macrophage, T cell, NK cell, ILC, B cell, dendritic cell, neutrophil, eosinophil, or basophil activation), phagocytosis (e.g., macrophage, neutrophil, monocyte, mast cell, B cell, eosinophil, or dendritic cell phagocytosis), antibody-dependent cellular phagocytosis (e.g., ADCP by monocytes, macrophages, neutrophils, or dendritic cells), antibody-dependent cellular cytotoxicity (e.g., ADCC by NK cells, ILCs, monocytes, macrophages, neutrophils, eosinophils, dendritic cells, or T cells), polarization (e.g., macrophage polarization toward an M1 or M2 phenotype or T cell polarization), proliferation (e.g., proliferation of B cells, T cells, monocytes, macrophages, dendritic cells, NK cells, ILCs, mast cells, neutrophils, eosinophils, or basophils), lymph node homing (e.g., lymph node homing of T cells, B cells, dendritic cells, or macrophages), lymph node egress (e.g., lymph node egress of T cells, B cells, dendritic cells, or macrophages), recruitment (e.g., recruitment of B cells, T cells, monocytes, macrophages, dendritic cells, NK cells, ILCs, mast cells, neutrophils, eosinophils, or basophils), migration (e.g., migration of B cells, T cells, monocytes, macrophages, dendritic cells, NK cells, ILCs, mast cells, neutrophils, eosinophils, or basophils), differentiation (e.g., regulatory T cell differentiation), immune cell cytokine production, antigen presentation (e.g., dendritic cell, macrophage, and B cell antigen presentation), maturation (e.g., dendritic cell maturation), and degranulation (e.g., mast cell, NK cell, ILCs, cytotoxic T cell, neutrophil, eosinophil, or basophil degranulation). Innervation of lymph nodes or lymphoid organs, development of HEVs), and development of TLOs can also be modulated using the methods described herein. Modulation can increase or decrease these activities, depending on the calcitonin receptor activator used to contact the cell or treat a subject.

    [0201] In some embodiments, an effective amount of a calcitonin receptor activator is an amount sufficient to modulate (e.g., increase or decrease) one or more (e.g., 2 or more, 3 or more, 4 or more) of the following immune cell activities in the subject or cell: T cell polarization; T cell activation; dendritic cell activation; neutrophil activation; eosinophil activation; basophil activation; T cell proliferation; B cell proliferation; T cell proliferation; monocyte proliferation; macrophage proliferation; dendritic cell proliferation; NK cell proliferation; ILC proliferation, mast cell proliferation; neutrophil proliferation; eosinophil proliferation; basophil proliferation; cytotoxic T cell activation; circulating monocytes; peripheral blood hematopoietic stem cells; macrophage polarization; macrophage phagocytosis; macrophage ADCP, neutrophil phagocytosis; monocyte phagocytosis; mast cell phagocytosis; B cell phagocytosis; eosinophil phagocytosis; dendritic cell phagocytosis; macrophage activation; antigen presentation (e.g., dendritic cell, macrophage, and B cell antigen presentation); antigen presenting cell migration (e.g., dendritic cell, macrophage, and B cell migration); lymph node immune cell homing and cell egress (e.g., lymph node homing and egress of T cells, B cells, dendritic cells, or macrophages); NK cell activation; NK cell ADCC, mast cell degranulation; NK cell degranulation; ILC activation, ILC ADCC, ILC degranulation, cytotoxic T cell degranulation; neutrophil degranulation; eosinophil degranulation; basophil degranulation; neutrophil recruitment; eosinophil recruitment; NKT cell activation; B cell activation; regulatory T cell differentiation; dendritic cell maturation; development of HEVs; development of TLOs; or lymph node or secondary lymphoid organ innervation. In certain embodiments, the immune response (e.g., an immune cell activity listed herein) is increased or decreased in the subject or cell at least 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 50%, 60%, 70%, 80%, 100%, 150%, 200%, 300%, 400%, 500% or more, compared to before the administration. In certain embodiments, the immune response is increased or decreased in the subject or cell between 5-20%, between 5-50%, between 10-50%, between 20-80%, between 20-70%, between 50-200%, between 100%-500%.

    [0202] After a calcitonin receptor activator is administered to treat a patient or contact a cell, a readout can be used to assess the effect on immune cell activity. Immune cell activity can be assessed by measuring a cytokine or marker associated with a particular immune cell type (e.g., a macrophage), as listed in Table 1 (e.g., performing an assay listed in Table 1 for the cytokine or marker). In certain embodiments, the parameter is increased or decreased in the subject at least 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 50%, 60%, 70%, 80%, 100%, 150%, 200%, 300%, 400%, 500% or more, compared to before the administration. In certain embodiments, the parameter is increased or decreased in the subject between 5-20%, between 5-50%, between 10-50%, between 20-80%, between 20-70%, between 50-200%, between 100%-500%. A calcitonin receptor activator can be administered at a dose (e.g., an effective amount) and for a time sufficient to modulate an immune cell activity described herein below.

    [0203] After a calcitonin receptor activator is administered to treat a patient or contact a cell, a readout can be used to assess the effect on immune cell migration. Immune cell migration can be assessed by measuring the number of immune cells in a location of interest (e.g., a lymph node or secondary lymphoid organ, or site of inflammation). Immune cell migration can also be assessed by measuring a chemokine, receptor, or marker associated with immune cell migration, as listed in Tables 2 and 3. In certain embodiments, the parameter is increased or decreased in the subject at least 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 50%, 60%, 70%, 80%, 100%, 150%, 200%, 300%, 400%, 500% or more, compared to before the administration. In certain embodiments, the parameter is increased or decreased in the subject between 5-20%, between 5-50%, between 10-50%, between 20-80%, between 20-70%, between 50-200%, between 100%-500%. A calcitonin receptor activator can be administered at a dose (e.g., an effective amount) and for a time sufficient to modulate an immune cell migration as described herein below.

    [0204] A calcitonin receptor activator described herein can affect immune cell migration. Immune cell migration between peripheral tissues, the blood, and the lymphatic system as well as lymphoid organs is essential for the orchestration of productive innate and adaptive immune responses. Immune cell migration is largely regulated by trafficking molecules including integrins, immunoglobulin cell-adhesion molecules (IgSF CAMs), cadherins, selectins, and a family of small cytokines called chemokines (Table 2). Cell adhesion molecules and chemokines regulate immune cell migration by both inducing extravasation from the circulation into peripheral tissues and acting as guidance cues within peripheral tissues themselves. For extravasation to occur, chemokines must act in concert with multiple trafficking molecules including C-type lectins (L-, P-, and E-selectin), multiple integrins, and cell adhesion molecules (ICAM-1, VCAM-1 and MAdCAM-1) to enable a multi-step cascade of immune cell capturing, rolling, arrest, and transmigration via the blood endothelial barrier (Table 3). Some trafficking molecules are constitutively expressed and manage the migration of immune cells during homeostasis, while others are specifically upregulated by inflammatory processes such as infection and autoimmunity.

    [0205] The expression of trafficking molecules important for extravasation is mainly regulated on specialized blood vessels called HEVs, which are the entry portals from the circulation into the periphery and are usually present in secondary lymphoid organs (SLOs) and chronically inflamed tissue. Chronically inflamed tissues often develop lymphoid-like structures called TLOs that contain structures resembling SLOs including HEVs, lymphoid stromal cells, and confined compartments of T and B lymphocytes. As they can act as major gateways for immune cell migration into peripheral tissues, TLOs have been shown to be important in the pathogenesis of autoimmune disorders.

    [0206] Once within peripheral tissues, four modes of immune cell migration have been observed: 1) chemokinesis: migration driven by soluble chemokines, without concentration gradients to provide directional bias, 2) haptokinesis: migration along surfaces presenting immobilized ligands such as chemokines or integrins, without concentration gradients to provide directional bias, 3) chemotaxis: directional migration driven by concentration gradients of soluble chemokines, and 4) haptotaxis: directional migration along surfaces presenting gradients of immobilized ligands such as chemokines or integrins. The response of immune cells to trafficking molecules present on the endothelium depends on the composition, expression, and/or functional activity of their cognate receptors, which in turn depends on activation state and immune cell subtype.

    [0207] Innate immune cells generally migrate toward inflammation-induced trafficking molecules in the periphery. In contrast, nave T and B cells constantly re-circulate between the blood and secondary lymphoid organs to screen for their cognate antigen presented by activated dendritic cells (DCs) or fibroblastic reticular cells (FRCs), respectively. If activated by recognition of their cognate antigen and appropriate co-stimulation within SLOs, both cell types undergo a series of complex maturation steps, including differentiation and proliferation, ultimately leading to effector and memory immune cell phenotypes. To reach their peripheral target sites, certain effector and memory T and B cell subsets egress from SLOs to the blood circulation via efferent lymphatics. In order to do so, they migrate toward a Sphingosine-1-phosphate (S1P) gradient sensed using their Sphingosine-1-phosphate receptor 1 (S1P.sub.1 or S1PR1). For successful egress into efferent lymphatics, immune cells need to overcome SLO retention signals through the CCR7/CCL21 axis or through CD69-mediated downregulation of S1P.sub.1.

    [0208] Finally, certain immune cell subsets, for example mature dendritic cells (DCs) and memory T cells, migrate from peripheral tissues into SLOs via afferent lymphatics. To exit from peripheral tissues and enter afferent lymphatics, immune cells again largely depend on the CCR7/CCL21 and S1P.sub.1/S1P axis. Specifically, immune cells need to overcome retention signals delivered via the CCR7/CCL21 axis, and migrate toward an S1P gradient established by the lymphatic endothelial cells using S1P.sub.1. The selective action of trafficking molecules on distinct immune cell subsets as well as the distinct spatial and temporal expression patterns of both the ligands and receptors are crucial for the fine-tuning of immune responses during homeostasis and disease.

    [0209] Aberrant immune cell migration is observed in multiple immune-related pathologies. Immune cell adhesion deficiencies, caused by molecular defects in integrin expression, fucosylation of selectin ligands, or inside-out activation of integrins on leukocytes and platelets, lead to impaired immune cell migration into peripheral tissues. This results in leukocytosis and in increased susceptibility to recurrent bacterial and fungal infections, which can be difficult to treat and potentially life-threatening. Alternatively, exaggerated migration of specific immune cell subsets into specific peripheral tissues is associated with a multitude of pathologies. For example, excessive neutrophil accumulation in peripheral tissues contributes to the development of ischemia-reperfusion injury, such as that observed during acute myocardial infarction, stroke, shock and acute respiratory distress syndrome. Excessive Th1 inflammation characterized by tissue infiltration of interferon-gamma secreting effector T cells and activated macrophages is associated with atherosclerosis, allograft rejection, hepatitis, and multiple autoimmune diseases including multiple sclerosis, rheumatoid arthritis, psoriasis, Crohn's disease, type 1 diabetes and lupus erythematodes. Excessive Th2 inflammation characterized by tissue infiltration of IL-4, IL-5, and IL-13 secreting Th2 cells, eosinophils and mast cells is associated with asthma, food allergies and atopic dermatitis.

    [0210] In some embodiments, a calcitonin receptor activator described herein increases macrophage lymph node homing, increases macrophage calcitonin receptor expression (e.g., expression of CALCR and/or RAMP1), and/or improves organ function. In some embodiments, a calcitonin receptor activator described herein decreases one or more of macrophage migration, macrophage proliferation, macrophage recruitment, macrophage lymph node egress, macrophage differentiation, macrophage activation, macrophage polarization, macrophage cytokine production, macrophage maturation, macrophage antigen presentation, macrophage ADCC, or macrophage ADCP. In some embodiments, the cytokine is a pro-inflammatory cytokine (e.g., IL6 and/or IFN). In some embodiments, a calcitonin receptor activator described herein decreases inflammation, auto-antibody levels, viral load, or the rate or number of relapses or flare-ups. In some embodiments, the macrophage is an M1 macrophage. In some embodiments, the macrophage is an M2 macrophage.

    [0211] Immune Effects

    [0212] A variety of in vitro and in vivo assays can be used to determine how a calcitonin receptor activator affects an immune cell activity. The effect of a calcitonin receptor activator on T cell polarization in a subject can be assessed by evaluation of cell surface markers on T cells obtained from the subject. A blood sample, lymph node biopsy (e.g., a primary, secondary, or tertiary lymph node biopsy), splenic biopsy, or tissue (e.g., a barrier tissue, skin, gut tissue, airway tissue, or wound tissue) sample can be collected from a subject and T cells from the sample evaluated for one or more (e.g., 2, 3, or 4 or more) Th1-specific markers: T-bet, IL-12R, STAT4, or chemokine receptors CCR5, CXCR6, and CXCR3; or Th2-specific markers: CCR3, CXCR4, or IL-4R. T cell polarization can also be assessed using the same methods in an in vivo animal model. This assay can also be performed by adding a calcitonin receptor activator to T cells in vitro (e.g., T cells obtained from a subject, animal model, repository, or commercial source) and measuring the aforementioned markers to evaluate T cell polarization. These markers can be assessed using flow cytometry, immunohistochemistry, in situ hybridization, and other assays that allow for measurement of cellular markers. Comparing results from before and after administration of a calcitonin receptor activator can be used to determine its effect.

    [0213] The effect of a calcitonin receptor activator on T cell activation in a subject can be assessed by evaluation of cellular markers on T cells obtained from the subject. A blood sample, lymph node biopsy (e.g., a primary, secondary, or tertiary lymph node biopsy), splenic biopsy, or tissue (e.g., a barrier tissue, skin, gut tissue, airway tissue, or wound tissue) sample can be collected from a subject and T cells from the sample evaluated for one or more (e.g., 2, 3, 4 or more) activation markers: CD25, CD71, CD26, CD27, CD28, CD30, CD154, CD40L, CD134, CD69, CD62L or CD44. T cell activation can also be assessed using the same methods in an in vivo animal model. This assay can also be performed by adding a calcitonin receptor activator to T cells in vitro (e.g., T cells obtained from a subject, animal model, repository, or commercial source) and measuring the aforementioned markers to evaluate T cell activation. Similar approaches can be used to assess the effect of a calcitonin receptor activator on activation of other immune cells, such as eosinophils (markers: CD35, CD11b, CD66, CD69 and CD81), dendritic cells (makers: IL-8, MHC class II, CD40, CD80, CD83, and CD86), basophils (CD63, CD13, CD4, and CD203c), ILCs (markers: CD69), and neutrophils (CD11b, CD35, CD66b and CD63). These markers can be assessed using flow cytometry, immunohistochemistry, in situ hybridization, and other assays that allow for measurement of cellular markers. Comparing results from before and after administration of a calcitonin receptor activator can be used to determine its effect.

    [0214] The effect of a calcitonin receptor activator on immune cell activation can also be assessed through measurement of secreted cytokines and chemokines. An activated immune cell (e.g., T cell, B cell, macrophage, monocyte, dendritic cell, eosinophil, basophil, mast cell, NK cell, ILC, or neutrophil) can produce pro-inflammatory cytokines and chemokines (e.g., IL-1, IL-5, IL-6, IL-8, IL-10, IL-12, IL-13, IL-18, TNF, and IFN-). Activation can be assessed by measuring cytokine levels in a blood sample, lymph node biopsy, or tissue sample from a human subject or animal model, with higher levels of pro-inflammatory cytokines following treatment with a calcitonin receptor activator indicating increased activation, and lower levels indicating decreased activation. Activation can also be assessed in vitro by measuring cytokines secreted into the media by cultured cells. Cytokines can be measured using ELISA, western blot analysis, and other approaches for quantifying secreted proteins. Comparing results from before and after administration of a calcitonin receptor activator can be used to determine its effect.

    [0215] The effect of a calcitonin receptor activator on T cell proliferation in a subject can be assessed by evaluation of markers of proliferation in T cells obtained from the subject. A blood sample, lymph node biopsy, or tissue sample can be collected from a subject and T cells from the sample evaluated for Ki67 marker expression. T cell proliferation can also be assessed using the same methods in an in vivo animal model. This assay can also be performed by adding a calcitonin receptor activator to T cells in vitro (e.g., T cells obtained from a subject, animal model, repository, or commercial source) and measuring Ki67 to evaluate T cell proliferation. Assessing whether a calcitonin receptor activator induces T cell proliferation can also be performed by in vivo (e.g., in a human subject or animal model) by collecting blood samples before and after calcitonin receptor activator administration and comparing T cell numbers, and in vitro by quantifying T cell numbers before and after contacting T cells with a calcitonin receptor activator. These approaches can also be used to measure the effect of a calcitonin receptor activator on proliferation of any immune cell (e.g., Tregs, B cells, T cells, macrophages, monocytes, dendritic cells, NK cells, ILCs, mast cells, eosinophils, basophils, and neutrophils). Ki67 can be assessed using flow cytometry, immunohistochemistry, in situ hybridization, and other assays that allow for measurement of nuclear markers. Comparing results from before and after administration of a calcitonin receptor activator can be used to determine its effect.

    [0216] The effect of a calcitonin receptor activator on cytotoxic T cell activation in a subject can be assessed by evaluation of T cell granule markers in T cells obtained from the subject. A blood sample, lymph node biopsy, or tissue sample can be collected from a subject and T cells from the sample evaluated for granzyme or perforin expression. Cytotoxic T cell activation can also be assessed using the same methods in an in vivo animal model. This assay can also be performed by adding a calcitonin receptor activator to cytotoxic T cells in vitro (e.g., cytotoxic T cells obtained from a subject, animal model, repository, or commercial source) and measuring the aforementioned markers to evaluate T cell proliferation. These markers can be detected in the media from cytotoxic T cell cultures. Techniques including ELISA, western blot analysis can be used to detect granzyme and perforin in conditioned media, flow cytometry, immunohistochemistry, in situ hybridization, and other assays can detect intracellular granzyme and perforin and their synthesis. Comparing results from before and after administration of a calcitonin receptor activator can be used to determine its effect.

    [0217] The effect of a calcitonin receptor activator on circulating monocytes in a subject can be assessed by evaluation of cell surface markers on primary blood mononuclear cells obtained from the subject. A blood sample, lymph node biopsy, or tissue sample can be collected from a subject and monocytes from the sample evaluated for CD14 and/or CD16 expression. Circulating monocytes can also be assessed using the same methods in an in vivo animal model. This assay can be performed by taking a blood sample before treatment with a calcitonin receptor activator and comparing it to a blood sample taken after treatment. CD14 and CD16 can be detected using flow cytometry, immunohistochemistry, western blot analysis, or any other technique that can measure cell surface protein levels. Comparing results from before and after administration of a calcitonin receptor activator can be used to determine its effect. This assay can be used to detect the number of monocytes in the bloodstream or to determine whether monocytes have adopted a CD14+/CD16+ phenotype, which indicates a pro-inflammatory function.

    [0218] The effect of a calcitonin receptor activator on peripheral blood hematopoietic stem cells in a subject can be assessed by evaluation of cell surface markers on primary blood mononuclear cells obtained from the subject. A blood sample, lymph node biopsy, or tissue sample can be collected from a subject and stem cells from the sample evaluated for one or more (2, 3 or 4 or more) specific markers: CD34, c-kit, Sca-1, or Thy1.1. Peripheral blood hematopoietic stem cells can also be assessed using the same methods in an in vivo animal model. This assay can be performed by taking a blood sample before treatment with a calcitonin receptor activator and comparing it to a blood sample taken after treatment. The aforementioned markers can be detected using flow cytometry, immunohistochemistry, western blot analysis, or any other technique that can measure cell surface protein levels. Comparing results from before and after administration of a calcitonin receptor activator can be used to determine its effect. This assay can be used to detect the number of stem cells mobilized into the bloodstream or to determine whether treatment induces differentiation into a particular hematopoietic lineage (e.g., decreased CD34 and increased GPA indicates differentiation into red blood cells, decreased CD34 and increased CD14 indicates differentiation into monocytes, decreased CD34 and increased CD11 b or CD68 indicates differentiation into macrophages, decreased CD34 and increased CD42b indicates differentiation into platelets, decreased CD34 and increased CD3 indicates differentiation into T cells, decreased CD34 and increased CD19 indicates differentiation into B cells, decreased CD34 and increased CD25 or CD69 indicates differentiation into activated T cells, decreased CD34 and increased CD1c, CD83, CD141, CD209, or MHC II indicates differentiation into dendritic cells, decreased CD34 and increased CD56 indicates differentiation into NK cells, decreased CD34 and increased CD15 indicates differentiation into neutrophils, decreased CD34 and increased 2D7 antigen, CD123, or CD203c indicates differentiation into basophils, and decreased CD34 and increased CD193, EMR1, or Siglec-8 indicates differentiation into eosinophils.

    [0219] The effect of a calcitonin receptor activator on macrophage polarization in a subject can be assessed by evaluation of cellular markers in macrophages cells obtained from the subject. A blood sample, lymph node biopsy, or tissue sample can be collected from a subject and macrophages from the sample evaluated for one of more (2, 3 or 4 or more) specific markers. Markers for M1 polarization include IL-12, TNF, IL-1, IL-6, IL-23, MARCO, MHC-II, CD86, iNOS, CXCL9, and CXCL10. Markers for M2 polarized macrophages include IL-10, IL1-RA, TGF, MR, CD163, DC-SIGN, Dectin-1, HO-1, arginase (Arg-1), CCL17, CCL22 and CCL24. Macrophage polarization can also be assessed using the same methods in an in vivo animal model. This assay can also be performed on cultured macrophages obtained from a subject, an animal model, repository, or commercial source to determine how contacting a macrophage with a calcitonin receptor activator affects polarization. The aforementioned markers can be evaluated by comparing measurements obtained before and after administration of a calcitonin receptor activator to a subject, animal model, or cultured cell. Surface markers or intracellular proteins (e.g., MHC-11, CD86, iNOS, CD163, Dectin-1, HO-1, Arg-1, etc.) can be measured using flow cytometry, immunohistochemistry, in situ hybridization, or western blot analysis, and secreted proteins (e.g., IL-12, TNF, IL-1, IL-10, TGF, IL1-RA, chemokines CXC8, CXC9, CCL17, CCL22, and CCL24, etc.) can be measured using the same methods or by ELISA or western blot analysis of culture media or blood samples. Comparing results from before and after administration of a calcitonin receptor activator can be used to determine its effect.

    [0220] The effect of a calcitonin receptor activator on macrophage phagocytosis in a subject can be assessed by culturing macrophages obtained from the subject with fluorescent beads. A blood sample, lymph node biopsy, or tissue sample can be collected from a subject and macrophages from the sample evaluated for engulfment of fluorescent beads. This assay can also be performed on cultured macrophages obtained from an animal model, repository, or commercial source to determine how contacting a macrophage with a calcitonin receptor activator affects phagocytosis. The same phagocytosis assay can be used to evaluate the effect of a calcitonin receptor activator on phagocytosis in other immune cells (e.g., neutrophils, monocytes, mast cells, B cells, eosinophils, or dendritic cells). Comparing results from before and after administration of a calcitonin receptor activator can be used to determine its effect on phagocytosis.

    [0221] In some embodiments, phagocytosis is ADCP. ADCP can be assessed using similar methods to those described above by incubating immune cells (e.g., macrophages, neutrophils, monocytes, mast cells, B cells, eosinophils, or dendritic cells) isolated from a blood sample, lymph node biopsy, or tissue sample with fluorescent beads coated with IgG antibodies. In some embodiments, immune cells are incubated with a target cell line that has been pre-coated with antibodies to a surface antigen expressed by the target cell line. ADCP can be evaluated by measuring fluorescence inside the immune cell or quantifying the number of beads or cells engulfed. This assay can also be performed on cultured immune cells obtained from an animal model, repository, or commercial source to determine how contacting an immune cell with a calcitonin receptor activator affects ADCP. The ability of an immune cell to perform ADCP can also be evaluated by assessing expression of certain Fc receptors (e.g., FcRIIa, FcRIIIa, and FcRI). Fc receptor expression can be assessed using flow cytometry, immunohistochemistry, in situ hybridization, or other assays that allow for measurement of cell surface markers. Comparing phagocytosis or Fc receptor expression before and after administration of a calcitonin receptor activator can be used to determine its effect on ACDP. In some embodiments, the calcitonin receptor activator increases ADCP of infectious agents. In some embodiments, the calcitonin receptor activator decreases macrophage ADCP of auto-antibody coated cells (e.g., in autoimmune diseases such as Crohn's disease).

    [0222] The effect of a calcitonin receptor activator on macrophage activation in a subject can be assessed by evaluation of cell surface markers on macrophages cells obtained from the subject. A blood sample, lymph node biopsy, or tissue sample can be collected from a subject and macrophages from the sample evaluated for one or more (e.g., 1, 2, 3 or 4 or more) specific markers: F4/80, HLA molecules (e.g., MHC-II), CD80, CD68, CD11b, or CD86. Macrophage activation can also be assessed using the same methods in an in vivo animal model. This assay can also be performed by adding a calcitonin receptor activator to macrophages in vitro (e.g., macrophages obtained from a subject, animal model, repository, or commercial source) and measuring the aforementioned markers to evaluate macrophage activation. These markers can be assessed using flow cytometry, immunohistochemistry, in situ hybridization, and other assays that allow for measurement of cell surface markers. As mentioned above, macrophage activation can also be evaluated based on cytokine production (e.g., pro-inflammatory cytokine production) as measured by ELISA and western blot analysis. Comparing results from before and after administration of a calcitonin receptor activator can be used to determine its effect.

    [0223] The effect of a calcitonin receptor activator on antigen presentation in a subject can be assessed by evaluation of cell surface markers on antigen presenting cells (e.g., dendritic cells, macrophages, and B cells) obtained from the subject. A blood sample, lymph node biopsy, or tissue sample can be collected from a subject and antigen presenting cells (e.g., dendritic cells, macrophages, and B cells) from the sample evaluated for one or more (e.g., 2, 3 or 4 or more) specific markers: CD11c, CD11b, HLA molecules (e.g., MHC-II), CD40, B7, IL-2, CD80 or CD86. Antigen presentation can also be assessed using the same methods in an in vivo animal model. This assay can also be performed by adding a calcitonin receptor activator to antigen presenting cells (e.g., dendritic cells) in vitro (e.g., antigen presenting cells obtained from a subject, animal model, repository, or commercial source) and measuring the aforementioned markers to evaluate antigen presentation. These markers can be assessed using flow cytometry, immunohistochemistry, in situ hybridization, and other assays that allow for measurement of cell surface markers. Comparing results from before and after administration of a calcitonin receptor activator can be used to determine its effect.

    [0224] The effect of a calcitonin receptor activator on antigen presenting cell migration in a subject can be assessed by evaluation of cell surface markers on antigen presenting cells (e.g., dendritic cells, B cells, and macrophages) obtained from the subject. A blood sample, lymph node biopsy, or tissue sample can be collected from a subject and antigen presenting cells (e.g., dendritic cells, B cells, and macrophages) from the sample evaluated for CCR7 expression. Antigen presenting cell migration can also be assessed using the same methods in an in vivo animal model. This assay can also be performed by adding a calcitonin receptor activator to antigen presenting cells (e.g., dendritic cells, B cells, and macrophages) in vitro (e.g., antigen presenting cells obtained from a subject, animal model, repository, or commercial source) and measuring CCR7 to evaluate antigen presenting cell migration. CCR7 can be assessed using flow cytometry, immunohistochemistry, in situ hybridization, and other assays that allow for measurement of cell surface markers. Comparing results from before and after administration of a calcitonin receptor activator can be used to determine its effect.

    [0225] The effect of a calcitonin receptor activator on lymph node immune cell homing and cell egress in a subject can be assessed by evaluation of cell surface markers on T or B cells obtained from the subject. A blood sample, lymph node biopsy, or tissue sample can be collected from a subject and T or B cells from the sample evaluated for one or more specific markers: CCR7 or S1PR1. Lymph node immune cell homing and cell egress can also be assessed using the same methods in an in vivo animal model. This assay can also be performed by adding a calcitonin receptor activator to T or B cells in vitro (e.g., T or B cells obtained from a subject, animal model, repository, or commercial source) and measuring the aforementioned markers to evaluate T or B cell lymph node homing. These markers can also be used to assess lymph node homing and cell egress of dendritic cells and macrophages. CCR7 and S1PR1 can be assessed using flow cytometry, immunohistochemistry, in situ hybridization, and other assays that allow for measurement of cell surface markers. If using an animal model, lymph nodes or sites of inflammation can be imaged in vivo (e.g., using a mouse that expresses fluorescently labeled T or B cells) or after biopsy to determine whether T or B cell numbers change as a result of administration of a calcitonin receptor activator. Comparing results from before and after administration of a calcitonin receptor activator can be used to determine its effect.

    [0226] In some embodiments, a calcitonin receptor activator increases homing or decreases egress of nave T cells into or out of secondary lymphoid organs prior to antigen challenge (e.g., prior to administration of a vaccine) to generate a better antigen-specific response. In some embodiments, a calcitonin receptor activator decreases homing or increases egress of inflammatory immune cells (e.g., neutrophils) into or out of peripheral tissues during acute infection or injury to prevent conditions such as ischemia-reperfusion disorders. In some embodiments, a calcitonin receptor activator decreases homing or increases egress of effector immune subsets into or out of peripheral tissues to avoid inflammation-induced tissue damage in autoimmune diseases.

    [0227] The effect of a calcitonin receptor activator on NK cell activation in a subject can be assessed by evaluation of cell surface markers on NK cells obtained from the subject. A blood sample, lymph node biopsy, or tissue sample can be collected from a subject and NK cells from the sample evaluated for one or more (e.g., 2, 3 or 4 or more) specific markers: CD117, NKp46, CD94, CD56, CD16, KIR, CD69, HLA-DR, CD38, KLRG1, and TIA-1. NK cell activation can also be assessed using the same methods in an in vivo animal model. This assay can also be performed by adding a calcitonin receptor activator to NK cells in vitro (e.g., NK cells obtained from a subject, animal model, repository, or commercial source) and measuring the aforementioned markers to evaluate NK cell activation. The effect of a calcitonin receptor activator can be determined by comparing results from before and after calcitonin receptor activator administration.

    [0228] In some embodiments, activated NK cells have increased lytic function or are cytotoxic (e.g., capable of performing ADCC). The effect of a calcitonin receptor activator on ADCC can be assessed by incubating immune cells capable of ADCC (e.g., NK cells, monocytes, macrophages, neutrophils, eosinophils, dendritic cells, or T cells) with a target cell line that has been pre-coated with antibodies to a surface antigen expressed by the target cell line. ADCC can be assessed by measuring the number of surviving target cells with a fluorescent viability stain or by measuring the secretion of cytolytic granules (e.g., perforin, granzymes, or other cytolytic proteins released from immune cells). Immune cells can be collected from a blood sample, lymph node biopsy, or tissue sample from a human subject or animal model treated with a calcitonin receptor activator. This assay can also be performed by adding a calcitonin receptor activator to immune cells in vitro (e.g., immune cells obtained from a subject, animal model, repository, or commercial source). The effect of a calcitonin receptor activator on ADCC can be determined by comparing results from before and after calcitonin receptor activator administration. In some embodiments, the calcitonin receptor activator decreases NK cell ADCC of auto-antibody coated cells (e.g., to treat autoimmune disease). In some embodiments, the calcitonin receptor activator increases NK cell ADCC of antibody-opsonized infectious agents.

    [0229] The effect of a calcitonin receptor activator on ILC activation in a subject can be assessed by evaluation of cell surface markers on ILCs obtained from the subject. A blood sample, lymph node biopsy, or tissue sample can be collected from a subject and ILCs from the sample evaluated for one or more (e.g., 2, 3 or 4 or more) specific markers: NKp46, CD69, T-bet, ROR, GATA3, and RORt. ILC activation can also be assessed using the same methods in an in vivo animal model. This assay can also be performed by adding a calcitonin receptor activator to ILCs in vitro (e.g., ILCs obtained from a subject, animal model, repository, or commercial source) and measuring the aforementioned markers to evaluate ILC activation. The effect of a calcitonin receptor activator can be determined by comparing results from before and after calcitonin receptor activator administration.

    [0230] In some embodiments, activated ILCs have increased lytic function or are cytotoxic (e.g., capable of performing ADCC). The effect of a calcitonin receptor activator on ADCC can be assessed by incubating immune cells capable of ADCC (e.g., ILCs, monocytes, macrophages, neutrophils, eosinophils, dendritic cells, or T cells) with a target cell line that has been pre-coated with antibodies to a surface antigen expressed by the target cell line. ADCC can be assessed by measuring the number of surviving target cells with a fluorescent viability stain or by measuring the secretion of cytolytic granules (e.g., perforin, granzymes, or other cytolytic proteins released from immune cells). Immune cells can be collected from a blood sample, lymph node biopsy, or tissue sample from a human subject or animal model treated with a calcitonin receptor activator. This assay can also be performed by adding a calcitonin receptor activator to immune cells in vitro (e.g., immune cells obtained from a subject, animal model, repository, or commercial source). The effect of a calcitonin receptor activator on ADCC can be determined by comparing results from before and after calcitonin receptor activator administration. In some embodiments, the calcitonin receptor activator decreases ILC ADCC of auto-antibody coated cells (e.g., to treat autoimmune disease). In some embodiments, the calcitonin receptor activator increases ILC ADCC of antibody-opsonized infectious agents.

    [0231] The effect of a calcitonin receptor activator on mast cell degranulation in a subject can be assessed by evaluation of markers in mast cells obtained from the subject. A blood sample, lymph node biopsy, or tissue sample can be collected from a subject and mast cells from the sample evaluated for one or more (e.g., 1, 2, 3 or 4 or more) specific markers: IgE, histamine, IL-4, TNF, CD300a, tryptase, or MMP9. Mast cell degranulation can also be assessed using the same methods in an in vivo animal model. This assay can also be performed by adding a calcitonin receptor activator to mast cells in vitro (e.g., mast cells obtained from a subject, animal model, repository, or commercial source) and measuring the aforementioned markers to evaluate mast cell degranulation. Some of these markers (e.g., histamine, TNF, and IL-4) can be detected by measuring levels in the mast cell culture medium after mast cells are contacted with a calcitonin receptor activator. The effect of a calcitonin receptor activator can be determined by comparing results from before and after calcitonin receptor activator administration. This approach can also be used to evaluate the effect of a calcitonin receptor activator on degranulation by other cells, such as neutrophils (markers: CD11b, CD13, CD18, CD45, CD15, CD66b IL-1, IL-8, and IL-6), eosinophils (markers: major basic protein (MBP), eosinophil cationic protein (ECP), eosinophil peroxidase (EPX), eosinophil-derived neurotoxin (EDN)), basophils (markers: histamine, heparin, chondroitin, elastase, lysophospholipase, and LTD-4), NK cells (markers: LAMP-1, perforin, and granzymes), and cytotoxic T cells (markers: LAMP-1, perforin, and granzymes). Markers can be detected using flow cytometry, immunohistochemistry, ELISA, western blot analysis, or in situ hybridization.

    [0232] The effect of a calcitonin receptor activator on neutrophil recruitment in a subject can be assessed by evaluation of cell surface markers on neutrophils obtained from the subject. A blood sample, lymph node biopsy, or tissue sample can be collected from a subject and neutrophils from the sample evaluated for one or more (e.g., 1, 2, 3 or 4 or more) specific markers: CD11b, CD14, CD114, CD177, CD354, or CD66. To determine whether neutrophils are being recruited to a specific site (e.g., a site of inflammation). Neutrophil recruitment can also be assessed using the same methods in an in vivo animal model. This assay can also be performed by adding a calcitonin receptor activator to neutrophils in vitro (e.g., neutrophils obtained from a subject, animal model, repository, or commercial source) and measuring the aforementioned markers to evaluate neutrophil recruitment. These markers can be assessed using flow cytometry, immunohistochemistry, in situ hybridization, and other assays that allow for measurement of cell surface markers. The effect of a calcitonin receptor activator can be determined by comparing results from before and after calcitonin receptor activator administration.

    [0233] The effect of a calcitonin receptor activator on eosinophil recruitment in a subject can be assessed by evaluation of cell surface markers on eosinophil obtained from the subject. A blood sample, lymph node biopsy, or tissue sample can be collected from a subject and eosinophils from the sample evaluated for one or more (e.g., 1, 2, 3 or 4 or more) specific markers: CD15, IL-3R, CD38, CD106, CD294 or CD85G. To determine whether eosinophils are being recruited to a specific site (e.g., a site of inflammation). Eosinophil recruitment can also be assessed using the same methods in an in vivo animal model. This assay can also be performed by adding a calcitonin receptor activator to eosinophils in vitro (e.g., eosinophils obtained from a subject, animal model, repository, or commercial source) and measuring the aforementioned markers to evaluate eosinophil recruitment. These markers can be assessed using flow cytometry, immunohistochemistry, in situ hybridization, and other assays that allow for measurement of cell surface markers. The effect of a calcitonin receptor activator can be determined by comparing results from before and after calcitonin receptor activator administration.

    [0234] The effect of a calcitonin receptor activator on NKT cell activation in a subject can be assessed by evaluation of cell surface markers on NKT cells obtained from the subject. A blood sample, lymph node biopsy, or tissue sample can be collected from a subject and NKT cells from the sample evaluated for one or more specific markers: CD272 or CD352. Activated NKT cells produce IFN-, IL-4, GM-CSF, IL-2, IL-13, IL-17, IL-21 and TNF. NKT cell activation can also be assessed using the same methods in an in vivo animal model. This assay can also be performed by adding a calcitonin receptor activator to NKT cells in vitro (e.g., NKT cells obtained from a subject, animal model, repository, or commercial source) and measuring the aforementioned markers to evaluate NKT cell activation. Cell surface markers CD272 and CD352 can be assessed using flow cytometry, immunohistochemistry, in situ hybridization, and other assays that allow for measurement of cell surface markers. The secreted proteins can be detected in blood samples or cell culture media using ELISA, western blot analysis, or other methods for detecting proteins in solution. The effect of a calcitonin receptor activator can be determined by comparing results from before and after calcitonin receptor activator administration.

    [0235] The effects of a calcitonin receptor activator on B cell activation in a subject can be assessed by evaluation of cell surface markers on B cells obtained from the subject. A blood sample, lymph node biopsy, or tissue sample can be collected from a subject and B cells from the sample evaluated for one or more (e.g., 2, 3 or 4 or more) specific markers: CD19, CD20, CD40, CD80, CD86, CD69, IgM, IgD, IgG, IgE, or IgA. B cell activation can also be assessed using the same methods in an in vivo animal model. This assay can also be performed by adding a calcitonin receptor activator to B cells in vitro (e.g., B cells obtained from a subject, animal model, repository, or commercial source) and measuring the aforementioned markers to evaluate B cell activation. These markers can be assessed using flow cytometry, immunohistochemistry, in situ hybridization, and other assays that allow for measurement of cell surface markers. The effect of a calcitonin receptor activator can be determined by comparing results from before and after calcitonin receptor activator administration.

    [0236] The effect of a calcitonin receptor activator on regulatory T cell differentiation in a subject can be assessed by evaluation of markers in regulatory T cells obtained from the subject. A blood sample, lymph node biopsy, or tissue sample can be collected from a subject and regulatory T cells from the sample evaluated for one or more (e.g., 1, 2, 3, 4 or more) specific markers: CD4, CD25, or FoxP3. Regulatory T cell differentiation can also be assessed using the same methods in an in vivo animal model. This assay can also be performed by adding a calcitonin receptor activator to regulatory T cells in vitro (e.g., regulatory T cells obtained from a subject, animal model, repository, or commercial source) and measuring the aforementioned markers to evaluate regulatory T cell differentiation. These markers can be assessed using flow cytometry, immunohistochemistry, in situ hybridization, and other assays that allow for measurement of cellular markers. The effect of a calcitonin receptor activator can be determined by comparing results from before and after calcitonin receptor activator administration.

    [0237] The effect of a calcitonin receptor activator on innervation of a lymph node or secondary lymphoid organ can be assessed by evaluation of neuronal markers in a lymph node or secondary lymphoid organ biopsy sample obtained from a human subject or animal model. A biopsy can be collected from the subject and evaluated for one or more (e.g., 1, 2, 3, 4, or 4 or more) neuronal markers selected from: Neurofilament, synapsin, synaptotagmin, or neuron specific enolase. Lymph node innervation can also be assessed using electrophysiological approaches (e.g., recording neuronal activity in a lymph node or secondary lymphoid organ in a human subject or animal model). The effect of a calcitonin receptor activator can be determined by comparing results from before and after calcitonin receptor activator administration.

    [0238] The calcitonin receptor activator can also reduce the number of nerve fibers in the affected tissue or reduce the activity of peripheral nerve fibers in the affected tissue. For example, the method includes administering to the subject (e.g., a human subject or animal model) a calcitonin receptor activator in an amount and for a time sufficient to reduce the number of nerve fibers in the affected tissue or reduce the activity of peripheral nerve fibers in the affected tissue. The affected tissue can be a lymph node, a lymphoid organ, or the bone marrow niche. The number of nerve fibers in the affected tissue or the activity of peripheral nerve fibers in the affected tissue can be decreased in the subject at least 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or more, compared to before the administration. The number of nerve fibers in the affected tissue or the activity of peripheral nerve fibers in the affected tissue can be decreased in the subject between 5-20%, between 5-50%, between 10-50%, between 20-80%, between 20-70%.

    [0239] The calcitonin receptor activator can also increase the number of nerve fibers in the affected tissue or increase the activity of peripheral nerve fibers in the affected tissue. For example, the method includes administering to the subject (e.g., a human subject or animal model) a calcitonin receptor activator in an amount and for a time sufficient to increase the number of nerve fibers in the affected tissue or increase the activity of peripheral nerve fibers in the affected tissue. The affected tissue can be a lymph node, a lymphoid organ, or the bone marrow niche. The number of nerve fibers in the affected tissue or the activity of peripheral nerve fibers in the affected tissue can be increased in the subject at least 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 50%, 60%, 70%, 80% or more, compared to before the administration. The number of nerve fibers in the affected tissue or the activity of peripheral nerve fibers in the affected tissue can be increased in the subject between 5-20%, between 5-50%, between 10-50%, between 20-80%, between 20-70%.

    [0240] The nerve fibers that are modulated can be part of the peripheral nervous system, e.g., a somatic nerve, an autonomic nerve, a sensory nerve, a cranial nerve, an optic nerve, an olfactory nerve, a sympathetic nerve, a parasympathetic nerve, a chemoreceptor, a photoreceptor, a mechanoreceptor, a thermoreceptor, a nociceptor, an efferent nerve fiber, or an afferent nerve fiber.

    [0241] The effect of a calcitonin receptor activator on immune cell cytokine production can be assessed by evaluation of cellular markers in an immune cell sample obtained from a human subject or animal model. A blood sample, lymph node biopsy, or tissue sample can be collected for the subject and evaluated for one or more (e.g., 1, 2, 3, 4, or 4 or more) cytokine markers selected from: pro-inflammatory cytokines (e.g., IL-1, IL-5, IL-6, IL-8, IL-10, IL-12, IL-13, IL-17, IL-18, IL-22, TNF, IFN, GMCSF), pro-survival cytokines (e.g., IL-2, IL-4, IL-6, IL-7, and IL-15) and anti-inflammatory cytokines (e.g., IL-4, IL-10, IL-11, IL-13, IFN, and TGF). Some cytokines can function as both pro- and anti-inflammatory cytokines depending on context or indication (e.g., IL-4 is often categorized as an anti-inflammatory cytokine, but plays a pro-inflammatory role in mounting an allergic or anti-parasitic immune response). Cytokines can be also detected in the culture media of immune cells contacted with a calcitonin receptor activator. Cytokines can be detected using ELISA, western blot analysis, or other methods for detecting protein levels in solution. The effect of a calcitonin receptor activator can be determined by comparing results from before and after calcitonin receptor activator administration.

    [0242] In some embodiments, a calcitonin receptor activator decreases or prevents the development of TLOs to decrease local inflammation in autoimmune diseases. TLOs are highly similar to SLOs and exhibit T and B cell compartmentalization, APCs such as DCs and follicular DCs, stromal cells, and a highly organized vascular system of high endothelial venules. In some embodiments, a calcitonin receptor activator decreases or prevents the development of HEVs within tertiary lymphoid organs to decrease local inflammation in autoimmune diseases. HEVs can be detected using the monoclonal antibody MECA-79.

    [0243] In some embodiments, a calcitonin receptor activator modulates dendritic cell maturation (e.g., activation). Dendritic cell maturation can be increased to promote their migration from peripheral tissues into secondary lymphoid organs to improve T cell activation in the draining lymph node (e.g., to increase vaccine efficacy. Dendritic cell maturation can be decreased to decrease their migration from peripheral tissues into secondary lymphoid organs to inhibit T cell activation in the draining lymph node (e.g., to improve outcomes in organ transplantation or to reduce the severity of or treat autoimmune diseases).

    [0244] Table 1 lists additional markers and relevant assays that may be used to assess the level, function and/or activity of immune cells in the methods described herein.

    TABLE-US-00001 TABLE 1 ASSESSMENT OF IMMUNE CELL PHENOTYPES ASSOCIATED IMMUNE CELL CYTOKINES MARKER ASSAYS Th1 helper IFN- CD4 ELISPOT IL-2 CD94 In situ hybridization IL-12 CD119 Immunohistochemistry IL-18 (IFN R1) Limiting dilution Analysis IL-27 CD183 Single-cell PCR TNF (CXCR3) In vivo capture assay TNF/LT CD186 ELISA (CXCR6) Flow cytometry CD191 (CCR1) CD195 (CCR5) CD212 (IL- 12R1&2) CD254 (RANKL) CD278 (ICOS) IL-18R MRP1 NOTCH3 TCR TIM3 Th2 helper IL-4 CD4 ELISPOT IL-2 CD30 In situ hybridization IL-6 CD119 Immunohistochemistry IL-33 (IFN R1) Limiting dilution IL-17E (IL-25) CD184 Analysis IL-31 (CXCR4) Single-cell PCR IL-3 CD185 In vivo capture IL-10 (CXCR5) assay IL-13 CD193 ELISA (CCR3) Flow cytometry CD194 (CCR4) CD197 (CCR7) CD278 (ICOS) CD294 (CRTh2) CDw198 (CCR8) IL-17RB IL-33R (ST2) NOTCH1 NOTCH2 TCR TIM1 Th17 helper TGF1 CD4 ELISPOT IL-1 CD27 In situ hybridization IL-6 CD62L Immunohistochemistry IL-21 CD127 (IL- Limiting dilution IL-23 7R) Analysis IL-17A CD161 Single-cell PCR IL-17F CD184 In vivo capture IL-22 (CXCR4) assay IL-26 CD194 ELISA GM-CSF (CCR4) Flow cytometry MIP-3 CD196 TNF (CCR6) CD197 (CCR7) CD212b1 (IL-12R1) CD213a1 (IL-13R1) CD278 (ICOS) IL-1R1 IL-21R IL-23R Treg TGF1 CD4 ELISPOT IL-2 CD25 In situ hybridization IL-10 CD39 Immunohistochemistry IL-35 CD73 Limiting dilution CD45RO Analysis CD121a (IL- Single-cell PCR 1R1) In vivo capture CD121b (IL- assay 1R2) ELISA CD127low Flow cytometry CD134 (OX40) CD137 (4- 1BB) CD152 (CTLA-4) CD357 (GITR/AITR) Foxp3 FR4 (m) GARP (activated) Helios LAP/TGF (activated) TIGIT Dendritic cell GM-CSF CD1a ELISPOT IFN CD8 In situ hybridization IL-4 CD11c Immunohistochemistry GM-CSF CD80 Limiting dilution IFN CD83 Analysis IL-1 CD85 (ILT) family Single-cell PCR IL-1 CD86 In vivo capture IL-6 CD141 (h) assay IL-8 CD169 ELISA IL-10 CD172 Flow cytometry IL-12 CD184 (CXCR4) IL-15 CD197 (CCR7) IL-18 CD205 IL-23 CD206 IL-27 CD207 IP-10 CD209 M-CSF CD215 (IL-15R) RANTES (CCL5) CD282 (TLR2) TGF CD284 (TLR4) TNF CD286 (TLR6) Clec Family Macrophages/Monocytes FLT3 Ligand CD11b ELISPOT GM-CSF CD14 (mono) In situ hybridization M-CSF CD16 Immunohistochemistry CXCL9 CD32 Limiting dilution CXCL10 CD68 Analysis CXCL11 CD85a (ILT5) Single-cell PCR G-CSF CD163 In vivo capture GM-CSF CD169 assay IFN CD195 (CCR5) ELISA IL-1 CD204 Flow cytometry IL-1 CD206 IL-6 CD282 (TLR2) IL-8 CD284 (TLR4) IL-10 CD286 (TLR6) IL-12p40 & p70 CD354 (Trem-1) IL-18 Clec Family IL-23 F4/80 (m) IL-27 HLA-DR M-CSF MIP-2 (CXCL2) RANTES (CCL5) TNF Natural Killer Cell IL-2 CD16 ELISPOT IL-12 CD25 In situ hybridization IL-15/IL-15R CD49b Immunohistochemistry IL-18 CD56 (h) Limiting dilution Granzyme B CD94 Analysis IL-17A CD158 family (KIR) Single-cell PCR IL-22 (h) In vivo capture MIP-1 (CCL3) CD181 (CXCR1) assay MIP-1 (CCL4) CD183 (CXCR3) ELISA Perforin CD184 (CXCR4) Flow cytometry RANTES (CCL5) CD186 (CXCR6) TNF CD192 (activated) CD195 (CCR5) CD197 (CCR7) CD212 (IL-12R) CD244 CD314 (NKG2D) CX3CR1 Eomes KLRG1 Ly49 family (m) NK1.1 NKG2A NKp30, NKp42 NKp44 (h), NKp46 T-bet Innate Lymphoid IFN- CD335 (NKp46) ELISPOT Cell 1 (ILC1) TNF CD336 (NKp44) In situ hybridization CD94 Immunohistochemistry CD56 (NCAM) Limiting dilution CD103 Analysis T-bet Single-cell PCR In vivo capture assay ELISA Flow cytometry Innate Lymphoid Areg CD127 ELISPOT Cell 2 (ILC2) IL-5 CRTH2 In situ hybridization IL-13 ST2 (IL-33R) Immunohistochemistry ROR Limiting dilution GATA3 Analysis Single-cell PCR In vivo capture assay ELISA Flow cytometry Innate Lymphoid CCL3 CD127 ELISPOT Cell 3 (ILC3) LTs CD117 (c-kit) In situ hybridization IL-22 CD335 (NKp46) Immunohistochemistry IL-17 CD336 (NKp44) Limiting dilution IFN- IL-23R Analysis RORt Single-cell PCR In vivo capture assay ELISA Flow cytometry Activated B Antibodies CD19 Flow cytometry cell/Plasma cells IgM CD25 IgG CD30 IgD IgM IgE CD19 IgA IgG CD27 CD38 CD78 CD138 CD319

    TABLE-US-00002 TABLE 2 EXAMPLES OF HUMAN CHEMOKINES Alternate Systematic Human human Human receptor(s) and Known name gene names Expression their expression functions C Family XCL1 XCL1 Lymphotactin, activated CD8+ T XCR1: cross-presenting migration and SCM-1 alpha, cells and other drendritic cells activation of ATAC MHCI restricted T lymphocytes, cells NK cells XCL2 XCL2 SCM-1 beta expressed in XCR1: cross-presenting migration and activated T cells drendritic cells activation of lymphocytes, NK cells CX3C Family CX3CL1 CX3CL1 Fractalkine, brain, heart, lung, CX3CR1: lymphocytes, migration and Neurotactin, kidney, skeletal monocytes adhesion of ABCD-3 muscle and testis. lymphocytes Up-regulated in and monocytes endothelial cells and microglia by inflammation CC Family CCL1 CCL1 I-309 activated T cells CCR8: natural killer migration of cells, monocytes and monocytes, NK lymphocytes cells, immature DARC: erytrocytes, B cells and endothelial and epithelial DCs cells CCL2 CCL2 MCP-1, monocytes, CCR2: monocytes migration of MCAF, HC11 macrophages and CCR4: lymphocytes monocytes and dendritic cells, CCR11: unkown basophils activated NK cells D6: lymphocytes, lymphatic endothelial cells, macrophages DARC: erytrocytes, endothelial and epithelial cells CCL3 CCL3 MIP-1 alpha, T cells, B cells, and CCR1: lymphocytes, adhesion of LD78 alpha, monocytes after monocytes, airway lymphocytes GOS19, antigen or mitogen smooth muscle cells Pat464 stimulation CCR4: lymphocytes CCR5: T cells, macrophages, dendritic cells, eosinophils and microglia D6: lymphocytes, lymphatic endothelial cells, macrophages CCL3L1 CCL3L1 LD78 beta Unknown CCR1: lymphocytes, migration of monocytes, airway lymphocytes smooth muscle cells and monocytes CCR3: eosinophils, basophils, Th2 cells, CD34+ hematopoetic progenitors, keratinocytes, mast cells CCR5: T cells, macrophages, dendritic cells, eosinophils and microglia D6: lymphocytes, lymphatic endothelial cells, macrophages CCL3L3 CCL3L3 LD78 beta Unknown CCR1: lymphocytes, migration of monocytes, airway lymphocytes smooth muscle cells and monocytes CCR3: eosinophils, basophils, Th2 cells, CD34+ hematopoetic progenitors, keratinocytes, mast cells CCR5: T cells, macrophages, dendritic cells, eosinophils and microglia CCL4 CCL4 MIP-1 beta, macrophages, CCR1: lymphocytes, migration and AT744.1, dendritic cells monocytes, airway adhesion of ACT-2, G-26, smooth muscle cells lymphocytes, HC21, H400, CCR5: T cells, regulatory T MAD-5, LAG- macrophages, dendritic cells, NK cells, 1 cells, eosinophils and monocyrtes microglia CCR8: natural killer cells, monocytes and lymphocytes D6: lymphocytes, lymphatic endothelial cells, macrophages CCL4L1 CCL4L1 AT744.2 macrophages, CCR1: lymphocytes, CCR1 and dendritic cells monocytes, airway CCR5 smooth muscle cells expressing CCR5: T cells, cells macrophages, dendritic cells, eosinophils and microglia CCL4L2 CCL4L2 macrophages, CCR1: lymphocytes, CCR1 and dendritic cells monocytes, airway CCR5 smooth muscle cells expressing CCR5: T cells, cells macrophages, dendritic cells, eosinophils and microglia CCL5 CCL5 RANTES T cells, CCR1: lymphocytes, migration of macrophages, monocytes, airway monocytes, platelets, synovial smooth muscle cells memory T fibroblasts, tubular CCR3: eosinophils, helper cells and epithelium, certain basophils, Th2 cells, eosinophils, types of tumor cells CD34+ hematopoetic causes the progenitors, release of keratinocytes, mast cells histamine from CCR4: lymphocytes basophils and CCR5: T cells, activates macrophages, dendritic eosinophils cells, eosinophils and microglia D6: lymphocytes, lymphatic endothelial cells, macrophages DARC: erytrocytes, endothelial and epithelial cells CCL7 CCL7 MCP-3 macrophages, CCR1: lymphocytes, migration of certain types of monocytes, airway monocytes, tumor cells smooth muscle cells activation of CCR2: monocytes macrophages CCR3: eosinophils, basophils, Th2 cells, CD34+ hematopoetic progenitors, keratinocytes, mast cells D6: lymphocytes, lymphatic endothelial cells, macrophages DARC: erytrocytes, endothelial and epithelial cells CCL8 CCL8 MCP-2, HC14 fibroblasts, CCR1: lymphocytes, migration of endothelial cells monocytes, airway monocytes, smooth muscle cells lymphocytes, CCR2: monocytes basophils and CCR3: eosinophils, eosinophils basophils, Th2 cells, CD34+ hematopoetic progenitors, keratinocytes, mast cells CCR5: T cells, macrophages, dendritic cells, eosinophils and microglia CCR11: unkown D6: lymphocytes, lymphatic endothelial cells, macrophages DARC: erytrocytes, endothelial and epithelial cells CCL11 CCL11 Eotaxin lung epithelial cells, CCR3: eosinophils, migration and pleural mesothelial basophils, Th2 cells, activation of cells, bronchial CD34+ hematopoetic inflammatory airway epithelial progenitors, leukocytes, cells, smooth keratinocytes, mast cells particularly muscle cells CCR5: T cells, eosinophils macrophages, dendritic cells, eosinophils and microglia D6: lymphocytes, lymphatic endothelial cells, macrophages DARC: erytrocytes, endothelial and epithelial cells CCL12 stromal cells in lung CCR2: monocytes migration and and secondary activation of lymphoid organs monocytes CCL13 CCL13 MCP-4, CK synovial fibroblasts, CCR1: lymphocytes, migration of beta 10, chondrocytes monocytes, airway eosinophils, NCC-1 smooth muscle cells monocytes and CCR2: monocytes T lymphocytes CCR3: eosinophils, basophils, Th2 cells, CD34+ hematopoetic progenitors, keratinocytes, mast cells CCR5: T cells, macrophages, dendritic cells, eosinophils and microglia CCR11: unkown D6: lymphocytes, lymphatic endothelial cells, macrophages DARC: erytrocytes, endothelial and epithelial cells CCL14 CCL14 HCC-1, spleen, bone CCR1: lymphocytes, activation of MCIF, CK marrow, liver, monocytes, airway monocytes beta 1, NCC- muscle and gut smooth muscle cells 2 CCR3: eosinophils, basophils, Th2 cells, CD34+ hematopoetic progenitors, keratinocytes, mast cells CCR5: T cells, macrophages, dendritic cells, eosinophils and microglia D6: lymphocytes, lymphatic endothelial cells, macrophages DARC: erytrocytes, endothelial and epithelial cells CCL15 CCL15 MIP-1 delta, airway smooth CCR1: lymphocytes, migration of LKN-1, HCC- muscle cells, lung monocytes, airway monocytes and 2, MIP-5, leukocytes, alveolar smooth muscle cells eosinophils, NCC-3 macrophages, CCR3: eosinophils, proliferation of basophils basophils, Th2 cells, CD34 myeloid CD34+ hematopoetic progenitor cells progenitors, keratinocytes, mast cells CCL16 CCL16 HCC-4, LEC, liver, thymus, and CCR1: lymphocytes, migration of ILINCK, spleen monocytes, airway lymphocytes NCC-4, LMC, smooth muscle cells and monocytes CK beta 12 CCR2: monocytes CCR5: T cells, macrophages, dendritic cells, eosinophils and microglia CCR8: natural killer cells, monocytes and lymphocytes DARC: erytrocytes, endothelial and epithelial cells H4: bone marrow, eosinophils, T-cells, dendritic cells, monocytes, mast cells, neutrophil CCL17 CCL17 TARC, constitutively CCR4: lymphocytes Migration and ABCD-2 expressed in CCR8: natural killer activation of T thymus, dendritic cells, monocytes and cells cells, keratinocytes lymphocytes D6: lymphocytes, lymphatic endothelial cells, macrophages DARC: erytrocytes, endothelial and epithelial cells CCL18 CCL18 PARC, DC- dendritic cells, CCR8: natural killer migration of CK1, AMAC- monocytes, and cells, monocytes and naive and 1, CK beta 7, macrophages lymphocytes regulatory MIP-4 PITPNM3: breast cancer lymphocytes, cells dendritic cells DARC: erytrocytes, endothelial and epithelial cells CCL19 CCL19 MIP-3 beta, fibroblastic reticular CCR7: lymphocytes migration of ELC, Exodus- cells, dendritic cells (mainly naive and naive and 3, CK beta 11 memory), mature memory dendritic cells lymphocytes CCR11: unkown and mature CCRL2: neutrophils, dendritic cells monocytes CCL20 CCL20 MIP-3 alpha, epidermis CCR6: immature migration of LARC, (keratinocytes), dendritic cells and lymphocytes, Exodus-1, lymphocytes memory T cells DCs and ST38, CK neutrophils beta 4 CCL21 CCL21 6Ckine, Stromal cells, CCR7: lymphocytes migration of Exodus-2, lymphatic (mainly naive and lymphocytes SLC, TCA-4, endothelial cells, memory), mature homing to CK beta 9 fibroblastic reticular dendritic cells secondary cells, dendritic cells CCR11: unkown lymphoid organs, induces integrin- mediated lymphocyte adhesion CCL22 CCL22 MDC Macrophages CCR4: lymphocytes migration of NK D6: lymphocytes, cells, lymphatic endothelial chronically cells, macrophages activated T cells, monocytes and DCs CCL23 CCL23 MPIF-1, CK Monocytes CCR1: lymphocytes, migration of beta 8, CK monocytes monocytes, beta 8-1, FPRL-1: monocytes, resting T cells MIP-3 mast cells and neutrophils CCL24 CCL24 Eotaxin-2, lung tissue CCR3: eosinophils, migration of MPIF-2, CK basophils, Th2 cells, basophils beta 6 CD34+ hematopoetic progenitors, keratinocytes, mast cells CCL25 CCL25 TECK, CK thymic dendritic cells CCR9: T lymphocytes of migration of beta 15 and mucosal small intestine dendritic cells, epithelial cells thymocytes and activated macrophages CCL26 CCL26 Eotaxin-3, heart, lung and CCR3: eosinophils, migration of MIP-4 alpha, ovary and in basophils, Th2 cells, eosinophils and IMAC, TSC-1 endothelial cells CD34+ hematopoetic basophils stimulated with IL4 progenitors, keratinocytes, mast cells CX3CR1: lymphocytes, monocytes CCL27 CCL27 CTACK, ILC, Keratinocytes CCR10: melanocytes, migration of PESKY, plasma cells and skin- memory T cells ESKINE homing T cells CCL28 CCL28 MEC columnar epithelial CCR3: eosinophils, migration of cells in the gut, lung, basophils, Th2 T cells, lymphocytes breast and the CD34+ hematopoetic and eosinophils salivary glands progenitors, keratinocytes, mast cells CCR10: melanocytes, plasma cells and skin- homing T cells CXC Family CXCL1 CXCL1 GRO alpha, mammary, CXCR2 (IL8RB): migration of MGSA, fibroblasts, neutrophils neutrophils GRO1, NAP- mammary epithelial DARC: erytrocytes, 3 cells, endothelial endothelial and epithelial cells, activated, cells monocytes, macrophages and neutrophils CXCL2 CXCL2 GRO beta, monocytes, CXCR2 (IL8RB): migration and MIP-2 alpha, macrophages neutrophils activation of GRO2 DARC: erytrocytes, neutrophils, endothelial and epithelial basophils, cells hematopoietic stem cells CXCL3 CXCL3 GRO gamma, smooth muscle CXCR2 (IL8RB): migration and MIP-2 beta, cells, epithelial cells neutrophils activation of GRO3 DARC: erytrocytes, neutrophils endothelial and epithelial cells CXCL4 PF4 PF4 activated platelets, CXCR3 (CD183b): T migration of megakaryocytes, cells, NK cells neutrophils and leukocytes, CXCR3-B: T cells, NK fibroblasts, endothelial cells cells inhibiting DARC: erytrocytes, endothelial cell endothelial and epithelial proliferation cells and chemotaxis CXCL4L1 PF4V1 PF4V1 smooth muscle CXCR3 (CD183b): T inhibiting cells, T cells, and cells, NK cells endothelial cell platelets CXCR3-B: T cells, NK proliferation cells and chemotaxis CXCL5 CXCL5 ENA-78 fibroblasts, epithelial CXCR2 (IL8RB): migration and cells, eosinophils neutrophils activation of DARC: erytrocytes, neutrophils endothelial and epithelial cells CXCL6 CXCL6 GCP-2 fibroblasts, epithelial CXCR1 (IL8RA): migration of cells neutrophils neutrophils CXCR2 (IL8RB): neutrophils DARC: erytrocytes, endothelial and epithelial cells CXCL7 PPBP NAP-2, activated platelets CXCR1 (IL8RA): migration of CTAPIII, neutrophils neutrophils beta-TG CXCR2 (IL8RB): neutrophils CXCL8 IL8 IL-8, NAP-1, macrophages, CXCR1 (IL8RA): migration of MDNCF, epithelial cells, neutrophils neutrophils, GCP-1 airway smooth CXCR2 (IL8RB): basophils, and muscle cells, neutrophils T-cells, and endothelial cells DARC: erytrocytes, angiogenic endothelial and epithelial factor cells CXCL9 CXCL9 MIG, CRG-10 monocytes, CXCR3 (CD183b): T migration of macrophages and cells, NK cells Th1 endothelial cells CXCR3-B: T cells, NK lymphocytes, cells angiogenic DARC: erytrocytes, factor endothelial and epithelial cells CXCL10 CXCL10 IP-10 neutrophils, CXCR3 (CD183b): T migration of hepatocytes, cells, NK cells CD4+ T cells endothelial cells and CXCR3-B: T cells, NK keratinocytes cells DARC: erytrocytes, endothelial and epithelial cells CXCL11 CXCL11 I-TAC, beta- peripheral blood CXCR3 (CD183b): T migration of R1, H174, IP- leukocytes, cells, NK cells interleukin- 9 pancreas and liver CXCR7 (ACKR3): tumor activated T astrocytes and at cells and tumor- cells but not moderate levels in associated blood unstimulated T thymus, spleen and endothelium cells, lung DARC: erytrocytes, neutrophils or endothelial and epithelial monocytes. cells CXCL12 CXCL12 SDF-1, PBSF ubiquitously CXCR4: brain, heart, migration of expressed in many lymphocytes, HSCs, lymphocytes tissues and cell blood endothelial cells and types and umbilical cord hepatopoietic endothelial cell stem cells, CXCR7 (ACKR3): tumor angiogenic cells and tumor- factor associated blood endothelium CXCL13 CXCL13 BCA-1, BLC follicles of the CXCR3 (CD183b): T migration of B spleen, lymph cells, NK cells cells nodes, and Peyer's CXCR5: Burkitt's patches lymphoma, lymph node follicules, spleen DARC: erytrocytes, endothelial and epithelial cells CXCL14 CXCL14 BRAK, BMAC Fibroblasts unknown migration of monocytes, NK cells, DCs CXCL16 CXCL16 SR-PSOX DCs CXCR6: T cells migration of several subsets of T cells and NKT cells CXCL17 CXCL17 DMC, VCC-1 Lung and tumor unknown migration of tissue DCs and monocytes

    TABLE-US-00003 TABLE 3 EXAMPLES OF HUMAN IMMUNE CELL TRAFFICKING MOLECULES Trafficking molecule expressing Trafficking or presenting Leukocyte Function in the molecule cells ligand extravasation cascade P-selectin Blood PSGL-1, Tethering/Rolling during endothelial L-selectin, extravasation cascade cell CD44 E-selectin Blood Glycoprotein, Tethering/Rolling during endothelial glycolipid, extravasation cascade cell PSG L-1 PNAd Blood L-selectin Tethering/Rolling during endothelial extravasation cascade cell MAdCAM Blood L-selectin, Tethering/Rolling, arrest endothelial integrins during extravasation cell cascade VCAM-1 Blood Integrins Tethering/Rolling, arrest endothelial (e.g. VLA-4) during extravasation cell cascade Chemokines Blood GPCRs Integrin activation, allowing endothelial binding of cell adhesion cell molecules and arrest ICAM-1 Blood Integrins Arrest during extravasation endothelial (e.g. LFA-1, cascade cell Mac-1) ICAM-2 Blood Integrins Arrest during extravasation endothelial (e.g. LFA-1, cascade cell Mac-1) PECAM1 Blood Integrins Transmigration (CD31) endothelial (e.g. alpha cell v beta 3), PECAM1 JAM- Blood Integrins Transmigration A/-B/-C endothelial (e.g. LFA-1, cell Mac-1, VLA-4) ESAM Blood unknown Transmigration endothelial cell CD99 Blood CD99 Transmigration endothelial cell CD99L2 Blood possibly Transmigration endothelial CD99L cell VE- Blood None Transmigration cadherin endothelial cell PVR Blood DNAM1 Transmigration endothelial cell S1P Lymphatic S1P Entry into afferent and endothelial receptor 1 efferent lymphatics cell (S1P1) (in peripheral or SLOs respectively)

    Inflammatory and Autoimmune Conditions

    [0245] The methods described herein can be used to treat an inflammatory or autoimmune condition or disease in a subject in need thereof by administering an effective amount of a calcitonin receptor activator to the subject. The methods described herein can further include a step of identifying (e.g., diagnosing) a subject who has an inflammatory or autoimmune condition, e.g., an inflammatory or autoimmune condition described herein. The method can include administering locally to the subject a calcitonin receptor activator described herein in a dose (e.g., effective amount) and for a time sufficient to treat the autoimmune or inflammatory condition or disease.

    [0246] The methods described herein can be used to inhibit an immune response in a subject in need thereof, e.g., the subject has an autoimmune condition and is in need of inhibiting an immune response against self- or auto-antibodies (e.g., the subject has multiple sclerosis (MS), psoriasis, Crohn's disease, inflammatory bowel disease (IBD), ulcerative colitis, dermatitis, asthma, fibrosis, or wound healing, or another autoimmune condition described herein). The methods described herein can also include a step of selecting a subject in need of inhibiting an immune response, e.g., selecting a subject who has or who has been identified to have an inflammatory or autoimmune condition.

    [0247] The methods described herein can also be used to potentiate or increase an immune response in a subject in need thereof, e.g., an immune response to an infection. For example, the subject has a chronic infection (e.g., a persistent viral infection, bacterial infection, fungal infection, mycoplasma infection or parasitic infection). The viral infection may be, e.g., a persistent viral infection from hepatitis virus, a human immunodeficiency virus (HIV), a human T-lymphotrophic virus (HTLV), a herpes virus, an Epstein-Barr virus, or a human papilloma virus. Persistent viral infections may also include infections caused by a latent virus (e.g., JC virus), e.g., the subject has progressive multifocal leukoencephalopathy (PML). The methods described herein can also include a step of selecting a subject in need of potentiating an immune response, e.g., selecting a subject who has a persistent or chronic infection.

    [0248] Types of Inflammatory and Autoimmune Conditions

    [0249] In the methods described herein relating to inflammatory and autoimmune conditions, the condition may be selected from: Acute Disseminated Encephalomyelitis (ADEM); Acute necrotizing hemorrhagic leukoencephalitis; Addison's disease; Adjuvant-induced arthritis; Agammaglobulinemia; Alopecia areata; Amyloidosis; Ankylosing spondylitis; Anti-GBM/Anti-TBM nephritis; Antiphospholipid syndrome (APS); Autoimmune angioedema; Autoimmune aplastic anemia; Autoimmune dysautonomia; Autoimmune gastric atrophy; Autoimmune hemolytic anemia; Autoimmune hepatitis; Autoimmune hyperlipidemia; Autoimmune immunodeficiency; Autoimmune inner ear disease (AIED); Autoimmune myocarditis; Autoimmune oophoritis; Autoimmune pancreatitis; Autoimmune retinopathy; Autoimmune thrombocytopenic purpura (ATP); Autoimmune thyroid disease; Autoimmune urticarial; Axonal & neuronal neuropathies; Balo disease; Behcet's disease; Bullous pemphigoid; Cardiomyopathy; Castleman disease; Celiac disease; Chagas disease; Chronic inflammatory demyelinating polyneuropathy (CIDP); Chronic recurrent multifocal ostomyelitis (CRMO); Churg-Strauss syndrome; Cicatricial pemphigoid/benign mucosal pemphigoid; Crohn's disease; Cogans syndrome; Collagen-induced arthritis; Cold agglutinin disease; Congenital heart block; Coxsackie myocarditis; CREST disease; Essential mixed cryoglobulinemia; Demyelinating neuropathies; Dermatitis herpetiformis; Dermatomyositis; Devic's disease (neuromyelitis optica); Discoid lupus; Dressler's syndrome; Endometriosis; Eosinophilic esophagitis; Eosinophilic fasciitis; Erythema nodosum Experimental allergic encephalomyelitis; Experimental autoimmune encephalomyelitis; Evans syndrome; Fibromyalgia; Fibrosing alveolitis; Giant cell arteritis (temporal arteritis); Giant cell myocarditis; Glomerulonephritis; Goodpasture's syndrome; Granulomatosis with Polyangiitis (GPA) (formerly called Wegener's Granulomatosis); Graves' disease; Guillain-Barre syndrome; Hashimoto's encephalitis; Hashimoto's thyroiditis; Hemolytic anemia; Henoch-Schonlein purpura; Herpes gestationis; Hypogammaglobulinemia; Idiopathic thrombocytopenic purpura (ITP); IgA nephropathy; IgG4-related sclerosing disease; Immunoregulatory lipoproteins; Inclusion body myositis; Interstitial cystitis; Inflammatory bowel disease; Juvenile arthritis; Juvenile oligoarthritis; Juvenile diabetes (Type 1 diabetes); Juvenile myositis; Kawasaki syndrome; Lambert-Eaton syndrome; Leukocytoclastic vasculitis; Lichen planus; Lichen sclerosus; Ligneous conjunctivitis; Linear IgA disease (LAD); Lupus (SLE); Lyme disease, chronic; Meniere's disease; Microscopic polyangiitis; Mixed connective tissue disease (MCTD); Mooren's ulcer; Mucha-Habermann disease; Multiple sclerosis; Myasthenia gravis; Myositis; Narcolepsy; Neuromyelitis optica (Devic's); Neutropenia; Non-obese diabetes; Ocular cicatricial pemphigoid; Optic neuritis; Palindromic rheumatism; PANDAS (Pediatric Autoimmune Neuropsychiatric Disorders Associated with Streptococcus); Paraneoplastic cerebellar degeneration; Paroxysmal nocturnal hemoglobinuria (PNH); Parry Romberg syndrome; Parsonnage-Turner syndrome; Pars planitis (peripheral uveitis); Pemphigus; Pemphigus vulgaris; Peripheral neuropathy; Perivenous encephalomyelitis; Pernicious anemia; POEMS syndrome; Polyarteritis nodosa; Type I, II, & III autoimmune polyglandular syndromes; Polymyalgia rheumatic; Polymyositis; Postmyocardial infarction syndrome; Postpericardiotomy syndrome; Progesterone dermatitis; Primary biliary cirrhosis; Primary sclerosing cholangitis; Psoriasis; Plaque Psoriasis; Psoriatic arthritis; Idiopathic pulmonary fibrosis; Pyoderma gangrenosum; Pure red cell aplasia; Raynauds phenomenon; Reactive Arthritis; Reflex sympathetic dystrophy; Reiter's syndrome; Relapsing polychondritis; Restless legs syndrome; Retroperitoneal fibrosis; Rheumatic fever; Rheumatoid arthritis; Sarcoidosis; Schmidt syndrome; Scleritis; Scleroderma; Sclerosing cholangitis; Sclerosing sialadenitis; Sjogren's syndrome; Sperm & testicular autoimmunity; Stiff person syndrome; Subacute bacterial endocarditis (SBE); Susac's syndrome; Sympathetic ophthalmia; Systemic lupus erythematosus (SLE); Systemic sclerosis; Takayasu's arteritis; Temporal arteritis/Giant cell arteritis; Thrombocytopenic purpura (TTP); Tolosa-Hunt syndrome; Transverse myelitis; Type 1 diabetes; Ulcerative colitis; Undifferentiated connective tissue disease (UCTD); Uveitis; Vasculitis; Vesiculobullous dermatosis; Vitiligo; Wegener's granulomatosis (now termed Granulomatosis with Polyangiitis (GPA).

    [0250] In some embodiments, the calcitonin receptor activator is administered in combination with an additional therapeutic agent to treat an inflammatory or autoimmune disease or condition. In some embodiments, the additional therapeutic agent is 6-mercaptopurine, 6-thioguanine, abatacept, adalimumab, alemtuzumab (Lemtrada), aminosalicylates (5-aminoalicylic acid, sulfasalazine, mesalamine, balsalazide, olsalazine), antibiotics, anti-histamines, anti-TNF (infliximab, adalimumab, certolizumab pegol, natalizumab) Ustekinumab), azathioprine, belimumab, beta interferon, calcineurin inhibitors, certolizumab, corticosteroids (prednisone, methylprednisolone), cromolyn, cyclosporin A, cyclosporine, dimethyl fumarate (tecfidera), etanercept, fingolimod (Gilenya), fumaric acid esters, glatiramer acetate (Copaxone), golimumab, hydroxyurea, IFN, IL-11, infliximab, leflunomide, leukotriene receptor antagonist, long-acting beta2 agonist, methotrexate, mitoxantrone, mycophenolate mofetil, natalizumab (tysabri), NSAIDs, ocrelizumab, pimecrolimus, probiotics (VSL#3), retinoids, rituximab, salicylic acid, short-acting beta2 agonist, sulfasalazine, tacrolimus, teriflunomide (Aubagio), theophylline, tocilizumab, ustekinumab (anti-IL12/IL23), or vedolizumab (Anti alpha3 beta7 integrin).

    Infection

    [0251] Chronic Infections

    [0252] As used herein, by persistent infection or chronic infection is meant an infection in which the infectious agent (e.g., virus, bacterium, parasite, mycoplasm, or fungus) is not cleared or eliminated from the infected host, even after the induction of an immune response. Persistent infections may be chronic infections, latent infections, or slow infections. While acute infections are relatively brief (lasting a few days to a few weeks) and resolved from the body by the immune system, persistent infections may last for months, years, or even a lifetime. These infections may also recur frequently over a long period of time, involving stages of silent and productive infection without cell killing or even producing excessive damage to the host cells. The causative infectious agents may also be detected in the host (e.g., inside specific cells of infected individuals) even after the immune response has resolved, using standard techniques. Mammals are diagnosed as having a persistent infection according to any standard method known in the art and described, for example, in U.S. Pat. Nos. 6,368,832, 6,579,854, and 6,808,710. Described herein, inter alia, are methods of treating a chronic infection in a subject with a calcitonin receptor activator described herein. The method may include administering locally to the subject a calcitonin receptor activator described herein in a dose (e.g., effective amount) and for a time sufficient to treat the infection. In embodiments, the infection is caused by a pathogen from one of the 3 following major categories:

    [0253] i) viruses, including the members of the Retroviridae family such as the lentiviruses (e.g., Human immunodeficiency virus (HIV) and deltaretroviruses (e.g., human T cell leukemia virus I (HTLV-I), human T cell leukemia virus II (HTLV-II)); Hepadnaviridae family (e.g., hepatitis B virus (HBV)), Flaviviridae family (e.g., hepatitis C virus (HCV)), Adenoviridae family (e.g., Human Adenovirus), Herpesviridae family (e.g., Human cytomegalovirus (HCMV), Epstein-Barr virus, herpes simplex virus 1 (HSV-1), herpes simplex virus 2 (HSV-2), human herpesvirus 6 (HHV-6), varicella-zoster virus), Papillomaviridae family (e.g., Human Papillomavirus (HPV)), Parvoviridae family (e.g., Parvovirus B19), Polyomaviridae family (e.g., JC virus and BK virus), Paramyxoviridae family (e.g., Measles virus), Togaviridae family (e.g., Rubella virus) as well as other viruses such as hepatitis D virus;

    [0254] ii) bacteria, such as those from the following families: Salmonella (e.g., S. enterica Typhi), Mycobacterium (e.g., M. tuberculosis and M. leprae), Yersinia (Y. pestis), Neisseria (e.g., N. meningitides, N. gonorrhea), Burkholderia (e.g., B. pseudomallei), Brucella, Chlamydia, Helicobacter, Treponema, Borrelia, and Pseudomonas; and

    [0255] iii) parasites, such as Leishmania, Toxoplasma, Trypanosoma, Plasmodium, Schistosoma, or Encephalitozoon.

    [0256] Calcitonin receptor activators described herein can be administered in combination with a second therapeutic agent for treatment of chronic infection. Additional therapeutic agents include, for example, antiviral compounds (e.g., vidarabine, acyclovir, gancyclovir, valgancyclovir, nucleoside-analog reverse transcriptase inhibitor (NRTI) (e.g., AZT (Zidovudine), ddI (Didanosine), ddC (Zalcitabine), d4T (Stavudine), or 3TC (Lamivudine)), non-nucleoside reverse transcriptase inhibitor (NNRTI) (e.g., (nevirapine or delavirdine), protease inhibitor (saquinavir, ritonavir, indinavir, or nelfinavir), ribavirin, or interferon), antibacterial compounds, antifungal compounds, antiparasitic compounds, anti-inflammatory compounds, and analgesics.

    [0257] Optionally, the subject is further administered a vaccine that elicits a protective immune response against the infectious agent that causes a persistent infection.

    [0258] Neuromodulatory Combination Therapies

    [0259] Neurotransmission Modulators

    [0260] In some embodiments, the calcitonin receptor activator is administered in combination with a neurotransmission modulator (e.g., an agent that increases or decreases neurotransmission). A neurotransmission modulator can be used to modulate neural activity in a lymph node or site of inflammation that is innervated by nerves or to modulate immune cells that express neurotransmitter receptors. For example, in some embodiments, the neurotransmission modulator is a neurotransmitter or neurotransmitter receptor listed in Table 4 or 5, or an agonist or antagonist listed in Tables 6A-6K for a corresponding neurotransmitter pathway member. In some embodiments, the neurotransmission modulator is a neurotransmission modulator listed in Table 7. Neurotransmission modulators that increase neurotransmission include neurotransmitters and neurotransmitter receptors listed in Tables 4 and 5 and analogs thereof, and neurotransmitter agonists (e.g., small molecules that agonize a neurotransmitter receptor listed in Table 4). Exemplary agonists are listed in Tables 6A-6K. In some embodiments, neurotransmission is increased via administration, local delivery, or stabilization of neurotransmitters (e.g., ligands listed in Tables 4 or 5). Neurotransmission modulators that increase neurotransmission also include agents that increase neurotransmitter synthesis or release (e.g., agents that increase the activity of a biosynthetic protein encoded by a gene in Table 4 via stabilization, overexpression, or upregulation, or agents that increase the activity of a synaptic or vesicular protein via stabilization, overexpression, or upregulation), prevent neurotransmitter reuptake or degradation (e.g., agents that block or antagonize transporters that remove neurotransmitter from the synaptic cleft), increase neurotransmitter receptor activity (e.g., agents that increase the activity of a signaling protein encoded by a gene in Table 4 via stabilization, overexpression, agonism, or upregulation, or agents that upregulate, agonize, or stabilize a neurotransmitter receptor listed in Table 4), increase neurotransmitter receptor synthesis or membrane insertion, decrease neurotransmitter degradation, and regulate neurotransmitter receptor conformation (e.g., agents that bind to a receptor and keep it in an open or primed conformation). In some embodiments, the neurotransmitter receptor is a channel, the activity of which can be increased by agonizing, opening, stabilizing, or overexpressing the channel. Neurotransmission modulators can increase neurotransmission by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98% or more. Exemplary neurotransmission modulators are listed in Table 7.

    [0261] Neurotransmission modulators that decrease neurotransmission include neurotransmitter antagonists (e.g., small molecules that antagonize a neurotransmitter receptor listed in Table 4). Exemplary antagonists are listed in Tables 6A-6K. Neurotransmission modulators that decrease neurotransmission also include agents that decrease neurotransmitter synthesis or release (e.g., agents that decrease the activity of a biosynthetic protein encoded by a gene in Table 4 via inhibition or downregulation, or agents that decrease the activity of a synaptic or vesicular protein via blocking, disrupting, downregulating, or antagonizing the protein), increase neurotransmitter reuptake or degradation (e.g., agents that agonize, open, or stabilize transporters that remove neurotransmitter from the synaptic cleft), decrease neurotransmitter receptor activity (e.g., agents that decrease the activity of a signaling protein encoded by a gene in Table 4 or via blocking or antagonizing the protein, or agents that block, antagonize, or downregulate a neurotransmitter receptor listed in Table 4), decrease neurotransmitter receptor synthesis or membrane insertion, increase neurotransmitter degradation, regulate neurotransmitter receptor conformation (e.g., agents that bind to a receptor and keep it in a closed or inactive conformation), and disrupt the pre- or postsynaptic machinery (e.g., agents that block or disrupt a structural protein, or agents that block, disrupt, downregulate, or antagonize a synaptic or vesicular protein). In some embodiments, the neurotransmitter receptor is a channel (e.g., a ligand or voltage gated ion channel), the activity of which can be decreased by blockade, antagonism, or inverse agonism of the channel. Neurotransmission modulators that decrease neurotransmission further include agents that sequester, block, antagonize, or degrade a neurotransmitter listed in Tables 4 or 5. Neurotransmission modulators that decrease or block neurotransmission include antibodies that bind to or block the function of neurotransmitters, neurotransmitter receptor antagonists, and toxins that disrupt synaptic release. Neurotransmission modulators can decrease neurotransmission by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98% or more. Neurotransmission modulator can be administered in any of the modalities described herein (e.g., antibody, small molecule, nucleic acid, polypeptide, or viral vector).

    TABLE-US-00004 TABLE 4 NEUROTRANSMITTER GENES & PATHWAYS Accession Entrez Gene Pathway Type Number Gene ID ABAT Neurotransmitter Biosynthesis P80404 18 ACHE Neurotransmitter Biosynthesis P22303 43 ADORA2A Neurotransmitter Receptor P29274 135 ADORA2B Neurotransmitter Receptor P29275 136 Adra1a Adrenergic/ Receptor P35348 148 Neurotransmitter Adra1b Adrenergic/ Receptor P35368 147 Neurotransmitter Adra1d Adrenergic/ Receptor P25100 146 Neurotransmitter Adra2a Adrenergic/ Receptor P08913 150 Neurotransmitter Adra2b Adrenergic/ Receptor P18089 151 Neurotransmitter Adra2c Adrenergic/ Receptor P18825 152 Neurotransmitter Adrb1 Adrenergic/ Receptor P08588 153 Neurotransmitter Adrb2 Adrenergic/ Receptor P07550 154 Neurotransmitter Adrb3 Adrenergic/ Receptor P13945 155 Neurotransmitter Adrbk1 Adrenergic Kinase P25098 156 Adrbk2 Adrenergic Kinase P35626 157 BACE1 Neurotransmitter Biosynthesis P56817 23621 BCHE Neurotransmitter Biosynthesis P06276 590 BRS3 Neuromodulator Receptor P32247 P32247 C6orf89 Neuromodulator Receptor Q6UWU4 221477 CHAT Neurotransmitter Biosynthesis P28329 1103 CHRFAM7A Neurotransmitter Receptor Q494W8 89832 Chrm1 Cholinergic/ Receptor P11229 1128 Neurotransmitter Chrm2 Cholinergic/ Receptor P08172 1129 Neurotransmitter Chrm3 Cholinergic/ Receptor P20309 1131 Neurotransmitter Chrm4 Cholinergic/ Receptor P08173 1132 Neurotransmitter Chrm5 Cholinergic/ Receptor P08912 1133 Neurotransmitter Chrna1 Cholinergic/ Receptor P02708 1134 Neurotransmitter Chrna10 Cholinergic/ Receptor Q9GZZ6 57053 Neurotransmitter Chrna2 Cholinergic/ Receptor Q15822 1135 Neurotransmitter Chrna3 Cholinergic/ Receptor P32297 1136 Neurotransmitter Chrna4 Cholinergic/ Receptor P43681 1137 Neurotransmitter Chrna5 Cholinergic/ Receptor P30532 1138 Neurotransmitter Chrna6 Cholinergic/ Receptor Q15825 8973 Neurotransmitter Chrna7 Cholinergic/ Receptor P36544 1139 Neurotransmitter Chrna9 Cholinergic/ Receptor Q9UGM1 55584 Neurotransmitter Chrnb1 Cholinergic/ Receptor P11230 1140 Neurotransmitter Chrnb2 Cholinergic/ Receptor P17787 1141 Neurotransmitter Chrnb3 Cholinergic/ Receptor Q05901 1142 Neurotransmitter Chrnb4 Cholinergic/ Receptor P30926 1143 Neurotransmitter Chrnd Cholinergic/ Receptor Q07001 1144 Neurotransmitter Chrne Cholinergic/ Receptor Q04844 1145 Neurotransmitter Chrng Cholinergic/ Receptor P07510 1146 Neurotransmitter CNR1 Cannabinoid/ Receptor P21554 1268 Neurotransmitter CNR2 Cannabinoid/ Receptor P34972 1269 Neurotransmitter CNRIP1 Neurotransmitter Receptor Q96F85 25927 COMT Neurotransmitter Biosynthesis P21964 1312 CPA4 Neurotransmitter Biosynthesis Q9UI42 51200 CPE Neuropeptide/ Biosynthesis P16870 1363 Neurotransmitter CREM Neurotransmitter Signaling Q03060 1390 DAGLA Neurotransmitter Biosynthesis Q9Y4D2 747 (Cannabinoid) DAGLB Neurotransmitter Biosynthesis Q8NCG7 221955 (Cannabinoid) DBH Neurotransmitter Biosynthesis P09172 1621 DDC Neurotransmitter Biosynthesis P20711 1644 DGKI Neurotransmitter Biosynthesis O75912 9162 DOPO Dopaminergic Receptor P09172 1621 DPP4 Neurotransmitter Biosynthesis P27487 1803 Drd1 Dopaminergic/ Receptor P21728 1812 Neurotransmitter Drd2 Dopaminergic/ Receptor P14416 1813 Neurotransmitter Drd3 Dopaminergic/ Receptor P35462 1814 Neurotransmitter Drd4 Dopaminergic/ Receptor P21917 1815 Neurotransmitter Drd5 Dopaminergic/ Receptor P21918 1816 Neurotransmitter ECEL1 Neurotransmitter Biosynthesis O95672 9427 FAAH Neurotransmitter Biosynthesis O00519 2166 FNTA Neurotransmitter Signaling P49354 2339 GABARAP Neurotransmitter Receptor O95166 11337 GABARAPL1 Amine Receptor Q9H0R8 23710 Neuromodulator GABARAPL2 Amine Receptor P60520 11345 Neuromodulator GABBR1 Neurotransmitter Receptor Q9UBS5 2550 GABBR2 Amine Receptor O75899 9568 Neuromodulator GABRA1 Neurotransmitter Receptor P14867 2554 GABRA2 Neurotransmitter Receptor P47869 2555 GABRA3 Neurotransmitter Receptor P34903 2556 GABRA4 Neurotransmitter Receptor P48169 2557 GABRA5 Neurotransmitter Receptor P31644 2558 GABRA6 Neurotransmitter Receptor Q16445 2559 GABRB1 Neurotransmitter Receptor P18505 2560 GABRB2 Neurotransmitter Receptor P47870 2561 GABRB3 Neurotransmitter Receptor P28472 2562 GABRD Neurotransmitter Receptor O14764 2563 GABRE Neurotransmitter Receptor P78334 2564 GABRG1 Neurotransmitter Receptor Q8N1C3 2565 GABRG2 Neurotransmitter Receptor P18507 2566 GABRG3 Neurotransmitter Receptor Q99928 2567 GABRP Neurotransmitter Receptor O00591 2568 GABRQ Neurotransmitter Receptor Q9UN88 55879 GABRR1 Neurotransmitter Receptor P24046 2569 GABRR2 Neurotransmitter Receptor P28476 2570 GABRR3 Neurotransmitter Receptor A8MPY1 200959 GAD1 Neurotransmitter Biosynthesis Q99259 2571 GAD2 Neurotransmitter Biosynthesis Q05329 2572 GCHFR Neurotransmitter Biosynthesis P30047 2644 GLRA1 Neurotransmitter Receptor P23415 2741 GLRA2 Neurotransmitter Receptor P23416 2742 GLRA3 Neurotransmitter Receptor O75311 8001 GLRA4 Neurotransmitter Receptor Q5JXX5 441509 GLRB Neurotransmitter Receptor P48167 2743 GLS Neurotransmitter Biosynthesis O94925 2744 GLS2 Neurotransmitter Biosynthesis Q9UI32 27165 GluA1 (GluR1) Amine Receptor P42261 2890 Neuromodulator GluK1 (GluR5) Amine Receptor P39086 2897 Neuromodulator GLUL Neurotransmitter Biosynthesis P15104 2752 GluN1(NR1) Amine Receptor Q05586 2902 Neuromodulator GNMT Neurotransmitter Biosynthesis Q14749 27232 GPER1 Neurotransmitter Receptor Q99527 2852 GPR1 Neurotransmitter Receptor P46091 2825 GPR139 Neurotransmitter Receptor Q6DWJ6 124274 GPR143 Neurotransmitter Receptor P51810 4935 GPR149 Neurotransmitter Receptor Q86SP6 344758 GPR18 Neurotransmitter Receptor Q14330 2841 GPR21 Neurotransmitter Receptor Q99679 2844 GPR26 Neurotransmitter Receptor Q8NDV2 2849 GPR3 Neurotransmitter Receptor P46089 2827 GPR35 Neurotransmitter Receptor Q9HC97 2859 GPR52 Neurotransmitter Receptor Q9Y2T5 9293 GPR55 Neurotransmitter Receptor Q9Y2T6 9290 GPR78 Neurotransmitter Receptor Q96P69 27201 GPR83 Neurotransmitter Receptor Q9NYM4 10888 GPR84 Neurotransmitter Receptor Q9NQS5 53831 GPRASP1 Neurotransmitter Receptor Q5JY77 9737 GPR50 Amine Receptor Q13585 9248 Neuromodulator GRIA1 Neurotransmitter Receptor P42261 2890 GRIA2 Neurotransmitter Receptor P42262 2891 GRIA3 Neurotransmitter Receptor P42263 2892 GRIA4 Neurotransmitter Receptor P48058 2893 GRID1 Neurotransmitter Receptor Q9ULK0 2894 GRID2 Neurotransmitter Receptor O43424 2895 GRIK1 Neurotransmitter Receptor P39086 2897 GRIK2 Neurotransmitter Receptor Q13002 2898 GRIK3 Neurotransmitter Receptor Q13003 2899 GRIK4 Neurotransmitter Receptor Q16099 2900 GRIK5 Neurotransmitter Receptor Q16478 2901 GRIN1 Neurotransmitter Receptor Q05586 2902 GRIN2A Neurotransmitter Receptor Q12879 2903 GRIN2B Neurotransmitter Receptor Q13224 2904 GRIN2C Neurotransmitter Receptor Q14957 2905 GRIN2D Neurotransmitter Receptor Q15399 2906 GRIN3A Neurotransmitter Receptor Q8TCU5 116443 GRIN3B Neurotransmitter Receptor O60391 116444 GRK2 Neurotransmitter Receptor P25098 156 GRK3 Neurotransmitter Receptor P35626 157 GRM1 Neurotransmitter Receptor Q13255 2911 GRM2 Neurotransmitter Receptor Q14416 2912 GRM3 Neurotransmitter Receptor Q14832 2913 GRM4 Neurotransmitter Receptor Q14833 2914 GRM5 Neurotransmitter Receptor P41594 2915 GRM6 Neurotransmitter Receptor O15303 2916 GRM7 Neurotransmitter Receptor Q14831 2917 GRM8 Neurotransmitter Receptor O00222 2918 HNMT Neurotransmitter Biosynthesis P50135 3176 HOMER1 Neurotransmitter Receptor Q86YM7 9456 HRH1 Neurotransmitter Receptor P35367 3269 HRH2 Neurotransmitter Receptor P25021 3274 HRH3 Neurotransmitter Receptor Q9Y5N1 11255 HRH4 Neurotransmitter Receptor Q9H3N8 59340 Htr1a Neurotransmitter Receptor P08908 3350 Htr1b Neurotransmitter Receptor P28222 3351 Htr1c Neurotransmitter Receptor P28335 Htr1d Neurotransmitter Receptor P28221 3352 Htr1e Neurotransmitter Receptor P28566 3354 Htr1f Neurotransmitter Receptor P30939 3355 Htr2a Neurotransmitter Receptor P28223 3356 Htr2b Neurotransmitter Receptor P41595 3357 Htr2c Neurotransmitter Receptor P28335 3358 Htr3a Neurotransmitter Receptor P46098 3359 Htr3b Neurotransmitter Receptor O95264 9177 Htr3c Neurotransmitter Receptor Q8WXA8 170572 Htr3d Neurotransmitter Receptor Q70Z44 200909 HTR3E Neurotransmitter Receptor A5X5Y0 285242 Htr4 Neurotransmitter Receptor Q13639 3360 Htr5a Neurotransmitter Receptor P47898 3361 Htr5b Neurotransmitter Receptor P35365 79247 HTR5BP Neurotransmitter Receptor 645694 Htr6 Neurotransmitter Receptor P50406 3362 Htr7 Neurotransmitter Receptor P32305 3363 ITPR1 Neurotransmitter Signaling Q14643 3708 ITPR2 Neurotransmitter Signaling Q14571 3709 ITPR3 Neurotransmitter Signaling Q14573 3710 LYNX1 Neurotransmitter Receptor Q9BZG9 66004 MAOA Neurotransmitter Biosynthesis P21397 4128 MAOB Neurotransmitter Biosynthesis P27338 4129 NAMPT Neurotransmitter Biosynthesis P43490 10135 NISCH Neurotransmitter Receptor Q9Y2I1 11188 NOS1 Neurotransmitter Biosynthesis P29475 4842 NPTN Neurotransmitter Receptor Q9Y639 27020 P2RX1 Neurotransmitter Receptor P51575 5023 P2RX2 Neurotransmitter Receptor Q9UBL9 22953 P2RX3 Neurotransmitter Receptor P56373 5024 P2RX4 Neurotransmitter Receptor Q99571 5025 P2RX5 Neurotransmitter Receptor Q93086 5026 P2RX6 Neurotransmitter Receptor O15547 9127 P2RX7 Neurotransmitter Receptor Q99572 5027 P2RY11 Neurotransmitter Receptor Q96G91 5032 PAH Neurotransmitter Biosynthesis P00439 5053 PC Neurotransmitter Biosynthesis P11498 5091 PDE1B Neurotransmitter Signaling Q01064 5153 PDE4A Neurotransmitter Signaling P27815 5141 PDE4D Neurotransmitter Signaling Q08499 5144 PHOX2A Neurotransmitter Biosynthesis O14813 401 PHOX2B Neurotransmitter Biosynthesis Q99453 8929 PIK3CA Neurotransmitter Signaling P42336 5290 PIK3CB Neurotransmitter Signaling P42338 5291 PIK3CG Neurotransmitter Signaling P48736 5294 PLCB1 Neurotransmitter Signaling Q9NQ66 23236 PLCB2 Neurotransmitter Signaling Q00722 5330 PLCB3 Neurotransmitter Signaling Q01970 5331 PLCB4 Neurotransmitter Signaling Q15147 5332 PLCD1 Neurotransmitter Signaling P51178 5333 PLCE1 Neurotransmitter Signaling Q9P212 51196 PLCG1 Neurotransmitter Signaling P19174 5335 PLCL1 Neurotransmitter Signaling Q15111 5334 PLCL2 Neurotransmitter Signaling Q9UPR0 23228 PPP1CB Neurotransmitter Signaling P62140 5500 PPP100 Neurotransmitter Signaling P36873 5501 PRIMA1 Neurotransmitter Biosynthesis Q86XR5 145270 PRKACG Neurotransmitter Signaling P22612 5568 PRKAR2B Neurotransmitter Signaling P31323 5577 PRKCG Neurotransmitter Signaling P05129 5582 PRKX Neurotransmitter Signaling P51817 5613 RIC3 Neurotransmitter Receptor Q7Z5B4 79608 SHANK3 Neurotransmitter Signaling Q9BYB0 85358 SLC6A1 Amine Transferase P30531 6529 Neuromodulator SLC6A13 Amine Transferase Q9NSD5 6540 Neuromodulator Slc6a4 Serotonin Transporter P31645 6532 SNX13 Neurotransmitter Signaling Q9Y5W8 23161 TAAR1 Amine Receptor Q96RJ0 134864 Neuromodulator TAAR2 Amine Receptor Q9P1P5 9287 Neuromodulator TAAR5 Neurotransmitter Receptor O14804 9038 TH Neurotransmitter Biosynthesis P07101 7054 TPH1 Neurotransmitter Biosynthesis P17752 7166 TPH2 Neurotransmitter Biosynthesis Q8IWU9 121278 TRHDE Neurotransmitter Biosynthesis Q9UKU6 29953

    TABLE-US-00005 TABLE 5 NEUROTRANSMITTERS Ligand Pathway Type 2-Arachidonoylglycerol Endocannabinoid Ligand 2-Arachidonyl glyceryl ether Endocannabinoid Ligand 3-methoxytyramine Amines Ligand Acetylcholine Amino Acids Ligand Adenosine Purine Ligand Adenosine triphosphate Purine Ligand Agmatine Amino Acids Ligand Anandamide Endocannabinoid Ligand Aspartate Amino Acids Ligand Carbon monoxide Gas Ligand D-serine Amino Acids Ligand Dopamine Monoamines Ligand Dynorphin Opioids Ligand Endorphin Opioids Ligand Enkephalin Opioids Ligand Epinephrine Monoamines Ligand Gamma-aminobutyric acid Amino Acids Ligand Glutamate Amino Acids Ligand Glycine Amino Acids Ligand Histamine Monoamines Ligand N-Acetylaspartylglutamate Neuropeptides Ligand N-Arachidonoyl dopamine Endocannabinoid Ligand N-methylphenethylamine Amines Ligand N-methyltryptamine Amines Ligand Nitric oxide Gas Ligand Norepinephrine Monoamines Ligand Octopamine Amines Ligand Phenethylamine Amines Ligand Serotonin Monoamines Ligand Synephrine Amines Ligand Tryptamine Amines Ligand Tyramine Amines Ligand Virodhamine Endocannabinoid Ligand

    TABLE-US-00006 TABLE 6A AGONISTS AND ANTAGONIST AGENTS Gene Agonist Antagonist Adrb2 NCX 950 Alprenolol Accession Number: Bitolterol Carvedilol P07550 Isoetarine Desipramine Norepinephrine Nadolol Phenylpropanolamine Levobunolol Dipivefrin Metipranolol Epinephrine Bevantolol Orciprenaline Oxprenolol Dobutamine Nebivolol Ritodrine Asenapine Terbutaline Bupranolol Salmeterol Penbutolol Formoterol Celiprolol Salbutamol Pindolol Isoprenaline Acebutolol Arbutamine Bopindolol Arformoterol Fenoterol Pirbuterol Ephedra Procaterol Clenbuterol Bambuterol Indacaterol Droxidopa Olodaterol Vilanterol Pseudoephedrine Cabergoline Mirtazepine Adra1d Midodrine Dapiprazole Accession Number: Norepinephrine Amitriptyline P25100 Clonidine Alfuzosin Oxymetazoline Promazine Pergolide Prazosin Bromocriptine Imipramine Droxidopa Nortriptyline Xylometazoline Doxazosin Ergotamine Nicardipine Cirazoline Dronedarone Cabergoline Tamsulosin Methoxamine Propiomazine Epinephrine Phenoxybenzamine Carvedilol Doxepin Terazosin Quetiapine Methotrimeprazine Silodosin Adrb1 Isoetarine Esmolol Accession Number: Norepinephrine Betaxolol P08588 Phenylpropanolamine Metoprolol Epinephrine Atenolol Dobutamine Timolol Salbutamol Sotalol Isoprenaline Propranolol Arbutamine Labetalol Fenoterol Bisoprolol Pirbuterol Alprenolol Ephedra Amiodarone Clenbuterol Carvedilol Droxidopa Nadolol Pseudoephedrine Levobunolol Carteolol Metipranolol Cabergoline Bevantolol Mirtazapine Practolol Loxapine Oxprenolol Vortioxetine Celiprolol Desipramine Nebivolol Asenapine Bupranolol Penbutolol Pindolol Acebutolol Bopindolol Cartelol Adrb3 SR 58611 Bopindolol Accession Number: Norepinephrine Propranolol P13945 Epinephrine Bupranolol Isoprenaline Arbutamine Fenoterol Ephedra Clenbuterol Droxidopa Mirabegron Adrbk1 ATP Alprenolol Accession Number: Carbachol Heparin P25098 Dopamine Isoproterenol Morphine DAMGO histamine Acetylcholine Etorphine NMDA Dopamine Adrbk2 Isoproterenol Propranolol Accession Number: DAMGO P26819 ATP Chrm3 cgmp MT3 Accession Number: ATP Hexocyclium P20309 Cevimeline Himbacine arecoline Biperiden oxotremorine-M lithocholylcholine NNC 11-1314 AFDX384 xanomeline 4-DAMP oxotremorine hexahydrodifenidol pentylthio-TZTP VU0255035 arecaidine propargyl ester N-methyl scopolamine NNC 11-1607 Darifenacin furmethide Thiethylperazine NNC 11-1585 methoctramine Acetylcholine silahexocyclium methylfurmethide Strychnine Bethanechol MT7 Carbachol Heparin Succinylcholine Olanzapine ALKS 27 Pirenzepine itopride Clidinium methacholine Ipratropium Meperidine Propantheline Cinnarizine Dicyclomine Trimipramine Darifenacin Tiotropium Atropine Scopolamine Amitriptyline Doxepin Lidocaine Nortriptyline Tropicamide Metixene Homatropine Methylbromide Solifenacin Glycopyrrolate Propiomazine Diphemanil Methylsulfate Promethazine Diphenidol Pancuronium Ziprasidone Quetiapine Imipramine Clozapine Cyproheptadine Aripiprazole Nicardipine Amoxapine Loxapine Promazine Oxyphencyclimine Anisotropine Methylbromide Tridihexethyl Chlorpromazine Ketamine Cyclosporin A Paroxetine Benzquinamide Tolterodine Oxybutynin Alcuronium WIN 62, 577 Tramadol Chlorprothixene Aclidiniurn Methotrimeprazine Umeclidinium Cryptenamine Mepenzolate Maprotiline Brompheniramine Isopropamide Trihexyphenidyl Ipratropium bromide Hyoscyamine Procyclidine Pipecuronium Fesoterodine Disopyramide Desipramine Mivacuriurn Chrna3 Nicotine A-867744 Accession Number: Varenicline NS1738 P32297 Acetylcholine Hexamethonium Ethanol Mecamylamine Cytisine Dextromethorphan Levamisole Pentolinium Galantamine Levomethadyl Acetate Bupropion Chrna6 Nicotine Hexamethonium Accession Number: Cytisine Mecamylamine Q15825 Varenicline Galantamine Chrna9 Nicotine Hexamethonium Accession Number: Galantamine Mecamylamine Q9UGM1 Ethanol Tetraethylammonium Muscarine ATG003 Strychnine Lobeline RPI-78M Chrnb1 Galantamine Accession Number: P11230 Chrnb4 Nicotine Atropine Accession Number: Varenicline Oxybutynin P30926 PNU-120596 Pentolinium Ethanol Dextromethorphan Galantamine Chrng Galantamine Accession Number: P07510 Adcyap1 Nicotine Atropine Accession Number: CGMP PPADS P18509 Apomorphine Onapristone Suramin Muscarine Nifedipine Haloperidol ATP Astressin Dihydrotestosterone Melatonin Maxadilan Scopolamine Dexamethasone Tetrodotoxin Acetylcholine Apamin Histamine Hexamethonium Carbachol Indomethacin NMDA Propranolol Dopamine Bumetanide Isoproterenol Progesterone Salbutamol Charybdotoxin Morphine Prazosin Clonidine Nimodipine 2,6-Diamino-Hexanoic Acid Amide CYSLTR1 Salbutamol Montelukast Accession Number: Dexamethasone Zafirlukast Q9Y271 Arachidonic acid Cinalukast Histamine Pranlukast Nedocromil Theophylline Indomethacin Zileuton Iralukast Pobilukast Sulukast Verlukast LTB4R LTB U75302 Accession Number: ATP CP105696 Q15722 Dexamethasone CP-195543 cholesterol Etalocib 20-hydroxy-LTB< SC-41930 12R-HETE LY255283 arachidonic acid Zafirlukast ONO-4057 RO5101576 BILL 260 PENK Dopamine Naltrexone Accession Number: kainate Naloxone P01210 NMDA Progesterone DAMGO Morphine Htr2c Apomorphine Melatonin Accession Number: Bifeprunox SB 224289 P28335 Tramadol LY334362 AL-37350A FR260010 5-MeO-DMT Sulpiride BW723C86 Thiethylperazine CGS-12066 cyamemazine DOI Mesulergine 5-CT SB 221284 YM348 Zotepine LSD Metergoline xanomeline methiothepin WAY-163909 Spiperone Dopamine SB 215505 LY344864 Tiospirone VER-3323 SB 228357 TFMPP Pizotifen 8-OH-DPAT SB 206553 MK-212 SB 204741 NMDA SDZ SER-082 org 12962 Ritanserin 5-MeOT SB 242084 RU 24969 S33084 Acetylcholine Roxindole QUINPIROLE RS-127445 quipazine Terguride tryptamine EGIS-7625 Ro 60-0175 SB 243213 Oxymetazoline RS-102221 Ergotamine Olanzapine Cabergoline Aripiprazole Lorcaserin Agomelatine Pergolide Ziprasidone Methylergonovine Quetiapine Renzapride Sarpogrelate Pramipexole Perphenazine GR-127935 Thioridazine BRL-15572 Sertindole ipsapirone Loxapine SB 216641 Methysergide SL65.0155 Risperidone S 16924 Asenapine Bromocriptine Mianserin Lisuride Clozapine Tegaserod Trifluoperazine Epicept NP-1 Trazodone dapoxetine Doxepin Dexfenfluramine Nortriptyline 3,4- Chlorprothixene Methylenedioxymethamphetamine Ropinirole Minaprine Maprotiline Propiomazine Desipramine Mirtazapine Amoxapine Yohimbine Cyproheptadine Imipramine Amitriptyline Promazine Chlorpromazine Ketamine Propranolol Fluoxetine Ketanserin Mesulergine AC-90179 Ergoloid mesylate 2 Methotrimeprazine Paliperidone Clomipramine Trimipramine Captodiame Nefazodone GABA Receptor Bamaluzole bicuculline Accession Numbers GABA Metrazol (Q9UBS5, O95166, Gabamide Flumazenil O75899, P28472, P18507, GABOB Thiothixine P47870, P47869, O14764) Gaboxadol Bupropion Ibotenic acid Caffeine Isoguvacine Isonipecotic acid Muscimol Phenibut Picamilon Progabide Quisqualamine SL 75102 Thiomuscimol Alcohols (e.g., ethanol, isopropanol) Avermectins (e.g., ivermectin) Barbiturates (e.g., phenobarbital) Benzodiazepines Bromides (e.g., potassium bromide Carbamates (e.g., meprobamate, carisoprodol) Chloralose Chlormezanone Clomethiazole Dihydroergolines (e.g., ergoloid (dihydroergotoxine)) Etazepine Etifoxine Imidazoles (e.g., etomidate) Kavalactones (found in kava) Loreclezole Neuroactive steroids (e.g., allopregnanolone, ganaxolone) Nonbenzodiazepines (e.g., zaleplon, zolpidem, zopiclone, eszopiclone) Petrichloral Phenols (e.g., propofol) Piperidinediones (e.g., glutethimide, methyprylon) Propanidid Pyrazolopyridines (e.g., etazolate) Quinazolinones (e.g., methaqualone) Skullcap constituents Stiripentol Sulfonylalkanes (e.g., sulfonmethane, tetronal, trional) Valerian constituents (e.g., valeric acid, valerenic acid) Volatiles/gases (e.g., chloral hydrate, chloroform, diethyl ether, sevoflurane) Glutamate Receptor 3,5-dihydroxyphenylglycine APICA Accession Number: eglumegad EGLU (P42261, P39086, Biphenylindanone A LY-341, 495 P39086, Q13585, P42261, DCG-IV P42262, P42263, P48058, L-AP4 P39086, Q13002, Q13003, Q13003, Q16478, Q12879, Q14957, Q13224, Q14957, Q15399, Q8TCU5, O60391) CNR1/CNR2 N-Arachidonoylethanolamine SR 141716A Accession Number: 2-Arachidonoyl-glycerol LY-320135 (P21554, P34972) 2-Arachidonoyl-glycerylether AM251 N-Arachidonoyl-dopamine AM281 O-Arachidonoyl-ethanolamine SR 144528 N-Arachidonoylethanolamine AM630 2-Arachidonoyl-glycerol 2-Arachidonoyl-glycerylether N-Arachidonoyl-dopamine O-Arachidonoyl-ethanolamine -9-THC CP-55, 940 R(+)-WIN 55, 212-2 HU-210 Levonantradol Nabilone Methanandamide ACEA O-1812 9-THC CP-55, 940 R(+)-WIN 55, 212-2 HU-210 Levonantradol Nabilone Methanandamide JWH-015 JWH-133

    TABLE-US-00007 TABLE 6B ADRENERGIC AGONISTS AND ANTAGONISTS Receptor Agonist Antagonist Non-selective adrenaline (epinephrine), carvedilol, arotinolol, and labetalol noradrenaline (norepinephrine), isoprenaline (isoproterenol), dopamine, caffeine, nicotine, tyramine, methylphenidate, ephedrine and pseudophedrine. 1 selective phenylephrine, methoxamine, acepromazine, alfuzosin, doxazosin, (ADRA1A, midodrine, cirazoline, labetalol, phenoxybenzamine, ADRA1B, xylometazoline, KW3902, phentolamine, prazosin, ADRA1D) metaraminol tamsulosin, terazosin, tolazoline, chloroehtylclonidine, trazodone, amitriptyline, silodosin, oxymetazoline clomipramine, doxepin, trimipramine, typical and atypical antipsychotics, and antihistamines, such as hyroxyzine 2 selective -methyl dopa, clonidine, phentolamine, phenoxybenzamine, (ADRA2A, brimonidine, agmatine, yohimbine, idazoxan, atipamezole, ADRA2B, dexmedetomidine, mirtazapine, tolazoline, trazodone, ADRA2C) medetomidine, romifidine and typical and atypical chloroethylclonidine, antipsychotics detomidine, lofexidine, xylazine, tizanidine, guanfacine, and amitraz 1 selective Dobutamine metroprolol, atenolol, acebutolol, (ADRB1) bisoprolol, betaxolol, levobetaxolol, esmolol, celiprolol, carteolol, landiolol, oxprenolol, propanolol, practolol, penbutolol, timolol, labetalol, nebivolol, levobunolol, nadolol, pindolol, sotalol, metipranolol, tertatolol, vortioxene 2 selective salbutamol, albuterol, bitolterol butaxamine, acebutolol, timolol, (ADRB2) mesylate, levabuterol, ritodrine, propanolol, levobunolol, carteolol, metaproterenol, terbutaline, labetalol, pindolol, oxprenolol, salmeterol, formoterol, and pirbuterol nadolol, metipranolol, penbutolol, tertatolol, sotalol 3 selective L-796568, amibegron, solabegron, SR 59230A, arotinolol (ADRB3) mirabegron

    TABLE-US-00008 TABLE 6C DOPAMINE AGONISTS AND ANTAGONISTS Receptor Agonist Antagonist Non- pramipexole, ropinirole, haloperidol, paliperidone, clozapine, selective rotigotine, apomorphine, risperidone, olanzapine, quetiapine, propylnorapomorphine, ziprasidone, metoclopramide, bromocriptine, cabergoline, droperidol, domperidone, amoxapine, ciladopa, dihydrexidine, dinapsoline, clomipramine, trimipramine, choline, doxamthrine, epicriptine, lisuride, melatonin, acepromazine, amisulpride, pergolide, piribedil, quinagolide, asenapine, azaperone, benperidol, roxindole, dopamine bromopride, butaclamol, chlorpromazine, clebopride, chlorprothixene, clopenthixol, clocapramine, eticlopride, flupenthixol, fluphenazine, fluspirilene, hydroxyzine, itopride, iodobenzamide, levomepromazine, levosulpiride, loxapine, mesoridazine, metopimazine, mosapramine, nafadotride, nemonapride, penfluridol, perazine, perphenazine, pimozide, prochlorperazine, promazine, pipotiazine, raclopride, remoxipride, spiperone, spiroxatrine, stepholidine, sulpiride, sultopride, tetrahydropalmatine, thiethylperazine, thioridazine, thiothixene, tiapride, trifluoperazine, trifluperidol, triflupromazine, thioproperazine, taractan, zotepine, zuclopenthixol, ziprasidone, ANP-010, NGD-94-4 D1 (DRD1) Fenoldopam, A-86929, SCH-23,390, SKF-83,959, Ecopipam, dihydrexidine, dinapsoline, Clebopride, Flupenthixol, dinoxyline, doxanthrine, SKF- Zuclopenthixol, Taractan, PSYRX- 81297, SKF-82958, SKF-38393, 101, LuAF-35700, GLC-756, G-BR-APB, dopexamine ADX10061, Zicronapine D2 (DRD2) Cabergoline, pergolide, Chloroethylnorapomorphine, quinelorane, sumanirole, talipexole, desmethoxyfallypride, domperidone, piribedil, quinpirole, quinelorane, eticlopride, fallypride, hydroxyzine, dinoxyline, dopexamine itopride, L-741,626, SV 293, yohimbine, raclopride, sulpiride, paliperidone, penfluridol, quetiapine, lurasidone, risperidone, olanzapine, blonanserin, perphenazine, metoclopramide, trifluoperazine, clebopride, levosulpiride, flupenthixol, haloperidol, thioridazine, alizapride, amisulpride, asenapine, bromopride, bromperidol, clozapine, fluphenazine, perphanazine, loxapine, nemonapride, pericyazine, pipamperone, prochlorperazine, thioproperazine, thiethylperazine, tiapride, ziprasidone, zuclopenthixol, taractan, fluanisone, melperone, molindone, remoxipride, sultopride, ALKS 3831, APD-403, ONC201, pridopidine, DSP-1200, NG- 101, TAK-906, ADN-1184, ADN-2013, AG-0098, DDD-016, IRL-626, KP303, ONC-206, PF-4363467, PGW-5, CG- 209, ABT-925, AC90222, ACP-005, ADN-2157, CB030006, CLR-136, Egis-11150, Iloperidone, JNJ- 37822681, DLP-115, AZ-001, S-33138, SLV-314, Y-931, YKP1358, YK-P1447, APD405, CP-903397, ocaperidone, zicronapine, TPN-902 D3 (DRD3) Piribedil, quinpirole, captodiame, Domperidone, FAUC 365, nafadotride, compound R, R-16, FAUC 54, raclopride, PNU-99,194, SB-277011- FAUC 73, PD-128,907, PF-219,061, A, sulpiride, risperidone, YQA14, PF-592,379, CJ-1037, FAUC 460, U99194, SR 21502, levosulpiride, FAUC 346, cariprazine amisulpride, nemonapride, ziprasidone, taractan, sultopride, APD- 403, F17464, ONC201, NG-101, TAK- 906, ONC-206, PF-4363467, ABT- 127, ABT-614, GSK-598809, GSK- 618334, S-14297, S-33138, YKP1358, YK-P1447 D4 (DRD4) WAY-100635, A-412,997, ABT-724, A-381393, FAUC 213, L-745,870, ABT-670, FAUC 316, PD-168, 077, L-570,667, ML-398, fananserin, CP-226,269 clozapine, PNB-05, SPI-376, SPI-392, Lu-35-138, NGD-94-1 D5 (DRD5) Dihydrexidine, rotigotine, SCH 23390 SKF-83,959, fenoldopam, Partial aplindore, brexpiprazole, aripiprazole, CY-208,243, pardoprunox, phencyclidine, and salvinorin A

    TABLE-US-00009 TABLE 6D GABA AGONISTS AND ANTAGONISTS Receptor Agonist Antagonist GABA.sub.A barbiturates (e.g., allobarbital, bicuculline, gabazine, hydrastine, amobarbital, aprobarbital, alphenal, pitrazepin, sinomenine, tutin, barbital, brallobarbital, phenobarbital, thiocolchicoside, metrazol, secobarbital, thiopental), bamaluzole, securinine, gabazine GABA, GABOB, gaboxadol, ibotenic acid, isoguvacine, isonipecotic acid, muscimol, phenibut, picamilon, progabide, quisqualamine, SL 75102, thiomuscimol, positive allosteric modulators (PAMs) (e.g., alcohols, such as ethanol and isopropanol; avermectins, such as ivermectin; benzodiazepines, such as diazepam, alprazolam, chlordiazepoxide, clonazepam, flunitrazepam, lorazepam, midazolam, oxazepam, prazepam, brotizolam, triazolam, estazolam, lormetazepam, nitrazepam, temazepam, flurazepam, clorazepate halazepam, prazepam, nimetazapem, adinazolam, and climazolam; bromides, such as potassium bromide; carbamates, such as meprobamate and carisoprodol; chloralose; chlormezanone; chlomethiazole; dihydroergolines, such as ergoloid; etazepine; etifoxine; imidazoles, such as etomidate; imidazopyridines, such as alpidem and necopdiem; kavalactones; loreclezole; neuroactive steroids, such as allogregnanolone, pregnanolone, dihydrodeoxycorticosterone, tetrahydrodeoxycortisosterone, androstenol, androsterone, etiocholanolone, 3-androstanediol, 5, 5, or 3-dihydroprogesterone, and ganaxolone; nonbenzodiazepines, such as zalepon, zolpidem, zopiclone, and eszopiclone; petrichloral; phenols, such as propofol; piperidinediones, such as glutethimide and methyprylon; propanidid; pyrazolopyridines, such as etazolate; pyrazolopyrimidines, such as divaplon and fasiplon; cyclopyrrolones, sush as pagoclone and suproclone; -cabolines, such as abecarnil and geodecarnil; quinazolinones, such as methaqualone; Scutellaria constituents; stiripentol; sulfonylalkanes, such as sulfonomethane, teronal, and trional; Valerian constituents, such as valeric acid and valerenic acid; and gases, such as chloral hydrate, chloroform, homotaurine, diethyl ether, and sevoflurane. GABA.sub.B 1,4-butanediol, baclofen, GABA, CGP-35348, homotaurine, phaclofen, Gabamide, GABOB, gamma-butyrolactone, saclofen, and SCH-50911 gamma-hydroxybutyric acid, gamma-hyrdoxyvaleric acid, gamma-valerolactone, isovaline, lesogaberan, phenibut, picamilon, progabide, homotaurine, SL-75102, tolgabide GABA.sub.A-p CACA, CAMP, GABA, GABOB, gabazine, gaboxadol, isonipecotic N4-chloroacetylcytosine arabinoside, acid, SKF-97,541, and (1,2,5,6- picamilon, progabide, tolgabide, and Tetrahydropyridin-4- neuroactive steroids, such as yl)methylphosphinic acid allopregnanolone, THDOC, and alphaxol one

    TABLE-US-00010 TABLE 6E MUSCARINC AGONISTS AND ANTAGONISTS Receptor Agonist Antagonist Chrm1 AF102B, AF150(S), AF267B, atropine, dicycloverine, hyoscyamine, acetylcholine, carbachol, cevimeline, ipratropium, mamba toxin muscarinic muscarine, oxotremorine, toxin 7 (MT7), olanzapine, oxybutynin, pilocarpine, vedaclidine, 77-LH-28-1, pirenzepine, telenzepine, and CDD-0097, McN-A-343, tolterodine L689,660, and xanomeline Chrm2 acetylcholine, methacholine, iper-8- atropine, dicycloverine, hyoscyamine, naph, berbine, and (2S,2'R,3'S,5'R)- otenzepad, AQRA-741, AFDX-384, 1-methyl-2-(2-methyl-1,3-oxathiolan- thorazine, diphenhydramine, 5-yl)pyrrolidine 3-sulfoxide methyl dimenhydrinate, ipratropium, iodide oxybutynin, pirenzepine, methoctramine, tripitramine, gallamine, and tolterodine Chrm3 acetylcholine, bethanechol, atropine, dicycloverine, hyoscyamine, carbachol, L689, 660, oxotremorine, alcidium bromide, 4-DAMP, pilocarpine, aceclidine, arecoline, darifenacin, DAU-5884, HL-031,120, and cevimeline ipratropium, J-104,129, oxybutynin, tiotropium, zamifenacin, and tolterodine Chrm4 acetylcholine, carbachol, and AFDX-384, dicycloverine, himbacine, oxotremorine), and Chrm5 agonists mamba toxin 3, PD-102,807, (e.g., acetylcholine, milameline, PD-0298029, and tropicamide sabcomeline Chrm5 acetylcholine, milameline, VU-0488130, xanomeline sabcomeline Non-selective scopolamine, hydroxyzine, doxylamine, dicyclomine, flavoxate, cyclopentolate, atropine methonitrate, trihexyphenidyl/benzhexol, solifenacin, benzatropine, mebeverine, and procyclidine

    TABLE-US-00011 TABLE 6F NICOTINIC AGONISTS AND ANTAGONISTS Receptor Agonist Antagonist Chrna receptors choline, acetylcholine, carbachol, turbocurarine, bupropion, methacholine, nicotine, varenicline mecamylamine, 18- tartrate, galantamine hydrobromide, methozycoronaridine, suxamethonium chloride hexamethonium, trimethaphan, (succinylcholine chloride), atraciurium, doxacurium, mivacurium, epibatidine, iobeline, pancuronium, vecuronium, decamethonium, isopronicline/TC- succinylcholine, dextromethorphan, 1734/AZD3480 (TC-1734), AZD1446 neramexane, dextrophan, and 3- (TC-6683), TC-5619, TC-5214, MEM methoxymorphinan 3454 (RG3487), ABT-894, ABT-560, EVP-6124, EVP-4473, PNU-282987, AR-R17779, SSR 189711, JN403, ABBF, PHA-543613, SEN12333, GTS-21/DMXB-A, AZD0328, A- 582941, ABT-418, 5-iodo-A-85380, SIB-1765F, ABT-089, and ABT-594

    TABLE-US-00012 TABLE 6G SEROTONIN AGONISTS AND ANTAGONISTS Receptor Agonist Antagonist 5-HT.sub.1A azapirones, such as alnespirone, pindolol, tertatolol, alprenolol, AV- binosperone, buspirone, 965, BMY-7,378, cyanopindolol, enilospirone, etapirone, geprione, dotarizine, flopropione, GR-46,611, ipsaprione, revospirone, zalospirone, iodocyanopindolol, isamoltane, perospirone, tiosperone, lecozotan, mefway, methiothepin, umespirone, and tandospirone; 8- methysergide, MPPF, NAN-190, OH-DPAT, befiradol, F-15,599, oxprenolol, pindobind, propanolol, lesopitron, MKC-242, LY-283,284, risperidone, robalzotan, SB-649,915, osemozotan, repinotan U-92,016-A, SDZ-216,525, spiperone, spiramide, RU-24969, 2C-B, 2C-E, 2C-T-2, spiroxatrine, UH-301, WAY-100,135, aripiprazole, asenapine, bacoside, WAY-100,635, and xylamidine befiradol, brexpiprazole, bufotenin, cannabidiol, and fibanserin 5-HT.sub.1B triptans, such as sumatriptan, methiothepin, yohimbine, rizatriptan, eletriptan, donitripatn, metergoline, aripiprazole, isamoltane, almotriptan, frovatriptan, avitriptan, AR-A000002, SB-216,641, SB- zolmitriptan, and naratriptan; 224,289, GR-127,935, SB-236,057 ergotamine, 5- carboxamidotryptamine, CGS- 12066A, CP-93,129, CP-94,253, CP-122,288, CP-135,807, RU-24969, vortioxetine, ziprasidone, and asenapine 5-HT.sub.1D triptans, such as sumatriptan, ziprasidone, methiothepin, rizatriptan, and naratriptan; yohimbine, metergoline, ergotamine, ergotamine, 5-(nonyloxy)tryptaime, BRL-15572, vortioxetine, 5-(t-butyl)-N-methyltryptamine, GR-127,935, LY-310,762, LY-367,642, CP-286,601, PNU-109,291, PNU- LY-456,219, and LY-456,220 142,633, GR-46611, L-694,247, L-772,405, CP-122,288, and CP-135,807 5-HT.sub.1E BRL-54443, eletriptan 5-HT.sub.1F LY-334,370, 5-n-butyryloxy-DMT, BRL-54443, eletriptan, LY-344,864, naratriptan, and lasmiditan 5-HT.sub.2A 25I-NBOH, 25I-NBOMe, (R)-DOI, cyproheptadine, methysergide, TCB-2, mexamine, O-4310, PHA- quetiapine, nefazodone, olanzapine, 57378, OSU-6162, 25CN-NBOH, asenapine, pizotifen, LY-367,265, juncosamine, efavirenz, mefloquine, AMDA, hydroxyzine, 5-MeO-NBpBrT, lisuride, and 2C-B and niaprazine 5-HT.sub.2B fenfluramine, pergolide, cabergoline, agomelatine, aripiprazole, mefloquine, BW-723086, Ro60- sarpogrelate, lisuride, tegaserod, 0175, VER-3323, 6-APB, metadoxine, RS-127,445, SDZ SER- guanfacine, norfenfluramine, 5-MeO- 082, EGIS-7625, PRX-08066, SB- DMT, DMT, mCPP, aminorex, 200,646, SB-204,741, SB-206,553, chlorphentermine, MEM, MDA, LSD, SB-215,505, SB-228,357, LY- psilocin, MDMA 266,097, and LY-272,015 5-HT.sub.2C lorcaserin, lisuride, A-372,159, AL- agomelatine, CPC, eltoprazine, 38022A, CP-809,101, fenfluramine, etoperidone, fluoxetine, FR-260,010, mesulergine, MK-212, LU AA24530, methysergide, naphthyllisopropylamine, nefazodone, norfluoxetine, norfenfluramine, ORG-12,962, ORG- O-desmethyltramadol, RS-102,221, 37,684, oxaflozane, PNU-22395, SB-200,646, SB-221,284, SB-242,084, PNU-181731, lysergamides, SDZ SER-082, tramadol, and phenethylamines, piperazines, trazodone tryptamines, Ro60-0175, vabicaserin, WAY-629, WAY-161,503, WAY-163,909, and YM-348 5-HT.sub.2A/2C ketanserin, risperidone, trazodone, mirtazapine, clozapine 5-HT.sub.3 2-methyl-5-HT, alpha- dolasetron, granisetron, ondansetron, methyltryptamine, bufotenin, palonosetron, tropisetron, alosetron, chlorophenylbiguanide, ethanol, cilanosetron, mirtazapine, AS-8112, ibogaine, phenylbiguanide, bantopride, metroclopramide, quipazine, RS-56812, SR-57227, renzapride, zacopride, mianserin, varenicline, and YM-31636 vortioxetine, clozapine, olanzapine, quetiapine, menthol, thujone, lamotigrine, and 3-tropanyl indole-3-carboxylate 5-HT.sub.4 cisapride, tegaserod, prucalopride, piboserod, GR-113,808, GR- BIMU-8, CJ-033,466, ML-10302, 125,487, RS-39604, SB-203,186, mosapride, renzapride, RS-67506, SB-204,070, and chamomile RS-67333, SL65.1055, zacopride, metoclopramide, and sulpride 5-HT.sub.5A valeronic acid ASP-5736, AS-2030680, AS-2674723, latrepiridine, risperidone, and SB-699,551 5-HT.sub.6 EMDT, WAY-181,187, WAY- ALX-1161, AVN-211, BVT-5182, 208,466, N-(inden-5- BVT-74316, cerlapiridine, EGIS- yl)imidazothiazole- 12233, idalopiridine, interpridine, 5-sulfonamide, latrepiridine, MS-245, PRX-07034, E-6837, E-6801, and SB-258,585, SB-271,046, SB- EMD-386,088 357,134, SB-339,885, Ro 04-6790, Ro-4368554, sertindole, olanzapine, asenapine, clozapine, rosa rugosa extract, and WAY-255315 5-HT.sub.7 AS-19, 5-CT, 5-MeOT, amisulpride, amitriptyline, 8-OH-DAPT, amoxapine, clomipramine, clozapine, aripiprazole, E-55888, DR-4485, fluphenazine, fluperlapine, E-57431, LP-12, ICI 169,369, imipramine, ketanserine, LP-44, MSD-5a, RA-7, and JNJ-18038683, loxapine, lurasidone, N,N-Dimethyltryptamine LY-215,840, maprotiline, methysergide, mesulergine, mianserin, olanzepine, pimozide, ritanserin, SB-258,719, SB-258,741, SB-269,970, SB-656,104-A, SB- 691,673, sertindole, spiperone, tenilapine, TFMPP, vortioxetine, trifluoperazine, ziprasidone, and zotepine Non-selective chlorpromazine, cyproheptadine, 5-HT pizotifen, oxetorone, spiperone, antagonists ritanserin, parachlorophenylalanine, metergoline, propranolol, mianserin, carbinoxamine, methdilazine, promethazine, pizotifen, oxatomide, feverfew, fenclonin, and reserpine

    TABLE-US-00013 TABLE 6H GLUATAMATE RECEPTOR AGONISTS AND ANTAGONISTS Receptor Agonist Antagonist Ionotropic AMPA, glutamic acid, AP5, AP7, CPPene, selfotel, (GRIA-14, ibotenic acid, HU-211, Huperzine A, GRIK1-5 kainic acid, gabapentin, , and NMDA, remacemide, amantadine, GRIN1-3B) quisqualic acid atomoxetine, AZD6765, agmatine, chloroform, dextrallorphan, dextromethorphan, dextrorphan, diphenidine, dizocilpine (MK-801), ethanol, eticyclidine, gacyclidine, ibogaine, ifenprodil, ketamine, kynurenic acid, memantine, magnesium, methoxetamine, nitromemantine, nitrous oxide, PD-137889, perampanel, phencyclidine, rolicyclidine, tenocyclidine, methoxydine, tiletamine, neramexane, eliprodil, etoxadrol, dexoxadrol, WMS-2539, NEFA, delucemine, 8A-PDHQ, aptiganel, rhynchophylline Metabotropic L-AP4, ACPD, L-QA, AIDA, fenobam, MPEP, (GRM1-8) CHPG, LY-379,268, LY-367,385, EGLU, LY-354,740, ACPT, CPPG, MAP4, MSOP, VU0155041 LY-341,495 Glycine rapastinel, NRX-1074, 7- antagonists chlorokynurenic acid, 4- chlorokynurenine, 5,7- dichlorokynurenic acid, kynurenic acid, TK-40, 1-aminocyclopropanecarboxylic acid (ACPC), L-phenylalanine, and xenon

    TABLE-US-00014 TABLE 6I HISTAMINE AGONISTS AND ANTAGONISTS Receptor Agonist Antagonist Non-selective histamine dihydrochloride, HTMT dimaleate, 2-pyridylethlyamine dihydrochloride H.sub.1 acrivastine, azelastine, astemizole, bilastine, bromodiphenhydramine, brompheniramine, buclizine, carbinoxamine, cetirizine, cetirizine dihydrochloride, clemastine fumarate, clemizole hydrochloride, chlorodiphenhydramine, chlorphenamine, chlorpromazine, clemastine, cyclizine, cyproheptadine, dexbrompheniramine, dexchlorpheniramine, dimenhydrinate, dimethindene maleate, dimetindene, diphenhydramine, diphenhydramine hydrochloride, doxepin hydrochloride, doxylamine, ebastine, embramine, fexofenadine, fexofenadine hydrochloride, hydroxyzine, ketotifen fumarate, loratadine, meclizine, meclizine dihydrochloride, mepyramine maleate, mirtazapine, olopatadine, olopatadine hydrochloride, orphenadrine, phenindamine, pheniramine, phenyltoloxamine, promethazine, quetiapine, rupatadine, terfenadine, tripelennamine, zotepine, trans- triprolidine hydrochloride, and triprolidine H.sub.1 inverse cetirizine, levocetirizine, agonists desloratadine, and pyrilamine H.sub.2 betazole, impromidine, dimaprit aminopotentidine, cimetidine, dihydrochloride, and amthamine famotidine, ICI 162,846, lafutidine, dihyrdobromide nizatidine, ranitidine, ranitidine hyrdochloride, roxatidine, zolantadine dimaleate, and toitidine H.sub.3 imetit dihydropbromide, immepip clobenpropit, clobenpropit dihyrdrobromide, immethridine dihydrobromide, A 3314440 dihydrobromide, dihyrdochloride, BF 2649 a-Methylhistamine hydrochloride, carcinine dihydrobromide, ditrifluoroacetate, ABT-239, ciprofaxin, N-methylhistamine conessine, GT 2016, A-349,821, dihydrochloride, impentamine dihydrobromide, proxyfan oxalate, iodophenpropit dihydrobromide, JNJ and betahistine 10181457 dihydrochloride, JNJ 5207852 dihydrochloride, ROS 234 dioxalate, SEN 12333, VUF 5681 dihydrobromide, and thioperamide H.sub.4 imetit dihydropbromide, immepip thioperamide, JNJ 7777120, A 943931 dihyrdrobromide, 4-methylhistamine dihydrochloride, A 987306, JNJ dihydrochloride, clobenpropit 10191584 maleate, and VUF-6002 dihydrobromide, VUF 10460, and VUF 8430 dihydrobromide

    TABLE-US-00015 TABLE 6J CANNABINOID AGONISTS AND ANTAGONISTS Receptor Agonist Antagonist Cannabinoid receptor Anandamide, N-Arachidonoyl (non-selective) dopamine, 2-Arachidonoylglycerol (2-AG), 2-Arachidonyl glyceryl ether, -9-Tetrahydrocannabinol, EGCG, Yangonin, AM-1221, AM- 1235, AM-2232, UR-144, JWH-007, JWH-015, JWH-018_ACEA, ACPA, arvanil, CP 47497, DEA, leelamine, methanandamide, NADA, noladin ether, oleamide, CB 65, GP-1a, GP- 2a, GW 405833, HU 308, JWH-133, L-759,633, L-759,656, LEI 101, MDA 19, and SER 601 CB.sub.1 receptor ACEA, ACPA, RVD-Hp, (R)-(+)- rimonabant, cannabidiol, .sup.9- methanandamide tetrahydrocannabivarin (THCV), taranabant, otenabant, surinabant, rosonabant, SLV-319, AVE1625, V24343, AM 251, AM 281, AM 6545, hemopressin, LY 320135, MJ 15, CP 945598, NIDA 41020, PF 514273, SLV 319, SR 1141716A, and TC-C 14G CB.sub.2 receptor CB 65, GP 1a, GP 2a, GW 405833, cannabidiol, .sup.9- HU 308, JWH 133, L-759,656, L- tetrahydrocannabivarin (THCV), AM 759,633, SER 601, LEI 101 630, COR 170, JTE 907, and SR 144528

    TABLE-US-00016 TABLE 6K PURINERGIC RECEPTOR AGONISTS AND ANTAGONISTS Receptor Agonist Antagonist ADORA1 (P1 Adenosine, N6- Caffeine, theophylline, 8- adenosine receptor) Cyclopentyladenosine, N6-3- Cyclopentyl-1,3-dimethylxanthine methoxyl-4-hydroxybenzyl adenine (CPX), 8-Cyclopentyl-1,3- riboside (B2), CCPA, tecadenoson, dipropylxanthine (DPCPX), 8- selodenoson, Certain Phenyl-1,3-dipropylxanthine, Benzodiazepines and Barbiturates, bamifylline, BG-9719, BG09928, FK- 2-MeCCPA, GR 79236, and SDZ 453, FK838, rolofylline, N-0861, and WAG 994 PSB 36 ADORA2A (P1 Adenosine, N6-3-methoxyl-4- Caffeine, theophylline, istradefylline, adenosine receptor) hydroxybenzyl adenine riboside (B2), SCH-58261, SCH-442,416, ATL- YT-146, DPMA, UK-423,097, 444, MSX-3, preladenant, SCH- limonene, NECA, CV-3146, 412,348, VER-6623, VER-6947, binodenoson, ATL-146e, CGS- VER-7835, vipadenant, and ZM- 21680, and Regadenoson 241,385 ADORA2B (P1 Adenosine, 5-N- Caffeine, theophylline, CVT-6883, adenosine receptor) ethylcarboxamidoadenosine, BAY ATL-801, compound 38, MRS-1706, 60-6583, LUF-5835, NECA, (S)- MRS-1754, OSIP-339,391, PSB- PHPNECA, and LUF-5845 603, PSB-0788, and PSB-1115 ADORA3 (P1 Adenosine, 2-(1-Hexynyl)-N- Caffeine, theophylline, MRS-1191, adenosine receptor) methyladenosine, CF-101 (IB- MRS-1220, MRS-1334, MRS-1523, MECA), CF-102, 2-CI-IB-MECA, CP- MRS-3777, MRE3008F20, 532,903, inosine, LUF-6000, and MRE3005F20, OT-7999, MRS-3558 SSR161421, KF-26777, PSB-10, PSB-11, and VUF-5574 P2Y receptor ATP, ADP, UTP, UDP, UDP-glucose, clopidogrel, elinogrel, prasugrel, 2-methylthioladenosine 5 ticlopidine, ticagrelor, AR-C diphosphate (2-MeSADP), 118925XX, AR-C 66096, AR-C lysophosphatidic acid, PSB 1114, 69931, AZD 1283, MRS 2179, MRS PSB 0474, NF 546, MRS 2365, MRS 2211, MRS 2279, MRS 2500, MRS 2690, MRS 2693, MRS 2768, MRS 2578, NF 157, NF 340, PPADS, 2905, MRS 2957, MRS 4062, and PPTN hydrochloride, PSD 0739, denufosol (P2Y.sub.2 agonist) SAR 216471, and suramin P2X receptor ATP A 438079, A 740003, A 804598, A 839977, AZ 10606120, AZ 11645373, 5-BDBD, BX 430, Evans Blue, JNJ 47965567, KN-62, NF 023, NF 110, NF 157, NF 279, NF 449, PPADS, iso-PPADS, PPNDS, Ro 0437626, Ro 51, RO-3, TC-P 262, suramin, TNP-ATP, and P2X7 antagonists NF279, calmidazolium, and KN-62

    TABLE-US-00017 TABLE 7 NEUROTRANSMISSION MODULATORS Type Modulators Norepinephrine reuptake inhibitors amedalin, atomoxetine, CP-39,332, daledalin, (increase adrenergic neurotransmission) edivoxetine, esreboxetine, lortalamine, nisoxetine, reboxetine, talopram, talsupram, tandamine, viloxazine, bupropion, ciclazindol, manifaxine, maprotiline, radafaxine, tapentadol, teniloxazine, protriptyline, nortriptyline, and desipramine Norepineprhine-dopamine reuptake inhibitors amineptine, bupropion, desoxypipradrol, (increase adrenergic and dopamine dexmethylphenidate, difemetorex, diphenylprolinol, neurotransmission) ethylphenidate, fencamfamine, fencamine, lefetamine, methylenedioxypyrovalerone, methylphenidate, nomifensine, O-2172, oxolinic acid, pipradrol, prolintane, pyrovalerone, tametraline, and WY-46824 Serotonin-norepinephrine-dopamine reuptake mazindol, nefazodone, sibutramine, venlafaxine, inhibitors (SNDRIs) and serotonin-norepinephrine esketamine, duloxetine, ketamine, phencyclidine, reuptake inhibitors (SNRIs) tripelennamine, mepiprazole, amitifadine, AN788, (increase adrengergic, dopamine, and serotonin ansofaxine, centanafadine, atomoxetine, neurotransmission) desvenlafaxine, milnacipran, levomilnacipran, dasotraline, Lu AA34893, Lu AA37096, NS-2360, tedatioxetine, tesofensine, bicifadine, BMS- 866,949, brasofensine, diclofensine, DOV-216,303, EXP-561, liafensine, NS-2359, RG-7166, SEP- 227,162, SEP-228,425, SEP-228,432, naphyrone, 3,3-Diphenylcyclobutanamine, 3,4- Dichlorotametraline, D-161, desmethylsertraline, DMNPC, DOV-102,677, fezolamine, GSK1360707F, indatraline, JNJ-7925476, JZ-IV- 10, JZAD-IV-22, LR-5182, methylnaphthidate, MI-4, PRC200-SS, PRC050, PR0025, SKF-83,959, TP1, phenyltropanes (e.g., WF-23, dichloropane, and RTI-55), Ginkgo biloba extract, St John's Wort, hyperforin, adhyperforin, and uliginosin B Dopamine reuptake inhibitors Dopamine reuptake inhbiitors (e.g., altropane, (increase dopamine neurotransmission) amfonelic acid, amineptine, BTCP, 3C-PEP, DBL- 583, difluoropine, GBR-12783, GBR-12935, GBR- 13069, GBR-13098, GYKI-52895, lometopane, methylphenidate, ethylphenidate, modafinil, armodafinil, RTI-229, vanoxerine, adrafinil, benztropine, bupropion, fluorenol, medifoxamine, metaphit, rimcazole, venlafaxine, Chaenomeles speciosa, and oroxylin A), dopamine releasing agents (e.g., p-Tyramine), dextroamphetamine, lisdexamfetamine, dexmethylphenidate, and cathinone Dopamine prodrugs Levopoda, docarpamine (increase dopamine neurotransmission) GABA reuptake inhibitors CL-996, deramciclane, gabaculine, guvacine, (increase GABA neurotransmission) nipecotic acid, NNC-711, NNC 05-2090, SKF- 89976A, SNAP-5114, tiagabine, and hyperforin GABA analogs gabapentin, butyric acid, valproic acid, valpromide, (increase GABA neurotransmission) valnoctamide, 3-hydroxybutanal, GHB, sodium, oxybate, aceburic acid, GBL, GHBAL, GHV, GVL, GHC, GCL, HOCPCA, UMB68, pregabalin, tolibut, phaclofen, sacolfen, arecaidine, gaboxadol, isonipecotic acid, 3-Methyl-GABA, AABA, BABA, DAVA, GAVA, Glutamic acid, hopantenic acid, piracetam, and vigabatrin GABA prodrugs L-Glutamine, N-Isonicotinoyl-GABA, picamilon, (increase GABA neurotransmission) progabide, tolgabide Acetylcholinesterase inhibitors carbamates, physostigmine, neostigmine, (increase nicotinic and muscarinic pyridostigmine, ambenonium, demecarium, neurotransmission) rivastigmine, phenanthrene derivatives, galantamine, caffeine, rosmarinic acid, alpha- pinene, piperidines, donepezil, tacrine, edrophonium, Huperzine A, ladostigil, ungeremine, lactucopicrin, dyflos, echothiophate, parathion, and quasi-irreversible acetylcholinesterase inhibitors Serotonin reuptake inhibitors alaproclate, cericlamine, citalopram, dapoxetine, (increase serotonin neurotransmission) escitalopram, femoxetine, fluoxetine, fluvoxamine, ifoxetine, indalpine, omiloxetine, panuramine, paroxetine, pirandamine, RTI-353, sertraline, zimelidine, desmethylcitalopram, didesmethylcitalopram, seproxetine ((S)- norfluoxetine), desvenlafaxine, cianopramine, litoxetine, lubazodone, SB-649,915, trazodone, vilazodone, vortioxetine, dextromethorphan, dextropropoxyphene, dimenhydrinate, diphenhydramine, mepyramine (pyrilamine), mifepristone, delucemine, mesembrenone, mesembrine, roxindole, duloxetine, levomilnacipran, milnacipran, dapoxetine, sibutramine, chlorpheniramine, dextropmethorphan, and methadone Serotonin releasing agents chlorphentermine, cloforex, dexfenfluramine, (increase serotonin neurotransmission) etolorex, fenfluramine, flucetorex, indeloxazine, levofenfluramine, tramadol, carbamazepine, amiflamine (FLA-336), viqualine (PK-5078), 2- Methyl-3,4-methylenedioxyamphetamine (2-Methyl- MDA), 3-Methoxy-4-methylamphetamine (MMA), 3- Methyl-4,5-methylenedioxyamphetamine (5-Methyl- MDA), 3,4-Ethylenedioxy-N-methylamphetamine (EDMA), 4-Methoxyamphetamine (PMA), 4- Methoxy-N-ethylamphetamine (PMEA), 4-Methoxy- N-methylamphetamine (PMMA), 4- Methylthioamphetamine (4-MTA), 5-(2- Aminopropyl)-2,3-dihydrobenzofuran (5-APDB), 5- Indanyl-2-aminopropane (IAP), 5-Methoxy-6- methylaminoindane (MMAI), 5-Trifluoromethyl-2- aminoindane (TAI), 5,6-Methylenedioxy-2- aminoindane (MDAI), 5,6-Methylenedioxy-N- methyl-2-aminoindane (MDMAI), 6-Chloro-2- aminotetralin (6-CAT), 6-Tetralinyl-2-aminopropane (TAP), 6,7-Methylenedioxy-2-aminotetralin (MDAT), 6,7-Methylenedioxy-N-methyl-2-aminotetralin (MDMAT), N-Ethyl-5-trifluoromethyl-2-aminoindane (ETAI), N-Methyl-5-indanyl-2-aminopropane, aminorex, MDMA, MDEA, MDA, MBDB, and tryptamines, such as DMT, MT, 5MeO-NMT, NMT, NETP, Dimethyl-Serotonin, 5MeO-NET, ET and MT Excitatory amino acid reuptake inhibitors didydrokanic acid, WAY-213,613, L-trans-2,4-PDC, (increase Glutamate receptor neurotransmission) amphetamine, and L-Theanine Glycine reuptake inhibitors bitopertin, Org 24598, Org 25935, ALX-5407, (increase Glutamate receptor neurotransmission) sacrosine, Org 25543, and N-arachidonylglycerine Histidine decarboxylase inhibitors Tritoqualine, catechin (decrease histamine neurotransmission) Endocannabinoid enhancers AM404, fatty acid amide hydrolase inhibitors (e.g., (increase cannabinoid neurotransmission) AM374, ARN2508, BIA 10-2472, BMS-469908, CAY-10402, JNJ-245, JNJ-1661010, JNJ- 28833155, JNJ-40413269, JNJ-42119779, JNJ- 42165279, MK-3168, MK-4409, MM-433593, OL- 92, OL-135, PF-622, PF-750, PF-3845, PF- 04457845, PF-04862853, RN-450, SA-47, SA-73, SSR-411298, ST-4068, TK-25, URB524, URB597, URB694, URB937, VER-156084, and V-158866 Monoacylglycerol lipase inhibitors N-arachidonoyl maleimide, JZL184 (increase cannabinoid neurotransmission) Endocannabinoid transporter inhibitors SB-FI-26 (increase cannabinoid neurotransmission) Endocannabinoid reuptake inhibitors AM404, AM1172, LY-2183240, O-2093, OMDM-2, (increase cannabinoid neurotransmission) UCM-707, VDM-11, guineensine, ETI-T-24_B_I, WOBE437, and RX-055 Adenosine uptake inhibitors cilostazol, dilazep, and dipyramidole (increase purinergic neurotransmission) Nucleoside transporter inhibitors 8MDP, Decynium 22, 5-iodotubercidin, NBMPR, (increase purinergic neurotransmission) and TC-T 6000

    [0262] In some embodiments, the neurotransmission modulator is a neurotoxin listed in Table 8, or a functional fragment or variant thereof. Neurotoxins include, without limitation, convulsants, nerve agents, parasympathomimetics, and uranyl compounds. Neurotoxins may be bacterial in origin, or fungal in origin, or plant in origin, or derived from a venom or other natural product. Neurotoxins may be synthetic or engineered molecules, derived de novo or from a natural product. Suitable neurotoxins include but are not limited to botulinum toxin and conotoxin. Exemplary neurotoxins are listed in Table 8.

    TABLE-US-00018 TABLE 8 NEUROTOXINS 2,4,5-Trihydroxyamphetamine 2,4,5-Trihydroxymethamphetamine 3,4-Dichloroamphetamine 5,7-Dihydroxytryptamine 5-Iodowillardiine Ablomin Aconitine Aconitum Aconitum anthora AETX Agelenin Agitoxin Aldrin Alpha-Methyldopamine Alpha-neurotoxin Altitoxin Anatoxin-a Androctonus australis hector insect toxin Anisatin Anthopleurin Antillatoxin Anuroctoxin Apamin Arum italicum Arum maculatum Babycurus toxin 1 Batrachotoxin BDS-1 Bestoxin Beta-Methylamino-L-alanine BgK Birtoxin BmKAEP BmTx3 BotIT2 BotIT6 Botulinum toxin Brevetoxin Bukatoxin Butantoxin Calcicludine Calciseptine Calitoxin Caramboxin Carbon disulfide CgNa toxin Charybdotoxin Cicutoxin Ciguatoxin CII1 Clostridium botulinum Conantokins Conhydrine Coniine Conotoxin Contryphan CssII CSTX Curare Cyanide poisoning Cylindrospermopsin Cypermethrin Delta atracotoxin Dendrotoxin Dieldrin Diisopropyl fluorophosphates Dimethylmercury Discrepin Domoic acid Dortoxin DSP-4 Ergtoxin Falcarinol Fenpropathrin Gabaculine Ginkgotoxin Grammotoxin Grayanotoxin Hainantoxin Halcurin Hefutoxin Helothermine Heteroscodratoxin-1 Histrionicotoxin Homoquinolinic acid Hongotoxin Huwentoxin Ibotenic acid Ikitoxin inhibitor cystine knot Jingzhaotoxin Kainic acid Kaliseptine Kappa-bungarotoxin Kodaikanal mercury poisoning Kurtoxin Latrotoxin Lq2 Maitotoxin Margatoxin Maurotoxin Mercury (element) Methanol Meth iocarb MPP+ MPTP Nemertelline Neosaxitoxin Nicotine N-Methylconiine Oenanthotoxin Oxalyldiaminopropionic acid Oxidopamine Oxotoxin Pahutoxin Palytoxin Pandinotoxin Para-Bromoamphetamine Para-Chloroamphetamine Para-Chloromethamphetamine Para-lodoamphetamine Penitrem A Phaiodotoxin Phenol Phoneutria nigriventer toxin-3 Phrixotoxin Polyacrylamide Poneratoxin Psalmotoxin Pumiliotoxin Quinolinic acid Raventoxin Resiniferatoxin Samandarin Saxitoxin Scyllatoxin Sea anemone neurotoxin Slotoxin SNX-482 Stichodactyla toxin Taicatoxin Taipoxin Tamapin Tertiapin Tetanospasmin Tetraethylammonium Tetramethylenedisulfotetramine Tetrodotoxin Tityustoxin Tricresyl phosphate TsIV Vanillotoxin Veratridine

    [0263] Antibodies

    [0264] Neurotransmission modulators also include antibodies that bind to neurotransmitters or neurotransmitter receptors listed in Tables 4 and 5 and decrease neurotransmission. These antibodies include blocking and neutralizing antibodies. Antibodies to neurotransmitters or neurotransmitter receptors listed in Tables 4 and 5 can be generated by those of skill in the art using well established and routine methods.

    [0265] Neuronal Growth Factor Modulator

    [0266] In some embodiments, the calcitonin receptor inhibitor is administered with a neuronal growth factor modulator (e.g., an agent that decreases or increases neurogenic/axonogenic signals, e.g., a neuronal growth factor or neuronal growth factor mimic, or an agonist or antagonist of a neuronal growth factor or neuronal growth factor receptor). For example, the neuronal growth factor modulator is a neuronal growth factor listed in Table 9, e.g., a neuronal growth factor having the sequence referenced by accession number or Entrez Gene ID in Table 9, or an analog thereof, e.g., a sequence having at least 75%, 80%, 85%, 90%, 90%, 98%, 99% identity to the sequence referenced by accession number or Entrez Gene ID in Table 9. Neuronal growth factor modulators also include agonists and antagonists of neuronal growth factors and neuronal growth factor receptors listed in Table 9. A neuronal growth factor modulator may increase or decrease neurogenesis, neuronal growth, neuronal differentiation, neurite outgrowth, synapse formation, synaptic maturation, synaptic refinement, or synaptic stabilization. Neuronal growth factor modulators regulate tissue innervation (e.g., innervation of a lymph node or site of inflammation) and the formation of synaptic connections between two or more neurons and between neurons and non-neural cells (e.g., between neurons and immune cells). A neuronal growth factor modulator may block one or more of these processes (e.g., through the use of antibodies that block neuronal growth factors or their receptors) or promote one or more of these processes (e.g., through the use of neuronal growth factors or analogs thereof). Neuronal growth factor modulators can increase or decrease one of the above-mentioned processes by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 200%, 500% or more.

    [0267] In some embodiments, the neuronal growth factor modulator is one that increases neurogenic/axonogenic signals, e.g., the method includes administering to the subject or contacting a cell with a neuronal growth factor modulator in an amount and for a time sufficient to increase neurogenesis or axonogenesis. For example, the neuronal growth factor modulator that leads to an increase in neurogenesis or axonogenesis is a neurotrophic factor. Relevant neurotrophic factors include NGF, BDNF, ProNGF, Sortilin, TGF and TGF family ligands and receptors (e.g., TGFR1, TGFR2, TGF1, TGF2 TGF4), GFR family ligands and receptors (e.g., GFR1, GFR2, GFR3, GFR4, GDNF), CNTF, LIF, neurturin, artemin, persephin, neurotrophin, chemokines, cytokines, and others listed in Table 9. Receptors for these factors may also be targeted, as well as downstream signaling pathways including Jak-Stat inducers, and cell cycle and MAPK signaling pathways. In some embodiments, the neuronal growth factor modulator increases neurogenesis, axonogenesis or any of the processes mentioned above by administering, locally delivering, or stabilizing a neuronal growth factor listed in Table 9, or by upregulating, agonizing, or stabilizing a neuronal growth factor receptor listed in Table 9. In some embodiments, the neuronal growth factor modulator increases neurogenesis, axonogenesis or any of the processes mentioned above by stabilizing, agonizing, overexpressing, or upregulating a signaling protein encoded by a gene that is downstream of a neuronal growth factor. In some embodiments, the neuronal growth factor modulator increases neurogenesis, axonogenesis or any of the processes mentioned above by stabilizing, overexpressing, or upregulating a synaptic or structural protein. Neurogenesis, axonogenesis, neuronal growth, neuronal differentiation, neurite outgrowth, synapse formation, synaptic maturation, synaptic refinement, or synaptic stabilization can be increased in the subject at least 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 50%, 60%, 70%, 80% or more, compared to before the administration. Neurogenesis, axonogenesis, neuronal growth, neuronal differentiation, neurite outgrowth, synapse formation, synaptic maturation, synaptic refinement, or synaptic stabilization can be increased in the subject between 5-20%, between 5-50%, between 10-50%, between 20-80%, between 20-70%.

    [0268] In some embodiments, the neuronal growth factor modulator decreases neurogenic/axonogenic signals, e.g., the method includes administering to the subject or contacting a cell with a neuronal growth factor modulator in an amount and for a time sufficient to decrease neurogenesis, axonogenesis, or innervation. For example, the neuronal growth factor modulator that leads to a decrease in neurogenesis or axonogenesis is a blocking or neutralizing antibody against a neurotrophic factor. Relevant neurotrophic factors include NGF, BDNF, ProNGF, Sortilin, TGF and TGF family ligands and receptors (e.g., TGFR1, TGFR2, TGF1, TGF2 TGF4), GFR family ligands and receptors (e.g., GFR1, GFR2, GFR3, GFR4, GDNF), CNTF, LIF, neurturin, artemin, persephin, neurotrophin, chemokines, cytokines, and others listed in Table 9. Receptors for these factors can also be targeted, as well as downstream signaling pathways including Jak-Stat inducers, and cell cycle and MAPK signaling pathways. In some embodiments, the neuronal growth factor modulator decreases neurogenesis, axonogenesis or any of the processes mentioned above by sequestering, blocking, antagonizing, degrading, or downregulating a neuronal growth factor or a neuronal growth factor receptor listed in Table 9. In some embodiments, the neuronal growth factor modulator decreases neurogenesis, axonogenesis or any of the processes mentioned above by blocking or antagonizing a signaling protein that is downstream of a neuronal growth factor. In some embodiments, the neuronal growth factor modulator decreases neurogenesis, axonogenesis or any of the processes mentioned above by blocking, disrupting, or antagonizing a synaptic or structural protein. Neurogenesis, axonogenesis, neuronal growth, neuronal differentiation, neurite outgrowth, synapse formation, synaptic maturation, synaptic refinement, synaptic stabilization, or tissue innervation can be decreased in the subject at least 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 50%, 60%, 70%, 80% or more, compared to before the administration. Neurogenesis, axonogenesis, neuronal growth, neuronal differentiation, neurite outgrowth, synapse formation, synaptic maturation, synaptic refinement, synaptic stabilization, or tissue innervation can be decreased in the subject between 5-20%, between 5-50%, between 10-50%, between 20-80%, between 20-70%. Neuronal growth factor blockers can be administered in any of the modalities described herein (e.g., antibody, small molecule, nucleic acid, polypeptide, or viral vector).

    [0269] In some embodiments, the neuronal growth factor modulator decreases the number of nerves in an affected tissue (e.g., a lymph node or site of inflammation). For example, the neuronal growth factor blocker is administered in an amount and for a time sufficient to decrease neurogenesis/axonogenesis.

    [0270] Neuronal growth factor blockers include antibodies that bind to neuronal growth factors or neuronal growth factor receptors and decrease their signaling (e.g., blocking antibodies). Exemplary neuronal growth factor blocking antibodies are listed below in Table 10. Antibodies to neuronal growth factors listed in Table 9 can also be generated by those of skill in the art using well established and routine methods.

    TABLE-US-00019 TABLE 9 NEURONAL GROWTH FACTORS Accession Entrez Gene Type Number Gene ID ARTN Ligand Q5T4W7 9048 BDNF Ligand P23560 627 BDNF-AS Ligand 497258 BEX1 Signaling Q9HBH7 55859 BEX3 Signaling Q00994 27018 CD34 Receptor P28906 947 CDNF Ligand Q49AH0 441549 CNTF Ligand P26441 1270 CNTFR Receptor P26992 1271 CRLF1 Receptor O75462 9244 CSPG5 Ligand O95196 10675 DCLK1 Signaling O15075 9201 DISC1 Signaling Q9NRI5 27185 DNAJC5 Signaling Q9H3Z4 80331 DPYSL2 Signaling Q16555 1808 DVL1 Signaling O14640 1855 EFNA5 Ligand P52803 1946 EGR3 Signaling Q06889 1960 ENO2 Signaling P09104 2026 EphA1 Receptor P21709 2041 EphA10 Receptor Q5JZY3 284656 EphA2 Receptor P29317 1969 EphA3 Receptor P29320 2042 EphA4 Receptor P29317 2043 EphA5 Receptor P54756 2044 EphA6 Receptor Q9UF33 285220 EphA7 Receptor Q15375 2045 EphA8 Receptor P29322 2046 EphB1 Receptor P54762 2047 EphB2 Receptor P29323 2048 EphB3 Receptor P54753 2049 EphB4 Receptor P54760 2050 EphB6 Receptor O15197 2051 ETBR2 Receptor O60883 9283 FSTL4 Receptor Q6MZW2 23105 GDNF Ligand P39905 2668 GFRA1 Receptor P56159 2674 GFRA2 Receptor O00451 2675 GFRA3 Receptor O60609 2676 GFRA4 Receptor Q9GZZ7 64096 GPR37 Receptor O15354 2861 GPRIN1 Signaling Q7Z2K8 114787 GPRIN2 Signaling O60269 9721 GPRIN3 Signaling Q6ZVF9 285513 GRB2 Signaling P62993 2885 GZF1 Signaling Q9H116 64412 IFNA1 Ligand P01562 3439 IGF1 Ligand P05019 3479 IGF2 Ligand P01344 3481 IL11RA Receptor Q14626 3590 IL1B Ligand P01584 3553 IL3 Ligand P08700 3562 IL4 Ligand P05112 3565 IL6 Ligand P05231 3569 IL6R Receptor P08887 3570 IL6ST Signaling P40189 3572 INS Ligand P01308 3630 L1CAM Signaling P32004 3897 LIF Ligand P15018 3976 LIFR Receptor P42702 3977 MAGED1 Signaling Q9Y5V3 9500 MANF Ligand P55145 7873 NDNF Ligand Q8TB73 79625 NENF Ligand Q9UMX5 29937 NENFP1 Ligand 106480294 NENFP2 Ligand 100129880 NENFP3 Ligand 106481703 NGF Ligand P01138 4803 NGFR Receptor P08138 4804 NRG1 Ligand Q02297 3084 NRP1 Receptor O14786 8829 NRTN Ligand Q99748 902 NTF3 Ligand P20783 4908 NTF4 Ligand P34130 4909 NTRK1 Receptor P04629 4914 NTRK2 Receptor Q16620 4915 NTRK3 Receptor Q16288 4916 PDPK1 Signaling O15530 5170 PEDF Ligand P36955 5176 PLEKHH3 Signaling Q7Z736 79990 PSAP Ligand P07602 5660 PSEN1 Signaling P49768 5663 PSPN Ligand O70300 5623 PTN Ligand P21246 5764 RELN Ligand P78509 5649 RET Signaling P07949 5979 ROR1 Receptor Q01973 4919 ROR2 Receptor Q01974 4920 RPS6KA3 Signaling P51812 6197 SDC3 Receptor O75056 9672 SEMA3E Ligand O15041 9723 SERPINE2 Ligand P07093 5270 SERPINF1 Ligand P36955 5176 SHC1 Signaling P51812 6464 SNTG1 Biosynthesis P07602 54212 SORCS1 Receptor O75056 114815 SORCS2 Receptor O15041 57537 SORCS3 Receptor P07093 22986 SORT1 Receptor Q99523 6272 SULF1 Signaling Q8IWU6 23213 SULF2 Signaling Q8IWU5 55959 TGFB1 Ligand P01137 7040 TGFB2 Ligand P61812 7042 TGFB3 Ligand P10600 7043 TMEM158 Receptor Q8WZ71 25907 TNF Ligand P01375 7124 TPM3 Receptor P06753 7170 VEGFA Ligand P15692 7422 VEGFB Ligand P49765 7423 VGF Ligand O15240 7425 XCR1 Receptor P46094 2829 ZN274 Signaling Q96G06 10782

    TABLE-US-00020 TABLE 10 NEURONAL GROWTH FACTOR ANTIBODIES Neuronal Growth Factor Antibody Company BDNF 3868 (agonist antibody) Pfizer BDNF 29D7 (agonist antibody) Pfizer EphA3 KB004 KaloBios Pharmaceuticals, Inc. IFNA1 Faralimomab Creative Biolabs IFNA1 Sifalimumab (MEDI-545) MedImmune IFNA1 Rontalizumab Genentech IGF Figitumumab (CP-751,871)-an Pfizer IGR-1R MAb IGF SCH717454 (Robatumamab, Merck inhibits IGF initiated phosphorylation) IGF Cixutumumab (IGF-1R antibody) Eli Lilly IGF Teprotumumab (IGF-1R blocking Genmab/Roche antibody) IGF-2 Dusigitumab MedImmune/AstraZeneca IGF-2 DX-2647 Dyax/Shire IGF Xentuzumab Boehringer Ingelheim/Eli Lilly IGF Dalotuzumab (IGFR1 blocking Merck & Co. antibody) IGF Figitumumab (IGFR1 blocking Pfizer antibody) IGF Ganitumab (IGFR1 blocking Amgen antibody) IGF Robatumumab (IGFR1 blocking Roche/Schering-Plough antibody) IL1B Canakinumab Novartis IL1B APX002 Apexigen IL1B Gevokizumab XOMA IL4 Pascolizumab GlaxoSmithKline IL4 Dupilumab Regeneraon/Sanofi IL6 Siltuximab Janssen Biotech, Inc. IL6 Olokizumab UCB/R-Pharm IL6 Elsilimomab Orphan Pharma International IL6 Sirukumab Centocor IL6 Clazakizumab Bristol Myers Squib/Alder Biopharmaceuticals IL6 Gerilimzumab (ARGX-109) arGEN-X/RuiYi IL6 FE301 Ferring Pharmaceuticals IL6 FM101 Femta Pharmaceuticals IL-6R Sarilumab (directed against IL6R) Regeneron/Sanofi IL-6R Tocilizumab Hoffmann-La Roche/Chugai IL-6R Sapelizumab Chugai IL-6R Vobarilizumab Ablynx L1CAM AB417 Creative biolabs L1CAM L1-9.3 Creative biolabs L1CAM L1-14.10 Biolegend NGF Tanezumab Pfizer NGF Fulranumab (JNJ-42160443), Amgen NGF MNAC13 (anti-TrkA, the NGF Creative Biolabs receptor) NGF mAb 911 Rinat/Pfizer NGF Fasinumab Regeneron/Teva NRG1 538.24 Hoffman-La Roche NRP1 Vesencumab Genentech/Roche ROR1 Cirmtuzumab Oncternal Therapeutics SAP GSK2398852 GlaxoSmithKline TGF Fresolimumab (pan-TGF Genzyme/Aventis antibody) TGF IMC-TR1 (LY3022859) (MAb Eli Lilly against TGFRII) TGF TM1 (anti-TGF1 MAb) Eli Lilly TGF2 Lerdelimumab (CAT-152) Genzyme TGF1 Metelimumab Genzyme TGF1 LY2382770 Eli Lilly TGF PF-03446962 (MAb against Pfizer TGFRI) TNF Infliximab Janssen Biotech, Inc. TNF Adalimumab AbbVie Inc. TNF Certolizumab pegol UCB TNF Golimumab Janssen Biotech, Inc. TNF Afelimomab TNF Placulumab Teva Pharmaceutical Industries, Inc. TNF Nerelimomab Chiron/Celltech TNF Ozoralizumab Pfizer/Ablynx VEGFA Bevacizumab Genentech VEGFA Ranibizumab Genentech VEGF Alacizumab pegol (anti-VEGFR2) UCB VEGFA Brolucizumab Novartis VEGF Icrucumab (anti-VEGFR1) Eli Lilly VEGF Ramucirumab (anti-VEGFR2) Eli Lilly

    [0271] Neuronal growth factor modulators also include agents that agonize or antagonize neuronal growth factors and neuronal growth factor receptors. For example, neuronal growth factor modulators include TNF inhibitors (e.g., etanercept, thalidomide, lenalidomide, pomalidomide, pentoxifylline, bupropion, and DOI), TGF1 inhibitors, (e.g., disitertide (P144)), TGF2 inhibitors (e.g., trabedersen (AP12009)). Exemplary neuronal growth factor agonists and antagonists are listed in Table 11.

    TABLE-US-00021 TABLE 11 NEURONAL GROWTH FACTOR AGONISTS AND ANTAGONISTS Agonist Antagonist TrkA NGF, amitriptyline, and ALE-0540 gambogic amide, gambogic acid TrkB BDNF, NT3, NT4, 3,7- ANA-12, Dihydroxyflavone, cyclotraxin B, and 3,7,8,2- gossypetin Tetrahydroxyflavone, 4- Dimethylamino-7,8- dihydroxyflavone, 7,3- Dihydroxyflavone, 7,8- Dihydroxyflavone, 7,8,2- Trihydroxyflavone, 7,8,3- Trihydroxyflavone, Amitriptyline, Deoxygedunin, Diosmetin, HIOC, LM22A-4, N- Acetylserotonin, Norwogonin (5,7,8-THF), R7, LM22A4, and TDP6 Pan-Trk entrectinib receptor (RXDX-101), AG 879, GNF 5837, GW 441756, and PF 06273340 GFR1R GDNF and XIB4035 VEGF AEE 788, AG 879, receptor AP 24534, axitinib, DMH4, GSK 1363089, Ki 8751, RAF 265, SU 4312, SU 5402, SU 5416, SU 6668, sunitinib, toceranib, vatalanib, XL 184, ZM 306416, and ZM 323881 TGFRI galunisertib (LY2157299), TEW-7197, SB-431542, A 83-01, D 4476, GW 788388, LY 364947, R 268712, RepSox, SB 505124, SB 525334, and SD 208

    [0272] In any of the combination therapy approaches described herein, the first and second therapeutic agent (e.g., a calcitonin receptor activator described herein and the additional therapeutic agent) are administered simultaneously or sequentially, in either order. The first therapeutic agent may be administered immediately, up to 1 hour, up to 2 hours, up to 3 hours, up to 4 hours, up to 5 hours, up to 6 hours, up to 7 hours, up to, 8 hours, up to 9 hours, up to 10 hours, up to 11 hours, up to 12 hours, up to 13 hours, 14 hours, up to hours 16, up to 17 hours, up 18 hours, up to 19 hours up to 20 hours, up to 21 hours, up to 22 hours, up to 23 hours up to 24 hours or up to 1-7, 1-14, 1-21 or 1-30 days before or after the second therapeutic agent.

    Diagnosis and Prognosis of Calcitonin Receptor-Associated Inflammatory or Autoimmune Diseases or Conditions

    [0273] The methods described herein include methods of diagnosing or identifying patients with a calcitonin receptor-associated inflammatory or autoimmune disease or condition. Subjects who can be diagnosed or identified as having a calcitonin receptor-associated inflammatory or autoimmune disease or condition are subjects who have an inflammatory or autoimmune disease or condition (e.g., subjects identified as having an inflammatory or autoimmune disease or condition), or subjects suspected of having an inflammatory or autoimmune disease or condition. Subjects can be diagnosed or identified as having a calcitonin receptor-associated inflammatory or autoimmune disease or condition based on screening of patient samples (e.g., immune cells collected from a subject, e.g., macrophages). Calcitonin receptor expression (e.g., expression of CALCR and/or RAMP1) can be assessed in a sample of immune cells isolated from a subject using standard techniques known in the art, such as immunohistochemistry, western blot analysis, quantitative RT-PCR, RNA sequencing, fluorescent in situ hybridization, cDNA microarray, and droplet digital PCR. Calcitonin receptor expression (e.g., expression of CALCR and/or RAMP1) can be assessed by comparing measurements obtained from immune cells collected from a subject having or suspected of having an inflammatory or autoimmune disease or condition to measurements of calcitonin receptor expression obtained from a reference sample (e.g., immune cells of the same type collected from a subject that does not have an inflammatory or autoimmune disease or condition or a cell that does not express calcitonin receptors, e.g., a HEK cell). Reference samples can be obtained from healthy subjects (e.g., subjects without an inflammatory or autoimmune disease or condition), or they can be obtained from databases in which average measurements of calcitonin receptor expression (e.g., expression of CALCR and/or RAMP1) are cataloged for immune cells from healthy subjects (e.g., subjects without an inflammatory or autoimmune disease or condition).

    [0274] Subjects are diagnosed or identified as having a calcitonin receptor-associated inflammatory or autoimmune disease or condition if calcitonin receptor expression (e.g., expression of CALCR and/or RAMP1) is decreased in the sample of immune cells from the subject compared to the reference sample. A decrease of calcitonin receptor expression of 1.1-fold or more (e.g., 1.1, 1.2, 1.3, 1.4, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 6.0, 7.0, 8.0, 9.0, 10.0-fold or more) in the inflammatory or autoimmune disease or condition sample compared to the reference indicates that the subject has a calcitonin receptor-associated inflammatory or autoimmune disease or condition. Subjects can also be diagnosed or identified as having a calcitonin receptor-associated inflammatory or autoimmune disease or condition (e.g., an inflammatory or autoimmune disease or condition in which a calcitonin receptor is functional in immune cells) by contacting (e.g., incubating) an immune cell (e.g., a macrophage) isolated from the subject with a calcitonin receptor activator (e.g., agonist) and evaluating immune cell cytokine production. A decrease in pro-inflammatory cytokine production (e.g., IFN or IL6 release) by 10% or more (e.g., 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 99%, or more) indicates that the immune cell expresses a function calcitonin receptor (e.g., the subject has a calcitonin receptor-associated inflammatory or autoimmune disease or condition). Subjects diagnosed or identified as having a calcitonin receptor-associated inflammatory or autoimmune disease or condition can be treated with the methods and compositions described herein (e.g., calcitonin receptor activators). Subjects with an autoimmune or inflammatory disease or condition can also be treated with the methods and compositions described herein if an immune cell from the subject (e.g., a macrophage) is found to express a calcitonin receptor (e.g., CALCR and/or RAMP1).

    [0275] The methods described herein also include methods of predicting patient response (e.g., the response of an inflammatory or autoimmune disease or condition in a subject) to calcitonin receptor activators in order to determine whether calcitonin receptor activators can be used for treatment of an inflammatory or autoimmune disease or condition. In some embodiments, a sample (e.g., an immune cell or tissue sample) is isolated from a subject and contacted with one or more calcitonin receptor activators or calcitonin receptor-specific activators (e.g., samples are cultured and contacted with one or more activators in vitro). The response of the sample (e.g., immune cell or tissue sample) to the one or more calcitonin receptor activators or calcitonin receptor-specific activators is evaluated to predict response to treatment. Responses that are evaluated include immune cell migration, proliferation, recruitment, lymph node homing, lymph node egress, differentiation, activation, polarization, cytokine production, degranulation, maturation, ADCC, ADCP, antigen presentation, or immune cell calcitonin receptor expression (e.g., expression of CALCR and/or RAMP1). A decrease of at least 5% or more (e.g., 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 99%, or more) in migration, proliferation, recruitment, lymph node egress, activation, pro-inflammatory cytokine production (e.g., production of IL-6 and/or IFN), polarization, degranulation, maturation, ADCC, ADCP, antigen presentation, calcitonin receptor expression (e.g., expression of CALCR and/or RAMP1), or markers of inflammation in treated cells compared to untreated or control-treated cells, or an increase of at least 5% or more (e.g., 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 99%, or more) in lymph node homing in treated cells compared to untreated or control-treated cells indicates that the inflammatory or autoimmune disease or condition would respond to treatment with a calcitonin receptor activator.

    [0276] The methods used above to diagnose or identify a subject with a calcitonin receptor-associated inflammatory or autoimmune disease or condition can also be used to predict patient response (e.g., the response of an inflammatory or autoimmune disease or condition in a subject) to treatment with a calcitonin receptor activator. If the expression of a calcitonin receptor (e.g., expression of CALCR and/or RAMP1) is decreased in an immune cell sample compared to a reference (e.g., 1.1, 1.2, 1.3, 1.4, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 6.0, 7.0, 8.0, 9.0, 10.0-fold or more) lower in the inflammatory or autoimmune disease or condition sample compared to the reference), the subject can be predicted to respond to treatment with a calcitonin receptor activator. Subjects predicted to respond to treatment with a calcitonin receptor activator or calcitonin receptor-specific activator can be treated using the methods and compositions described herein (e.g., calcitonin receptor activators).

    Methods of Treatment

    [0277] Administration

    [0278] An effective amount of a calcitonin receptor activator described herein for treatment of inflammatory or autoimmune disease or condition can be administered to a subject by standard methods. For example, the agent can be administered by any of a number of different routes including, e.g., intravenous, intradermal, subcutaneous, percutaneous injection, oral, transdermal (topical), or transmucosal. The calcitonin receptor activator can be administered orally or administered by injection, e.g., intramuscularly, or intravenously. The most suitable route for administration in any given case will depend on the particular agent administered, the patient, the particular disease or condition being treated, pharmaceutical formulation methods, administration methods (e.g., administration time and administration route), the patient's age, body weight, sex, severity of the diseases being treated, the patient's diet, and the patient's excretion rate. The agent can be encapsulated or injected, e.g., in a viscous form, for delivery to a chosen site, e.g., a lymph node, lymphoid organ, gut, barrier tissue, spleen, skin, airway, wound, or site of inflammation. The agent can be provided in a matrix capable of delivering the agent to the chosen site. Matrices can provide slow release of the agent and provide proper presentation and appropriate environment for cellular infiltration. Matrices can be formed of materials presently in use for other implanted medical applications. The choice of matrix material is based on any one or more of: biocompatibility, biodegradability, mechanical properties, and cosmetic appearance and interface properties. One example is a collagen matrix.

    [0279] The agent (e.g., calcitonin receptor activator, e.g., polypeptide, small molecule, nucleic acid, or antibody) can be incorporated into pharmaceutical compositions suitable for administration to a subject, e.g., a human. Such compositions typically include the agent and a pharmaceutically acceptable carrier. As used herein the term pharmaceutically acceptable carrier is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances are known. Except insofar as any conventional media or agent is incompatible with the active compound, such media can be used in the compositions of the invention. Supplementary active compounds can also be incorporated into the compositions.

    [0280] A pharmaceutical composition can be formulated to be compatible with its intended route of administration. Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.

    [0281] Pharmaceutical compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, or phosphate buffered saline (PBS). In all cases, the composition must be sterile and should be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, and sodium chloride in the composition. Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.

    [0282] Sterile injectable solutions can be prepared by incorporating the active compound (e.g., a calcitonin receptor activator described herein) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle which contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying which yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.

    [0283] Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For the purpose of oral therapeutic administration, the active compound can be incorporated with excipients and used in the form of tablets, troches, or capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed. Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition. The tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, or corn starch; a lubricant such as magnesium stearate; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.

    [0284] Systemic administration can also be by transmucosal or transdermal means. For transmucosal or transdermal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives. Transmucosal administration can be accomplished through the use of nasal sprays or suppositories. For transdermal administration, the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art.

    [0285] The active compounds can be prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art. Liposomal suspensions (including liposomes targeted to infected cells with monoclonal antibodies to viral antigens) can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art.

    [0286] Nucleic acid molecule agents described herein can be administered directly (e.g., therapeutic mRNAs) or inserted into vectors used as gene therapy vectors. Gene therapy vectors can be delivered to a subject by, for example, intravenous injection, local administration (see U.S. Pat. No. 5,328,470) or by stereotactic injection (see, e.g., Chen et al., PNAS 91:3054 1994). The pharmaceutical preparation of the gene therapy vector can include the gene therapy vector in an acceptable diluent, or can include a slow release matrix in which the gene delivery vehicle is embedded. Alternatively, where the complete gene delivery vector can be produced intact from recombinant cells, e.g., retroviral vectors, the pharmaceutical preparation can include one or more cells which produce the gene delivery system.

    [0287] The pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration.

    [0288] Methods of formulating pharmaceutical agents are known in the art, e.g., Niazi, Handbook of Pharmaceutical Manufacturing Formulations (Second Edition), CRC Press 2009, describes formulation development for liquid, sterile, compressed, semi-compressed and OTC forms. Transdermal and mucosal delivery, lymphatic system delivery, nanoparticles, controlled drug release systems, theranostics, protein and peptide drugs, and biologics delivery are described in Wang et al., Drug Delivery: Principles and Applications (Second Edition), Wiley 2016; formulation and delivery of peptide and protein agent is described, e.g., in Banga, Therapeutic Peptides and Proteins: Formulation, Processing, and Delivery Systems (Third Edition), CRC Press 2015.

    [0289] Local Administration

    [0290] The calcitonin receptor activators described herein can be administered locally, e.g., to the site of inflammatory or autoimmune disease or condition in the subject. Examples of local administration include epicutaneous, inhalational, intra-articular, intrathecal, intravaginal, intravitreal, intrauterine, intra-lesional administration, lymph node administration, intratumoral administration and administration to a mucous membrane of the subject, wherein the administration is intended to have a local and not a systemic effect. As an example, for the treatment of an inflammatory or autoimmune disease or condition described herein, the calcitonin receptor activator may be administered locally (e.g., to or near a lymph node, lymphoid organ, spleen, barrier tissue, skin, gut, airway, or wound) in a compound-impregnated substrate such as a wafer, microcassette, or resorbable sponge placed in direct contact with the affected tissue. Alternatively, the calcitonin receptor activator is infused into the brain or cerebrospinal fluid using standard methods. As another example, for a cardiac infection, the calcitonin receptor activator may be delivered locally, for example, to the cardiac tissue (e.g., myocardium, pericardium, or endocardium) by direct intracoronary injection through the chest wall or using standard percutaneous catheter based methods. As yet another example, a chronic infection or autoimmune or inflammatory disease or condition described herein (e.g., asthma) may be treated, for example, by administering the calcitonin receptor activator locally by inhalation, e.g., in the form of an aerosol spray from a pressured container or dispenser which contains a suitable propellant, e.g., a gas such as carbon dioxide or a nebulizer. A calcitonin receptor activator for use in the methods described herein can be administered to or near a lymph node, the spleen, a secondary lymphoid organ, a tertiary lymphoid organ, barrier tissue, skin, the gut, an airway, or a wound. In certain embodiments, the agent is administered to a mucous membrane of the subject.

    [0291] Combination Therapy

    [0292] The calcitonin receptor activators described herein may be administered in combination with one or more additional therapies (e.g., 1, 2, 3 or more additional therapeutic agents). The two or more agents can be administered at the same time (e.g., administration of all agents occurs within 15 minutes, 10 minutes, 5 minutes, 2 minutes or less). The agents can also be administered simultaneously via co-formulation. The two or more agents can also be administered sequentially, such that the action of the two or more agents overlaps and their combined effect is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one agent or treatment delivered alone or in the absence of the other. The effect of the two or more treatments can be partially additive, wholly additive, or greater than additive (e.g., synergistic). Sequential or substantially simultaneous administration of each therapeutic agent can be effected by any appropriate route including, but not limited to, oral routes, intravenous routes, intramuscular routes, local routes, and direct absorption through mucous membrane tissues. The therapeutic agents can be administered by the same route or by different routes. For example, a first therapeutic agent of the combination may be administered by intravenous injection while a second therapeutic agent of the combination can be administered locally in a compound-impregnated microcassette. The first therapeutic agent may be administered immediately, up to 1 hour, up to 2 hours, up to 3 hours, up to 4 hours, up to 5 hours, up to 6 hours, up to 7 hours, up to, 8 hours, up to 9 hours, up to 10 hours, up to 11 hours, up to 12 hours, up to 13 hours, 14 hours, up to hours 16, up to 17 hours, up 18 hours, up to 19 hours up to 20 hours, up to 21 hours, up to 22 hours, up to 23 hours up to 24 hours or up to 1-7, 1-14, 1-21 or 1-30 days before or after the second therapeutic agent.

    [0293] For use in treating inflammatory and autoimmune related diseases or conditions, the second agent may be a disease-modifying anti-rheumatic drug (DMARD), a biologic response modifier (a type of DMARD), a corticosteroid, a nonsteroidal anti-inflammatory medication (NSAID). In some embodiments, the second agent is prednisone, prednisolone, methylprednisolone, methotrexate, hydroxycholorquine, sulfasalazine, leflunomide, cyclophosphamide, azathioprine, or a biologic such as tofacitinib, adalimumab, abatacept, anakinra, kineret, certolizumab, etanercept, golimumab, infliximab, rituximab or tocilizumab. For example, if the disease is RA, the second agent may be one or more of: prednisone, prednisolone and methylprednisolone, methotrexate, hydroxycholorquine, sulfasalazine, leflunomide, cyclophosphamide and azathioprine, tofacitinib, adalimumab, abatacept, anakinra, kineret, certolizumab, etanercept, golimumab, infliximab, rituximab or tocilizumab. In some embodiments, the second agent is 6-mercaptopurine, 6-thioguanine, abatacept, adalimumab, alemtuzumab (Lemtrada), aminosalicylates (5-aminoalicylic acid, sulfasalazine, mesalamine, balsalazide, olsalazine), antibiotics, anti-histamines, anti-TNF (infliximab, adalimumab, certolizumab pegol, natalizumab) Ustekinumab), azathioprine, belimumab, beta interferon, calcineurin inhibitors, certolizumab, corticosteroids (prednisone, methylprednisolone), cromolyn, cyclosporin A, cyclosporine, dimethyl fumarate (tecfidera), etanercept, fingolimod (Gilenya), fumaric acid esters, glatiramer acetate (Copaxone), golimumab, hydroxyurea, IFN, IL-11, infliximab, leflunomide, leukotriene receptor antagonist, long-acting beta2 agonist, methotrexate, mitoxantrone, mycophenolate mofetil, natalizumab (tysabri), NSAIDs, ocrelizumab, pimecrolimus, probiotics (VSL#3), retinoids, rituximab, salicylic acid, short-acting beta2 agonist, sulfasalazine, tacrolimus, teriflunomide (Aubagio), theophylline, tocilizumab, ustekinumab (anti-IL12/IL23), or vedolizumab (Anti alpha3 beta7 integrin).

    [0294] For use in treating infectious disease, the second agent may be an antiviral compound (e.g., vidarabine, acyclovir, gancyclovir, valgancyclovir, nucleoside-analog reverse transcriptase inhibitor (NRTI) (e.g., AZT (Zidovudine), ddI (Didanosine), ddC (Zalcitabine), d4T (Stavudine), or 3TC (Lamivudine)), non-nucleoside reverse transcriptase inhibitor (NNRTI) (e.g., (nevirapine or delavirdine), protease inhibitor (saquinavir, ritonavir, indinavir, or nelfinavir), ribavirin, or interferon); an antibacterial compound; an antifungal compound; an antiparasitic compound.

    [0295] Dosing

    [0296] Subjects that can be treated as described herein are subjects with an inflammatory or autoimmune disease or condition, or subjects with an infection. The methods described herein may include a step of selecting a treatment for a patient. The method includes (a) identifying (e.g., diagnosing) a patient who has an autoimmune or inflammatory disease or condition or an infection, and (b) selecting a calcitonin receptor activator, e.g., a calcitonin receptor activator described herein, to treat the condition in the patient. In some embodiments, the method includes administering the selected treatment (e.g., an effective amount of a calcitonin receptor activator) to the subject. In some embodiments, the subject has had denervation (e.g., surgical denervation or traumatic denervation such as from spinal cord injury).

    [0297] In some embodiments, the method includes administering the selected treatment to the subject.

    [0298] In some embodiments, the agent is administered in an amount and for a time effective to result in one of (or more, e.g., 2 or more, 3 or more, 4 or more of): (a) reduced auto-antibody levels, (b) reduced inflammation, (c) improved organ function (d) reduced pain, (e) decreased rate or number of relapses or flare-ups of the disease, (f) increased quality of life.

    [0299] The methods described herein can include profiling an immune cell to determine whether it expresses a calcitonin receptor (e.g., CALCR and/or RAMP1). Profiling can be performed using RNA sequencing, microarray analysis, or serial analysis of gene expression (SAGE). Other techniques that can be used to assess calcitonin receptor expression include quantitative RT-PCR. Profiling results can be confirmed using other methods such as immunohistochemistry, western blot analysis, flow cytometry, or southern blot analysis. Profiling results can be used to determine which calcitonin receptor activator should be administered to treat the patient.

    [0300] Subjects with an inflammatory or autoimmune disease or condition or infection are treated with an effective amount of a calcitonin receptor activator. The methods described herein also include contacting immune cells with an effective amount of a calcitonin receptor activator. In some embodiments, an effective amount of a calcitonin receptor activator is an amount sufficient to increase or decrease lymph node innervation, nerve firing in a lymph node, the development of HEVs or TLOs, immune cell migration, proliferation, recruitment, lymph node homing, lymph node egress, differentiation, activation, polarization, cytokine production, degranulation, maturation, ADCC, ADCP, or antigen presentation. In some embodiments, an effective amount of a calcitonin receptor activator is an amount sufficient to treat the autoimmune or inflammatory condition or infection, reduce symptoms of an autoimmune or inflammatory condition, reduce inflammation, reduce auto-antibody levels, improve organ function, decrease rate or number of relapses or flare-ups, reduce viral load, or control infection.

    [0301] In some embodiments, a calcitonin receptor activator administered according to the methods described herein does not have a direct effect on the central nervous system (CNS) or gut. Any effect on the CNS or gut is reduced compared to the effect observed if the calcitonin receptor activator is administered directly to the CNS or gut. In some embodiments, direct effects on the CNS or gut are avoided by modifying the calcitonin receptor activator not to cross the BBB, as described herein above, or administering the agent locally to a subject.

    [0302] The methods described herein may also include a step of assessing the subject for a parameter of immune response, e.g., assessing the subject for one or more (e.g., 2 or more, 3 or more, 4 or more) of: Tregs, Th2 cells, T cells, circulating monocytes, neutrophils, peripheral blood hematopoietic stem cells, macrophages, mast cell degranulation, activated B cells, NKT cells, macrophage phagocytosis, macrophage polarization, antigen presentation, immune cell activation, immune cell proliferation, immune cell lymph node homing or egress, T cell differentiation, immune cell recruitment, immune cell migration, lymph node innervation, dendritic cell maturation, HEV development, TLO development, or cytokine production. In embodiments, the method includes measuring a cytokine or marker associated with the particular immune cell type, as listed in Table 1 (e.g., performing an assay listed in Table 1 for the cytokine or marker). In some embodiments, the method includes measuring a chemokine, receptor, or immune cell trafficking molecule, as listed in Tables 2 and 3 (e.g., performing an assay to measure the chemokine, marker, or receptor). The assessing may be performed after the administration, before the first administration and/or during a course a treatment, e.g., after a first, second, third, fourth or later administration, or periodically over a course of treatment, e.g., once a month, or once every 3 months. In one embodiment, the method includes assessing the subject prior to treatment or first administration and using the results of the assessment to select a subject for treatment. In certain embodiments, the method also includes modifying the administering step (e.g., stopping the administration, increasing or decreasing the periodicity of administration, increasing or decreasing the dose of the calcitonin receptor activator) based on the results of the assessment. For example, in embodiments where increasing a parameter of immune response described herein is desired (e.g., in inflammatory or autoimmune disease-related embodiments where, e.g., an increase in Treg cells is desired), the method includes stopping the administration if a marker of Treg cells is not increased at least 5%, 10%, 15%, 20%, 30%, 40%, 50% or more; or the method includes increasing the periodicity of administration if the marker of Treg cells is not increased at least 5%, 10%, 15%, 20%, 30%, 40%, 50% or more; or the method includes increasing the dose of the calcitonin receptor activator if the marker of Treg cells is not increased at least 5%, 10%, 15%, 20%, 30%, 40%, 50% or more. For example, in embodiments where decreasing a parameter of immune response described herein is desired (e.g., embodiments where a decrease in macrophage cells is desired), the method includes stopping the administration if a marker of macrophage cells is not decreased at least 5%, 10%, 15%, 20%, 30%, 40%, 50% or more; or the method includes increasing the periodicity of administration if the marker of macrophage cells is not decreased at least 5%, 10%, 15%, 20% or more; or the method includes increasing the dose of the calcitonin receptor activator if the marker of macrophage cells is not decreased at least 5%, 10%, 15%, 20% or more.

    [0303] In certain embodiments, immune effects (e.g., immune cell activities) are modulated in a subject (e.g., a subject having an inflammatory or autoimmune condition) or in a cultured cell by at least 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 50%, 60%, 70%, 80%, compared to before an administration, e.g., of a dosing regimen, of a calcitonin receptor activator such as those described herein. In certain embodiments, the immune effects are modulated in the subject or a cultured cell between 5-20%, between 5-50%, between 10-50%, between 20-80%, between 20-70%, between 50-100%, between 100-500%. The immune effects described herein may be assessed by standard methods:

    [0304] The calcitonin receptor activators described herein are administered in an amount (e.g., an effective amount) and for a time sufficient to effect one of the outcomes described above. The calcitonin receptor activator may be administered once or more than once. The calcitonin receptor activator may be administered once daily, twice daily, three times daily, once every two days, once weekly, twice weekly, three times weekly, once biweekly, once monthly, once bimonthly, twice a year, or once yearly. Treatment may be discrete (e.g., an injection) or continuous (e.g., treatment via an implant or infusion pump). Subjects may be evaluated for treatment efficacy 1 week, 2 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months or more following administration of a calcitonin receptor activator depending on the calcitonin receptor activator and route of administration used for treatment. Depending on the outcome of the evaluation, treatment may be continued or ceased, treatment frequency or dosage may change, or the patient may be treated with a different calcitonin receptor activator. Subjects may be treated for a discrete period of time (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months) or until the disease or condition is alleviated, or treatment may be chronic depending on the severity and nature of the disease or condition being treated.

    Kits

    [0305] The invention also features a kit including (a) a pharmaceutical composition including a calcitonin receptor activator described herein, and (b) instructions for administering the pharmaceutical composition to treat an inflammatory or autoimmune disease or condition.

    [0306] In some embodiments, the kit includes (a) a unit dose of a calcitonin receptor activator that increases an immune response described herein, (b) a vaccine against an infectious agent, and (c) instructions for administering the unit dose to prevent or treat an infection caused by the infectious agent.

    EXAMPLES

    [0307] The following examples are provided to further illustrate some embodiments of the present invention, but are not intended to limit the scope of the invention; it will be understood by their exemplary nature that other procedures, methodologies, or techniques known to those skilled in the art may alternatively be used.

    Example 1Identification of Calcitonin Receptors on Immune Cells

    [0308] CD14+ monocytes were isolated from human PBMCs using negative magnetic bead selection (Stemcell Technologies) on day 0. Cells were cultured two days with M-CSF to differentiate monocytes to macrophages. On day 3, macrophages were polarized to M1-like macrophages with IFN and LPS; and M2-like macrophages with IL4, IL10, and TGF. Cells were harvested on day 6. The cells were lysed and RNA was extracted using an RNA extraction kit (Qiagen). qPCR was performed using integrated fluidic circuits (IFCs) run on a real-time PCR machine (Fluidigm) with primers specific for CALCR and RAMP1 (Life Technologies). Gene expression was normalized to HPRT1. Expression level was calculated by 2{circumflex over ()}(delta CT), where delta CT is (GOI CtHPRT Ct).

    [0309] Gene expression for CALCR in M2-like macrophages and RAMP1 in both M1-like and M2-like macrophages was determined. RAMP1 expression was higher in M2-like macrophages compared to M1-like macrophages, as shown in Table 12 below.

    TABLE-US-00022 TABLE 12 EXPRESSION OF CALCITONIN RECEPTORS IN MACROPHAGES Expression Level Cell Type Gene Name (Relative to HPRT1) M1-like Macrophages CALCR (Entrez: 799) Not detected M2-like Macrophages CALCR (Entrez: 799) 0.0304 M1-like Macrophages RAMP1 (Entrez: 10267) 0.01045 M2-like Macrophages RAMP1 (Entrez: 10267) 5.7757

    Example 2Modulation of Calcitonin Receptors with a Small Molecule Agonist

    [0310] CD14+ monocytes were isolated from human PBMCs using negative magnetic bead selection (Stemcell Technologies) on day 0. Cells were cultured with M-CSF to differentiate monocytes to macrophages. On day 6, cells were treated with SUN-B-8155, a non-peptide calcitonin receptor agonist (Sigma-Aldrich), at concentrations 2 M and 20 M overnight. Supernatant was collected and bead-based immunoassays (Biolegend) were performed to detect changes in cytokine secretion.

    [0311] Across multiple donors, secretion of the inflammatory cytokine, IL6, by macrophages was decreased after addition of small molecule agonist to calcitonin receptor, as shown in Table 13 below.

    TABLE-US-00023 TABLE 13 EFFECT OF CALCITONIN RECEPTOR AGONISM ON CYTOKINE SECRETION IN HUMAN MACROPHAGES Fold change of IL6(Normalized to Macs + LPS with no Sample compound treatment) Macs + LPS 1.00 Macs + LPS + SUN-B-8155 (2 M) 0.92 Macs + LPS + SUN-B-8155 (20 M) 0.09

    Example 3Administration of a Calcitonin Receptor Activator to Treat Local Intestinal Inflammation

    [0312] According to the methods disclosed herein, a physician of skill in the art can treat a patient, such as a human patient with an inflammatory condition (e.g., intestinal inflammation, such as IBD, ulcerative colitis (UC), or Hirschsprung's disease-associated enterocolitis (HAEC)), so as to reduce the inflammation that contributes to the condition. Before treating the patient, a physician can perform an endoscopy or colonoscopy to diagnose a patient with intestinal inflammation, or identify a patient as having intestinal inflammation based on results from an endoscopy or colonoscopy. To treat the patient, a physician of skill in the art can administer to the human patient a calcitonin receptor activator that decreases macrophage activation (e.g., an agent that increases calcitonin receptor signaling, such as calcitonin receptor-specific activating antibodies). The calcitonin receptor-specific activating antibody can be and administered parenterally (e.g., by subcutaneous injection or intravenous infusion) to treat intestinal inflammation. The calcitonin receptor-specific activating antibody is administered in a therapeutically effective amount, such as from 10 g/kg to 500 mg/kg (e.g., 10 g/kg, 100 g/kg, 500 g/kg, 1 mg/kg, 10 mg/kg, 50 mg/kg, 100 mg/kg, 250 mg/kg, or 500 mg/kg). In some embodiments, the calcitonin receptor-specific activating antibody is administered bimonthly, once a month, once every two weeks, or at least once a week or more (e.g., 1, 2, 3, 4, 5, 6, or 7 times a week or more).

    [0313] The calcitonin receptor-specific activating antibody decreases macrophage production of one or more pro-inflammatory cytokines (e.g., IL6 or IFN). The calcitonin receptor-specific activating antibody is administered to the patient in an amount sufficient to decrease pro-inflammatory cytokine levels by 10% or more (e.g., 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or more), or improve symptoms of intestinal inflammation (e.g., abdominal pain, diarrhea, fever, and fatigue). Cytokine production can be assessed by collecting a blood sample from the patient and evaluating one or more pro-inflammatory cytokines (e.g., IL6 or IFN). The blood sample can be collected one day or more after administration of the calcitonin receptor-specific activating antibody (e.g., 1, 2, 3, 4, 5, 6, 7, 10, 14, 21, or 30 or more days after administration). The blood sample can be compared to a blood sample collected from the patient prior to administration of the calcitonin receptor-specific activating antibody (e.g., a blood sample collected earlier the same day, 1 day, 1 week, 2 weeks, one month or more before administration of the calcitonin receptor-specific activating antibody). A restoration in intestinal health as evaluated using a colonoscopy, endoscopy or tissue biopsy, reduction in the symptoms of intestinal inflammation (e.g., abdominal pain, diarrhea, fever, and fatigue), a reduction in the markers of intestinal inflammation in a blood sample (e.g., CRP, ESR, calprotectin, or lactoferrin, as compared to levels in a blood sample before treatment), reduced pro-inflammatory cytokine levels, or increased IL-10, TGF, Arg1, IDO, PF4, CCL24, or IL4Ralpha indicate that the calcitonin receptor-specific activating antibody reduces inflammation, reduces macrophage activation, or treats intestinal inflammation.

    Other Embodiments

    [0314] While the invention has been described in connection with specific embodiments thereof, it will be understood that it is capable of further modifications and this application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the invention that come within known or customary practice within the art to which the invention pertains and may be applied to the essential features hereinbefore set forth, and follows in the scope of the claims. Other embodiments are within the claims.