Compositions and methods for treating malignancies
10365280 ยท 2019-07-30
Assignee
Inventors
Cpc classification
G01N2333/70596
PHYSICS
G01N2800/56
PHYSICS
G01N2500/02
PHYSICS
G01N2800/52
PHYSICS
International classification
Abstract
Provided by the invention are methods for identifying therapeutic agents for treating multiple myeloma or another hematological malignancy, as well as methods for determining the prognosis of a patient with multiple myeloma or another hematological malignancy. The methods are based in part on the inventors' discovery that an extracellular form of cyclophilin A binds to CD147 expressed on multiple myeloma cells.
Claims
1. A method for identifying a therapeutic agent for treating multiple myeloma (MM), the method comprising: (a) providing a first polypeptide comprising a CD147 polypeptide and a second polypeptide comprising an extracellular cyclophilin A (eCyPA) polypeptide sequence under conditions that allow for binding of the CD147 polypeptide and the eCyPA sequence; (b) contacting the complex with a test agent; (c) determining whether the test agent disrupts binding of the first and second polypeptide, wherein disruption of the binding of the first polypeptide and second polypeptide by the test agent indicates the test agent is a putative therapeutic agent for treating MM; (d) contacting the putative therapeutic agent with a multiple myeloma (MM) cell population expressing CD147; and (e) determining whether the putative therapeutic agent inhibits migration of MM cells from the MM cell population into bone marrow, wherein inhibition of MM cell migration indicates the test agent is a therapeutic agent for treating MM.
2. The method of claim 1, wherein the CD147 polypeptide is provided in a cell expressing a CD147 polypeptide sequence.
3. The method of claim 2, wherein the cell expressing a CD147 polypeptide sequence is provided in vitro.
4. The method of claim 2, wherein the cell expressing a CD147 polypeptide sequence is provided in vivo.
5. The method of claim 2, wherein the cell expressing a CD147 polypeptide sequence is a human cell.
6. The method of claim 2, wherein the cell expressing a CD147 polypeptide sequence is a lymphocyte, optionally wherein the lymphocyte is a B cell.
7. The method of claim 2, wherein the cell expressing a CD147 polypeptide sequence is a multiple myeloma cell.
8. The method of claim 1, wherein the amino acid sequence of the eCyPA polypeptide is set forth in SEQ ID NO:1.
9. The method of claim 1, wherein the amino acid sequence of the CD147 polypeptide is set forth in SEQ ID NO:2.
10. The method of claim 1, wherein the test agent is a nucleic acid, a polypeptide, a small molecule, or combinations thereof.
11. The method of claim 10, wherein the test agent is a nucleic acid, and wherein the nucleic acid is an inhibitory nucleic acid.
12. The method of claim 11, wherein the inhibitory nucleic acid is a triplex forming oligonucleotide, an aptamer, a ribozyme, an antisense RNA, a short interfering RNA (siRNA), or a micro-RNA (miRNA).
13. The method of claim 10, wherein the test agent is a polypeptide, and wherein the polypeptide is an antibody or an antigen-binding derivative thereof.
14. The method of claim 13, wherein antibody or an antigen-binding derivative thereof specifically binds to CyPA.
15. The method of claim 14, wherein the antibody or antigen-binding derivative thereof is humanized.
16. The method of claim 1, wherein disruption of the binding of the first polypeptide and second polypeptide by the test agent indicates the test agent is a putative therapeutic agent for treating chronic lymphocytic leukemia (CLL) or lymphoplasmacytic lymphoma (LPL).
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) Some of the figures in the application were executed in color.
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
DETAILED DESCRIPTION OF THE INVENTION
(19) Metastasis of epithelial tumors is a complex and poorly understood molecular, cellular, and organismal multistage process. Sometimes termed the invasion-metastasis cascade, it occurs when cancer cells spread from the site of origin to anatomically distant organs. The process is driven by acquisition of genetic and/or epigenetic alterations within the tumor cells themselves (the seeds), and by multistep interplay of these cells with the host microenvironment (the soil), culminating in colonization in a foreign organ. Akin to certain epithelial neoplasms (e.g., prostate and breast carcinomas) that frequently metastasize and colonize to the bone marrow (BM), B-cell lymphoid malignancies such as multiple myeloma (MM), chronic lymphocytic lymphoma (CLL), and lymphoplasmacytic lymphoma (LPL), preferentially colonize and accumulate within the BM. Although the molecular mechanisms responsible for this preferential colonization are still not completely understood, pathogenetic studies indicate that the BM-microenvironment (BM-ME), comprised of an extracellular matrix and diverse cellular elements (e.g. stromal, adiposal, endothelial, and hematopoietic), plays a pivotal role. As with the BM homing of hematopoietic stem cell cells (HSCs), migration of MM and other B-cell malignancies from the PB to the BM niche is not a passive process, but rather is a complex active process requiring multiple adhesion and chemokine receptors. BM homing of HSCs involves tethering of the cells by E- and P-selectins, associated with P-selectin glycoprotein ligand-1 and CD44 on the cells. This tethering involves interaction of endothelial cells with circulating HSCs, and leads to rolling of the HSCs along the endothelium and activation of the SDF-1/CXCR4 axis, followed by VLA-/VCAM-1 activation. Other molecules that appear to play a role in HSCs homing include LFA-1, VLA-5, and activated metalloproteases MMP2/9.
(20) Here we have used MM as a prototypical terminally differentiated B-cell neoplasm to investigate the cellular and molecular BM-ME properties involved in BM colonization. MM is a fatal hematological malignancy of terminally differentiated, post-germinal B-cells that originate in the lymph nodes and accumulate in the BM during disease evolution. Reciprocal interactions between MM cells and the BM-ME not only mediate their growth, but also protect them from apoptosis, resulting in the bone lytic lesions and BM angiogenesis. Interestingly, however, at the end-stage of disease MM cells are able to survive and proliferate even in the absence of the BM-ME. During this stage the number of MM cells circulating in the PB increases, and growth outside the BM can occur. Similarly to the HSC, factors implicated in BM homing of MM include the CXCR4/SDF-1 axis, IGF-1, and intracellular regulators downstream of CXCR4, including Rho and Rac. Of these factors, the CXCR4/SDF-1 axis plays an especially critical role in regulating migration and adhesion of MM cells.
(21) Among the interactions between MM cells and the BM-ME, intimate physical contact with BMECs is a major feature and is most readily discerned during early disease stages, when the tumor burden is low. Clinico-pathologic correlations which highlight the importance of the functional interactions between MM cells and BMECs include the following: (1) BM angiogenesis is associated with MM cell growth, disease progression, and patient survival; (2) progression of monoclonal gammopathy of undetermined significance (MGUS), to active MM is associated with increasing angiogenesis; and (3) microvascular density correlates with disease stage and is a prognostic factor in newly diagnosed MM patients receiving conventional and high-dose chemotherapy.
(22) Although several pro-angiogenic molecules secreted by MM cells have been identified (e.g. VEGF, FGF, and HGF), the signaling molecules secreted by BMECs, which that promote MM disease progression and BM homing are not fully known.
(23) We have investigated the role of BMECs in the colonization of MM cells to the BM niche. Having previously observed high BCL9 expression in BMECs, but not other BM cells, we chose to focus on the role of this transcriptional co-activator of the canonical Wnt/-catenin pathway. We used an integrated approach combining in vitro assays with in vivo migration assays that simulate the human-human heterotypic interactions between MM and BM cells. Additionally, we performed proteomic analysis of signaling molecules secreted by BMECs, as well as shRNA-based loss-of-function assays, to identify and functionally validate eCyPA as a novel transcriptional target of the Wnt/-catenin/BCL9 complex. eCyPA is secreted by BMECs and promotes pleiotropic signaling changes that enhance not only migration of MM cells toward the BM, but also proliferation mediated by binding to CD147 receptors on the MM cells. A comparison between BMECs and BMSCs from the same MM patient demonstrated that these cells play different roles in the migration and BM colonization of MM cells. In contrast to primary BMECs, primary BMSCs secrete very little eCyPA but instead secrete SDF-1, thereby promoting migration and BM homing of MM cells, less efficiently than primary BMECs. Consistent with this finding, BMEC-induced migration of MM cells was inhibited by a CD147 Ab, but not by a CXCR4 Ab. In addition, inhibition of the eCyPA/CD17 axis supressed migration, tumor growth, and BM-colonization in a mouse xenograt model of MM. Furthermore, we have documented that eCyPA promotes migration of CLL and LPL cells, two other B-cell malignancies that colonize the BM and express CD147. Taken together, our findings indicate that cells within the BM microenvironment play different roles in MM progression, and offer a potential link between chronic inflammation, immunomodulation, and the pathogenesis of MM, CLL and LPL. Moreover, our results provide a compelling rationale for exploring the role of eCyPA and CD147 as markers of disease progression and for the development of novel therapeutic approaches based on targeting the eCyPA/CD147 signaling complex.
(24) Screening for Therapeutic Agents for Treating a Hematological Malignancy
(25) Provided by the invention are methods for identifying therapeutic agents for treating multiple myeloma or another hematological malignancy that are based on the binding of cyclophilin A to CD147 on multiple myeloma cells.
(26) For example, a method for identifying an agent for treating multiple myeloma (MM) or other hematological malignancies includes providing a first polypeptide comprising a CD147 polypeptide and a second polypeptide comprising an extracellular cyclophilin A (eCyPA) polypeptide sequence under conditions that allow for binding of the CD147 polypeptide and the eCyPA sequence to form a complex. The complex is then contacted with a test agent, and the complex is assayed to determine whether the test agent disrupts binding of the first and second polypeptide. Disruption of the binding of the first polypeptide and second polypeptide by the test agent indicates the test agent is a potential therapeutic agent for treating MM.
(27) A test agent that disrupts CD147 binding to eCyPA can be further characterized to determine its suitability as a therapeutic agent for treating MM. For example, a promising test agent can be used as described in the examples below to determine whether it inhibits proliferation of an MM cell population and/or whether it inhibits migration of MM cells into bone marrow Inhibition of MM cell proliferation and/or migration indicates the test agent is a therapeutic agent for treating MM.
(28) The first and second polypeptide sequences can be CD147 polypeptide sequences and cyclophilin A sequences known in the art. Thus, in some embodiments, extracellular cyclophilin A polypeptide sequences include the following amino acid sequence:
(29) TABLE-US-00001 (SEQIDNO:1) GGSMVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENILKHTGPGIL SMANAGPNTNGSQFFICTAKTEWLDGKVVFGKVKEGMNIVEAMERFGSRN GKTSKKITIADCGQLE
(30) In some embodiments the CD147 polypeptide sequences include a polypeptide with the following amino acid sequence of a human CD147 polypeptide:
(31) TABLE-US-00002 (SEQIDNO:2) MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSP VPEIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVE EDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPGTVFTTVEDLG SKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGE YSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPV TDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYR CNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRK PEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS
Test Agents
(32) The term test agent or test compound refers to any chemical entity, pharmaceutical, drug, and the like, that can be used to treat or prevent a disease, illness, sickness, or disorder of bodily function, or otherwise alter the physiological or cellular status of a sample (e.g., the level of disregulation of apoptosis in a cell or tissue). Test agents comprise both known and potential therapeutic compounds. A test compound can be determined to be therapeutic by using the screening methods of the present invention.
(33) A known therapeutic compound refers to a therapeutic compound that has been shown (e.g., through animal trials or prior experience with administration to humans) to be effective in such treatment or prevention.
(34) The screening methods can include those known or used in the art or those first described herein. For example, in one embodiment a CD147 is immobilized on a microtiter plate and incubated with cyclophilin A in the presence of a test agent. Subsequently, the complex can be detected using a secondary antibody, and absorbance can be detected on a plate reader.
(35) The test agent can be a small molecule or a large molecule. A small molecule as used herein, is meant to refer to a composition that has a molecular weight of less than about 5 kD and most preferably less than about 4 kD. Small molecules can be, e.g., nucleic acids, peptides, polypeptides, peptidomimetics carbohydrates, lipids or other organic or inorganic molecules. Libraries of chemical and/or biological mixtures, such as fungal, bacterial, or algal extracts, are known in the art and can be screened with any of the assays of the invention. Examples of methods for the synthesis of molecular libraries can be found in the art, for example in: DeWitt, et al., 1993. Proc. Natl. Acad. Sci. U.S.A. 90: 6909; Erb, et al., 1994. Proc. Natl. Acad. Sci. U.S.A. 91: 11422; Zuckermann, et al., 1994. J. Med. Chem. 37: 2678; Cho, et al., 1993. Science 261: 1303; Carrell, et al., 1994. Angew. Chem. Int. Ed. Engl. 33: 2059; Carell, et al., 1994. Angew. Chem. Int. Ed. Engl. 33: 2061; and Gallop, et al., 1994. J. Med. Chem. 37: 1233.
(36) The test agent need not be any particular structure or size. In some embodiments, the test agent is a nucleic acid, a polypeptide, a small molecule or combinations thereof, an inhibitory nucleic acid, e.g., a triplex forming oligonucleotide, an aptamer, a ribozyme, an antisense RNA, a short interfering RNA (siRNA), or a micro-RNA (miRNA).
(37) In some embodiments, the polypeptide is a polypeptide binding partner of a cyclophilin A molecule or CD147 molecule, e.g., an antibody, e.g., an anti-CyPA antibody. Anti-CyPA antibodies for treating HIV infection are described in, e.g., U.S. Pat. No. 5,840,305.
(38) Antibodies are preferably modified to reduce the likelihood of an unwanted host reaction. One example of such a modification is a humanized antibody. Humanized forms of non-human (e.g., murine) antibodies are chimeric molecules of immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab, F(ab) or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human immunoglobulin. Humanized antibodies include human immunoglobulins (recipient antibody) in which residues from a complementary determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity and capacity. In some instances, Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues. Humanized antibodies may also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin (Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature, 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol., 2:593-596 (1992)).
(39) Methods for humanizing non-human antibodies are well known in the art. Generally, a humanized antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as import residues, which are typically taken from an import variable domain. Humanization can be essentially performed following the method of Winter and co-workers (Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. Accordingly, such humanized antibodies are chimeric antibodies (U.S. Pat. No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
(40) Human antibodies can also be produced using other techniques known in the art, including phage display libraries (Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991)). The techniques of Cole and Boerner are also available for the preparation of human monoclonal antibodies (Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985) and Boerner et al., J. Immunol., 147(1):86-95 (1991)). Similarly, human antibodies can be made by introduction of human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,661,016, and in the following scientific publications: Marks et al., Bio/Technology 10: 779-783 (1992); Lonberg et al., Nature 368: 856-859 (1994); Morrison, Nature 368 812-13 (1994); Fishwild et al., Nature Biotechnology 14, 845-51 (1996); Neuberger, Nature Biotechnology 14: 826 (1996); and Lonberg and Huszar, Intern. Rev. Immunol. 13, 65-93 (1995).
(41) In addition, cyclophilin A antibodies and anti-CD147 antibodies can be used to create a therapeutic agent for treating MM, or another disease by adapting methods for making humanized antibodies described in U.S. Pat. No. 8,673,593. The method includes providing a DNA encoding the variable domains of a donor CyPA antibody and determining the amino acid sequence of the CDR regions of the donor monoclonal antibody from the DNA, selecting human acceptor antibody sequences; and producing a humanized CyPA antibody comprising the CDRs from the donor antibody and variable region frameworks from the human acceptor antibody sequences. If desired, the method can further include determining whether humanized antibody disrupts binding of first polypeptide comprising a CD147 polypeptide and a second polypeptide comprising an extracellular cyclophilin A (eCyPA) polypeptide sequence under conditions that allow for binding of the CD147 polypeptide and the eCyPA sequence. Disruption of the binding of the first polypeptide and second polypeptide by the humanized antibody indicates it is a therapeutic agent for treating MM.
(42) The antibody preferably binds specifically (or selectively) to either a cyclophilin A or CD147 molecule. The phrase specifically (or selectively) binds to an antibody or specifically (or selectively) immunoreactive with, when referring to a protein or peptide, refers to a binding reaction that is determinative of the presence of the protein in a heterogeneous population of proteins and other biologics. Thus, under designated immunoassay conditions, the specified antibodies bind to a particular protein at least two times the background and do not substantially bind in a significant amount to other proteins present in the sample. Specific binding to an antibody under such conditions may require an antibody that is selected for its specificity for a particular protein. A variety of immunoassay formats may be used to select antibodies specifically immunoreactive with a particular protein. For example, solid-phase ELISA immunoassays are routinely used to select antibodies specifically immunoreactive with a protein (see, e.g., Harlow & Lane, Antibodies, A Laboratory Manual (1988), for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity). Typically a specific or selective reaction will be at least twice background signal or noise and more typically more than 10 to 100 times background.
(43) If desired, the antibody can be provided conjugated or coupled to a detectable label, a radioactive label, an enzyme, a fluorescent label, a luminescent label, a bioluminescent label, or a therapeutic agent.
(44) Detecting eCyPA and CD147 Complexes
(45) The first and second polypeptide can be provided in either a cell-free or a cell-based system. Art recognized methods for measuring protein-protein interactions can be used to characterize binding of the eCyPA sequence and CD147 polypeptide in the presence of the test agent, for example, by coupling the test agent with a radioisotope or enzymatic label such that binding of the test compound to the antigen or biologically-active portion thereof can be determined by detecting the labeled compound in a complex. For example, test agents can be labeled with .sup.125l, .sup.35S, .sup.14C, or .sup.3H, either directly or indirectly, and the radioisotope detected by direct counting of radioemission or by scintillation counting. Alternatively, test agents can be enzymatically-labeled with, for example, horseradish peroxidase, alkaline phosphatase, or luciferase, and the enzymatic label detected by determination of conversion of an appropriate substrate to product.
(46) In one embodiment, the assay comprises contacting eCyPA sequence-CD147 polypeptide complex with a test agent, and determining the ability of the test compound to interact with the complex or otherwise disrupt the existing complex. In this embodiment, determining the ability of the test compound comprises determining the ability of the test compound to preferentially bind to the eCyPA sequence and/or the CD147 or a biologically-active portion thereof, as compared to its binding partner.
(47) Observation of the complex in the presence and absence of a test agent can be accomplished in any vessel suitable for containing the reactants. Examples of such vessels include microtiter plates, test tubes, and micro-centrifuge tubes. In one embodiment, a fusion protein that adds a domain that allows one or both of the proteins to be bound to a matrix can be provided. In one embodiment, GST-antibody fusion proteins or GST-antigen fusion proteins are adsorbed onto glutathione Sepharose beads (Sigma Chemical, St. Louis, Mo.) or glutathione-derivatized microtiter plates, that are then combined with the test compound, and the mixture is incubated under conditions conducive to complex formation (e.g., at physiological conditions for salt and pH).
(48) Following incubation, the beads or microtiter plate wells are washed to remove any unbound components, the matrix immobilized in the case of beads, complex determined either directly or indirectly. Alternatively, the complexes can be dissociated from the matrix, and the level of antibody-antigen complex formation can be determined using standard techniques.
(49) In some embodiments, one of either the eCyPA sequence or the CD147 sequence is immobilized to facilitate separation of complexed from uncomplexed forms of one or both following introduction of the rest agent, as well as to accommodate automation of the assay. If desired, either member of the putative complex can be immobilized utilizing biotin and streptavidin. Biotinylated antibody or antigen molecules can be prepared from biotin-NHS (N-hydroxysuccinimide) using techniques well-known in the art (e.g., biotinylation kit, Pierce Chemicals, Rockford, Ill.), and immobilized in the wells of streptavidin-coated 96 well plates (Pierce Chemical). Methods for detecting such complexes, in addition to those described above for the GST-immobilized complexes, include immunodetection of complexes using such other antibodies reactive with the antibody or antigen.
(50) In some embodiments, binding of the test agent to the complex is detected using assay AlphaScreen technology (PerkinElmer, Waltham, Mass.).
(51) Cells Used in Screening Assays
(52) When cell-based assays are used, CD-147 expressing cells can be provided by any cell (e.g., MM1S, OPM1, H929, U266 cells) that expresses CD147 in amounts sufficient to detectably bind an eCyPA polypeptide or CD147-binding fragment of an eCyPA polypeptide. Cells can be prokaryotic or eukaryotic cells. The cell can be provided in vitro or in vivo. Cells can be prokaryotic or eukaryotic, for example, mammalian cells including both human and non-human mammalian cells (e.g., a rodent such as a mouse or rat cell).
(53) Cells can be primary cells or established cell lines. In some embodiments hematopoietic cells are used. The term hemapoietic cells as used herein includes all blood cell types, including those from the myeloid lineage (monocytes and macrophages, neutrophils, basophils, eosinophils, erythrocytes, megakaryocytes/platelets, dendritic cells), and lymphoid lineages (T-cells, B-cells, NK-cells).
(54) In some embodiments, the methods described herein are performed on cell samples. A sample in the context of screening assays is understood within the scope of the invention to refer to a suitable cell, group of cells, animal model or human. These samples do not have to be derived from a subject. A sample in this context can be a group of cells from a cell line. Preferably cell lines are derived from a hematopoietic disorder. A non-limiting list of samples includes bone marrow aspirates or bone marrow biopsy (for myeloma, leukemias and other hematopoietic disorders), lymph node samples lymphomas and other hematopoietic disorders) and peripheral blood samples (for leukemias and other hematopoietic disorders). The sample may be of a particular type of hematopoietic cell, for example a population of B lymphocytes and/or T lymphocytes.
(55) The presence and/or level of proteins used in the methods described herein (e.g., eCyPA protein and CD147 polypeptides) can be evaluated using methods known in the art, e.g., using quantitative immunoassay methods such as enzyme linked immunosorbent assays (ELISA), see above, immunoprecipitations, immunofluorescence, enzyme immunoassay (EIA), radioimmunoassay (RIA), and Western blot analysis.
(56) Similarly, the presence and/or level of transcripts encoding these proteins can be evaluated using RNA detection methods known in the art, e.g., quantitative transcription detection such as a transcription-based amplification system (TAS). Some examples of RNA detection systems include PCR and QRT-PCR-based amplification systems, ligase chain reaction, Q, replicase, reverse transcriptase-coupled nucleic acid sequence-based amplification (NASBA), self-sustained sequence replication (3SR), strand displacement amplification (SDA), or reverse transcriptase-coupled rolling circle amplification (RCA).
(57) Diagnosing and Determining a Prognosis for a Subject with Multiple Myeloma
(58) The link identified by the inventors between eCyPA and multiple myeloma also provides new methods for diagnosing and otherwise assessing MM in a subject. Multiple myeloma (MM) or a multiple myeloma precursor condition in a subject can be diagnosed by providing a sample from a subject and assaying the sample to determine a level of eCyPA in the sample to obtain an eCyPA test value. The test value is compared to an eCyPA reference value calculated for a sample whose MM status is known. An eCyPA test value greater than a reference eCyPA value in a reference sample known not to have MM indicates that the subject has MM or a MM precursor conditions. Conversely, an eCyPA test value equal to or less than a reference eCyPA value in a sample known to have MM indicates that the subject does not have multiple myeloma.
(59) Similarly, the prognosis for a subject with multiple myeloma (MM) can be determined by providing a sample from a subject with MM and assaying the sample to determine a level of eCyPA in the sample to obtain an eCyPA test value, then comparing the eCyPA test value to an eCyPA reference value calculated for a sample whose MM status is known. An eCyPA test value greater than a reference eCyPA value in a sample known not to have MM indicates that the subject has a poor prognosis, while an eCyPA test value less than a reference eCyPA value in a sample known to have MM indicates that the subject has a good prognosis.
(60) Efficaciousness of a treatment for multiple myeloma can be determined by providing a sample from a subject with MM and assaying the sample to determine a level of eCyPA in the sample to obtain an eCyPA test value. The eCyPA test value is compared to an eCyPA reference value calculated for a sample whose MM status is known. An eCyPA test value greater than a reference eCyPA value in a reference sample known not to have MM indicates that the treatment is not efficacious, and an eCyPA test value less than a reference eCyPA value in a sample known to have MM indicates that the treatment is efficacious. In some embodiments, the reference sample is obtained from the same subject prior to beginning treatment of MM or at an earlier point in treatment of MM.
(61) The progression of multiple myeloma (MM) in a subject can similarly be determined; an eCyPA test value greater than a reference eCyPA value in a sample known not to have MM indicates that the subject has a MM more advanced than MM in subjects from which the reference eCyPA value is calculated, while an eCyPA test value less than the reference eCyPA value indicates that the subject has a MM less advanced than MM in subjects from which the reference eCyPA value is calculated.
(62) The threshold for determining how a test sample is scored in the assays described herein, e.g., whether a test sample is scored positive, can be altered depending on the sensitivity or specificity desired. The clinical parameters of sensitivity, specificity, negative predictive value, positive predictive value and efficiency are typically calculated using true positives, false positives, false negatives and true negatives. A true positive sample is a sample that is positive according to an art recognized method, which is also diagnosed as positive (high risk for early attack) according to a method of the invention. A false positive sample is a sample negative by an art-recognized method, which is diagnosed positive (high risk for early attack) according to a method of the invention. Similarly, a false negative is a sample positive for an art-recognized analysis, which is diagnosed negative according to a method of the invention. A true negative is a sample negative for the assessed trait by an art-recognized method, and also negative according to a method of the invention. See, for example, Mousy (Ed.), Intuitive Biostatistics New York: Oxford University Press (1995), which is incorporated herein by reference.
(63) As used herein, the term sensitivity means the probability that a laboratory method is positive in the presence of the measured trait. Sensitivity is calculated as the number of true positive results divided by the sum of the true positives and false negatives. Sensitivity essentially is a measure of how well a method correctly identifies those with disease. For example, cut-off values can be selected such that the sensitivity of diagnosing an individual is at least about 60%, and can be, for example, at least about 50%, 65%, 70%, 75%, 80%, 85%, 90% or 95%.
(64) As used herein, the term specificity means the probability that a method is negative in the absence of the measured trait. Specificity is calculated as the number of true negative results divided by the sum of the true negatives and false positives. Specificity essentially is a measure of how well a method excludes those who do not have the measured trait. For example, cutoff values can be selected so that when the sensitivity is at least about 70%, the specificity of diagnosing an individual is in the range of 30-60%, for example, 35-60%, 40-60%, 45-60% or 50-60%.
(65) The term positive predictive value, as used herein, is synonymous with PPV and means the probability that an individual diagnosed as having the measured trait actually has the disease. Positive predictive value can be calculated as the number of true positives divided by the sum of the true positives and false positives. Positive predictive value is determined by the characteristics of the diagnostic method as well as the prevalence of the disease in the population analyzed. The cut-off values can be selected such that the positive predictive value of the method in a population having a disease prevalence of 15% is at least about 5%, and can be, for example, at least about 8%, 10%, 15%, 20%, 25%, 30% or 40%.
(66) As used herein, the term efficiency means the accuracy with which a method diagnoses a disease state. Efficiency is calculated as the sum of the true positives and true negatives divided by the total number of sample results, and is affected by the prevalence of the trait in the population analyzed. The cut-off values can be selected such that the efficiency of a method of the invention in a patient population having a prevalence of 15% is at least about 45%, and can be, for example, at least about 50%, 55% or 60%.
(67) For determination of the cut-off level, receiver operating characteristic (ROC) curve analysis can be used. In some embodiments, the cut-off value for the classifier can be determined as the value that provides specificity of at least 90%, at least 80% or at least 70%.
(68) Treating Subjects with High Levels of eCyPA
(69) Subjects determined to have multiple myeloma, a multiple myeloma related condition, or inflammation based on elevated levels of eCyPA can be treated using one or more treatment modalities known in the art. For example, treatment multiple myeloma, a multiple myeloma related condition can be with a chemotherapeutic agent, radiation agent, hormonal agent, biological agent, an anti-inflammatory agent, or a combination of two or more of these agents.
(70) Chemotherapeutic agents include, e.g., sanglifehrin A, sarcosine-3(4-methylbenzoate) (SmBz), voclosporin, cyclosporin A, NVP018, alisporivir, NIM811, MMM284, CD147 antibody, CyPA antibody, tamoxifen, trastuzamab, raloxifene, doxorubicin, fluorouracil/5-fu, pamidronate disodium, anastrozole, exemestane, cyclophosphamide, epirubicin, letrozole, toremifene, fulvestrant, fluoxymester one, trastuzumab, methotrexate, megastrol acetate, docetaxel, paclitaxel, testolactone, aziridine, vinblastine, capecitabine, goselerin acetate, zoledronic acid, taxol, vincristine, and/or HDAC/TDAC inhibitors and aggresome inhibitors disclosed in U.S. Pat. No. 8,999,289. Additional treatment strategies include, e.g., autologous stem cell transplantation and allogeneic effector cell transplantation, to develop an effective treatment strategy based on the stage of myeloma being treated (see, e.g., Multiple Myeloma Research Foundation, Multiple Myeloma: Stem Cell Transplantation 1-30 (2004); U.S. Pat. Nos. 6,143,292, and 5,928,639, Igarashi, et al. Blood 2004, 104(1): 170-177, Maloney, et al. 2003, Blood, 102(9): 3447-3454, Badros, et al. 2002, J. Clin. Oncol., 20:1295-1303, Tricot, et al. 1996, Blood, 87(3):1196-1198; the contents of which are incorporated herein by reference).
(71) The effectiveness of a multiple myeloma diagnosis or prognosis using eCyPa levels can be compared to other methods known in the art for assessing multiple myeloma or a related condition. The multiple myeloma staging system most widely used since 1975 has been the Durie-Salmon system, in which the clinical stage of disease (Stage I, II, or III) is based on four measurements (see, e.g., Durie and Salmon, 1975, Cancer, 36:842-854). These four measurements are: (1) levels of monoclonal (M) protein (also known as paraprotein) in the serum and/or the urine; (2) the number of lytic bone lesions; (3) hemoglobin values; and, (4) serum calcium levels. These three stages can be further divided according to renal function, classified as A (relatively normal renal function, serum creatinine value<2.0 mg/dL) and B (abnormal renal function, creatinine value.gtoreq.2.0 mg/dL). A new, simpler alternative is the International Staging System (ISS) (see, e.g., Greipp et al., 2003, Development of an international prognostic index (IPI) for myeloma: report of the international myeloma working group, The Hematology). The ISS is based on the assessment of two blood test results, beta.sub.2-microglobulin (.sub.2-M) and albumin, which separates patients into three prognostic groups irrespective of type of therapy.
(72) Administration of the pharmaceutical compositions at selected dosage ranges and routes typically elicits a beneficial response as defined by the European Group for Blood and Marrow transplantation (EBMT) in Table 1, below (taken from U.S. Pat. No. 8,632,772).
(73) TABLE-US-00003 TABLE 1 lists the EBMT criteria for response: EBMT/IBMTR/ABMTR.sup.1 Criteria for Response Complete No M-protein detected in serum or urine by Response immunofixation for a minimum of 6 weeks and fewer than 5% plasma cells in bone marrow Partial >50% reduction in serum M-protein level Response and/or 90% reduction in urine free light chain excretion or reduction to <200 mg/24 hrs for 6 weeks.sup.2 Minimal 25-49% reduction in serum M-protein level Response and/or 50-89% reduction in urine free light chain excretion which still exceeds 200 mg/24 hrs for 6 weeks.sup.3 No Change Not meeting the criteria or either minimal response or progressive disease Plateau No evidence of continuing myeloma-related organ or tissue damage, <25% change in M- protein levels and light chain excretion for 3 months Progressive Myeloma-related organ or tissue damage Disease continuing despite therapy or its reappearance in plateau phase, >25% increase in serum M- protein level (>5 g/L) and/or >25% increase in urine M-protein level (>200 mg/24 hrs) and/or >25% increase in bone marrow plasma cells (at least 10% in absolute terms).sup.2 Relapse Reappearance of disease in patients previously in complete response, including detection of paraprotein by immunofixation .sup.1EBMT: European Group for Blood and Marrow transplantation; IBMTR: International Bone Marrow Transplant Registry; ABMTR: Autologous Blood and Marrow Transplant Registry.
(74) Additional criteria that can be used to measure the outcome of a treatment include near complete response and very good partial response. A near complete response is defined as the criteria for a complete response (CR), but with a positive immunofixation test. A very good partial response is defined as a greater than 90% decrease in M protein (see, e.g., Multiple Myeloma Research Foundation, Multiple Myeloma: Treatment Overview 9 (2005)).
(75) The degree to which administration of the composition elicits a response in an individual clinically manifesting at least one symptom associated with MM, depends in part, on the severity of disease, e.g., Stage I, II, or III, and in part, on whether the patient is newly diagnosed or has late stage refractory MM. Thus, in some embodiments, administration of the pharmaceutical composition elicits a complete response.
(76) In some embodiments, administration of the pharmaceutical composition elicits a very good partial response or a partial response. In other embodiments, administration of the pharmaceutical composition elicits a minimal response. In other embodiments, administration of the pharmaceutical composition prevents the disease from progressing, resulting in a response classified as no change or plateau by the EBMT.
(77) Computer Implemented Embodiments
(78) Information from the eCyPA levels and other test results can implemented in computer programs executed on programmable computers that include, inter alia, a processor, a data storage system (including volatile and non-volatile memory and/or storage elements), at least one input device, and at least one output device. Program code can be applied to input data to perform the functions described above and generate output information. The output information can be applied to one or more output devices, according to methods known in the art. The computer may be, for example, a personal computer, microcomputer, or workstation of conventional design.
(79) In some embodiments, the a machine-readable storage medium can comprise a data storage material encoded with machine readable data or data arrays which, when using a machine programmed with instructions for using the data, is capable of use for a variety of purposes, such as, without limitation, subject information relating to a diagnosing a type or subtype of ovarian cancer, evaluating the effectiveness of a treatment (e.g., surgery or chemotherapy).
(80) Each program can be implemented in a high level procedural or object oriented programming language to communicate with a computer system. However, the programs can be implemented in assembly or machine language, if desired. The language can be a compiled or interpreted language. Each such computer program can be stored on a storage media or device (e.g., ROM or magnetic diskette or others as defined elsewhere in this disclosure) readable by a general or special purpose programmable computer, for configuring and operating the computer when the storage media or device is read by the computer to perform the procedures described herein.
(81) The health-related data management system of the invention may also be considered to be implemented as a computer-readable storage medium, configured with a computer program, where the storage medium so configured causes a computer to operate in a specific and predefined manner to perform various functions described herein.
(82) Bone Marrow Scaffolding Substrates
(83) Also provided by the invention is a composition that includes a biocompatible substrate and bone marrow-derived endothelial cells (BMEC) admixed with a biocompatible substrate. The BMEC cells express eCyPA in an amount sufficient to stimulate proliferation or migration of multiple myeloma (MM) cells. In some embodiments, the substrate is a poly-caprolactone scaffolding (PCLS). To admix the BMEC with a biocompatible substrate, the PCLS is pre-coated with fibronectin.
(84) Other Malignancies and Conditions
(85) While illustrated with multiple myeloma cells, the methods and compositions described herein can be adapted for any malignancy in which increased cyclophilin A levels or activity promotes proliferation and/or migration of malignant cells to bone marrow, and/or is associated with CD147 expression. This includes chronic lymphocytic leukemia (CLL) and lymphoplasmacytic lymphoma (LPL) (see examples below showing eCyPA affects these cells in ways similar to its effects on MM cells).
(86) Additional conditions include precursor conditions or other conditions related to MM, such as Monoclonal Gammopathy of Undetermined Significance (MGUS), smoldering myeloma, asymptomatic MM, and symptomatic MM, ranging from newly diagnosed to late stage relapsed/refractory.
(87) Additional non-limiting examples of hematopoietic cancers for which methods of the invention can be used include leukemias (myeloid and lymphoid types), and lymphomas of B- and T-cell lineages), polycythermis vera and other myeloproliferative diseases. Examples of leukemias include acute lymphoblastic leukemia (ALL), adult T cell leukemia (ATL), acute myeloblastic leukemia (AML) and chronic myeloid leukemia (CML). The method can also be used to treat carcinomas that frequently metastasize to the bone marrow such as breast and prostate cancers.
(88) In addition, the methods disclosed herein are useful in treating inflammation generally. The screening methods are useful for identifying new therapeutic agents for treating inflammation. Similarly, the methods discussed above can be used in diagnosing, prognosis, efficaciousness and assessing the progression of inflammation in a subject.
(89) The invention will be further illustrated in the following non-limiting examples. The examples show that B-cell malignancies frequently colonize the bone marrow (BM). New insights into the pathogenesis of these malignancies suggest that cells in the BM microenvironment play a critical role. Using multiple myeloma (MM) as a model of a terminally differentiated B-cell neoplasm that selectively colonizes the BM, and taking advantage of a broadly adaptable mouse xenograft model system employing bone-like scaffolds coated with human BM-derived cells, we demonstrated that BM-derived endothelial cells (BMECs), but not BM-derived stromal cells (BMSCs), secrete cyclophilin A (eCyPA), an extracellular pleiotropic signaling factor that promotes migration, growth, and BM colonization of MM cells via binding to its cognate receptor, CD147, on MM cells. The clinical/translational implications of this work are highlighted by the observation of significantly higher eCyPA levels in BM serum than in peripheral blood (PB) of the same MM patient, and that blockade of the eCyPA/CD17 axis supresses BM-homing and tumor growth in a mouse xenograft model of MM. Furthermore, eCyPA also promotes cell migration in chronic lymphocytic lymphoma and lymphoplasmacytic lymphoma, two other B-cell malignancies that colonize the BM and express CD147. Taken together, these findings provide evidence of a possible link between chronic inflammation, immune dysregulation, and the pathogenesis of these B-cell malignancies. Importantly, our findings also offer a compelling rationale for targeting the eCPA/CD147 signaling complex as a novel treatment approach for these malignancies.
(90) The examples offer experimental, as well as clinical and translational, evidence of a novel molecular mechanism for the migration and BM homing of MM cells. We document that eCyPA, but not its homolog CyPB, is produced in (
(91) Although CyPA was initially recognized as the host cell receptor for the potent immunosuppressive drug Cyclosporine A, recent studies have revealed that it can be secreted by cells in response to inflammatory stimuli. Secreted eCyPA can initiate a signaling response in target cells and is a potent neutrophil, eosinophil, and T cell chemoattractant 31-34. Studies aimed at establishing the mechanism whereby eCyPA mediates its chemotactic activity have identified CD147 as the principal signaling receptor for eCyPA. Indeed, all human 37 and mouse 32 leucocytes examined to date require CD147 expression for eCyPA-mediated chemotaxis to occur.
(92) CD147, also known as Extracellular Matrix Metalloproteinase Inducer (EMPRIN), is a type I integral transmembrane glycoprotein that belongs to the immunoglobulin super family. It plays critical roles in intercellular communication involved in chronic inflammation, immune-related functions, tumor metastasis and angiogenesis, and HIV infection. CD147 induces expression of the matrix metallopeptidases required for tumor invasion and metastasis via cell-cell and cell-matrix interactions. Recently, expression of CD147 has been broadly correlated with progression in ovarian, hepatocellular, bladder, cervical, lung, and gallbladder carcinomas, as well as hematological malignancies such as MM.
(93) In regard to MM, we show that CyPB, although tested at much higher concentrations than those in BM serum of MM patients (
Example 1
General Materials and Methods
(94) Patient Samples and Cell Lines
(95) BM specimens were obtained from patients with MM or from normal donors in accordance with Dana-Farber Cancer Institute Review Board protocols, and with informed consent in compliance with the Helsinki Declaration. BM mononuclear cells were isolated with the aid of a Ficoll gradient, and BMECs as well as MM primary cells were isolated using CD34 or CD138 magnetic beads (Miltenyi Biotec, Auburn, Calif.), respectively, as described in Sukhedo et al., Proc. Nat. Acad. Sci. (USA) 104:7516-7521 (2007). Primary BMECs and primary BMSCs from the same MM patient were prepared as follows: after Ficoll gradient, BM mononuclear cells were treated with collagenase, and single-cell suspensions were placed on plastic dishes. When only attached cells remained in the cultures, they were divided into two fractions and one was stored without further processing for subsequent use as BMSCs. From the other fraction, we purified BMECs using CD34 immunomagnetic beads. Purified BMECs cells were further expanded in culture ex-vivo and their identity confirmed by FC and immunoblot analysis using several endothelial cell markers (CD31, VEGF R1, CD138, and Factor VIII). Primary CLL and LPL cells were purified using CD19 magnetic beads (Miltenyi Biotec, Auburn, Calif.). All primary cells were >90% pure and fresh for functional studies or stored in liquid nitrogen for other subsequent studies. Established MM cell lines (MM1S, ABNL6, U266, H929, OPM2, and RPMI) were all from the Carrasco laboratory. The HG3 (CLL) and BCWM.1 (LPL) cells were provided by Drs. Wu and Treon, respectively. Human BM-derived endothelial cell lines BMEC-60 and HBME-1 were kindly provided by Drs. van der Schoot and Giuliani, respectively. The stromal cell line HS5 was obtained from Dr. Mitsiades's lab. All cells were grown at 37 C. under a 5% CO.sub.2 humidified atmosphere in RPMI 1640 medium supplemented with 10% fetal bovine serum (FBS). All cell lines were routinely tested using Human Cell Line Genotyping System (Promega), and were periodically surveyed for mycoplasma contamination with the help of a commercial detection kit (LT07-218, Lonza). Serum from BM and PB of MM patients were obtained from the Jerome Lipper Multiple Myeloma Center, Dana-Farber Cancer Institute. Studies with human subjects were approved by the Dana-Farber Cancer Institute Review Board Committee (IRB #01-206), and informed consent was obtained from all subjects.
(96) Scaffold Mouse Xenograft Model
(97) 210.sup.6 BMEC-60 cells, HS5 cells, PBMEC or PBMSC were trypsinized and seeded into poly--caprolactone polymeric scaffolds generously provided by Dr. Tassone (see Calimeri et al., Leukemia 25: 707-711 (2011). Scaffolds were first coated with 50 g/ml fibronectin (Santa Cruz). The seeded scaffolds were cultured in vitro for 2 weeks and implanted s.c. in the right or left flank of five-week old non--irradiated CB17.Cg-PrkdcscidLystbg-J/Crl male mice (Charles River). Two weeks later, 510.sup.6 luciferase-labeled MM1S or H929 cells were injected via the tail-vein into scaffold-implanted mice. Tumor burden was analyzed on the basis of luciferase bioluminescence using an LAS-4000 Luminescent Imager Analyzer (Fujifilm). Mice were euthanized 4 weeks later and the scaffolds removed for histological and IHC examination as described in Mani et al., Cancer Res.69: 7577-86, 2009. Experiments were repeated independently three times. Animal experiments were approved by the Dana-Farber Cancer Institute Institutional Animal Care and Use Committee (IRB#10-039) and were in compliance with ethical practice. All the experiments were performed blindly, as the investigator who implanted the mouse did not know the content of the scaffolds. In animal studies using the Xenograft scaffold system, one experiment was excluded because MM1S-luc or H929-luc cells grew within both the BMEC-60 coated scaffold and the spine and skull of the mouse, precluding optimal evaluation using the Xenogen system.
(98) For in vivo treatment with CD147 Ab, the mouse scaffold system was modified as follows: scaffolds were pre-coated with BMEC-60 cells, incubated with MM1S-luc cells, and then implanted into the flank of non--irradiated CB17.Cg-PrkdcscidLystbg-J/Crl mice. One week post-implantation the mice were subjected to whole-body imaging, and those with a comparable tumor burden were selected for Ab therapy. Mice were injected with 100 l of a solution containing either 100 ng of isotype Ab or anti-CD147 Ab sc every other day in a region adjoing the scaffold. Tumor growth within each scaffold was evaluated by Xenogen imaging every five days. After 15 days, the scaffolds were removed and processed for histological and IHC analysis.
(99) Complement-Dependent Cytotoxicity (CDC)
(100) MM.1S-Luc cells (110.sup.6) were labeled with Calcein-AM (1 g/ml, Technologies, Grand Island, N.Y.) for 30 min in a CO.sub.2 incubator at 37 C., washed twice with fresh mouse medium, and then cultured for 1 h with anti-CD147 Ab or isotype control Ab (10 g/ml), in the absence or presence of mouse serum (20% final concentration). Cells were spun down and fluorescence in the supernatant was measured using a 490 nm excitation filter and a 520 nm emission filter. Percent specific lysis was calculated from the formula % Lysis=(Sample RFUBackground RFU/Total RFUBackground RFU)100.
(101) Immunoblot Analysis
(102) Total protein samples were prepared from non-attached H929 and MM1S cells grown in CM from cultures of BMEC-60 or BMEC-1 cells attached for 72 hr. In some experiments, the cells were co-cultured with BMEC-60 cells using transwell chambers (Corning Costar, 0.45 m pore diameter). Immunoblotting was performed as described in Takada et al., Sci. Transl. Med. 4, 148ra117 (2012). When MM1S and H929 cells were treated with eCyPA or CD147 Ab, they were first incubated with eCyPA or CD147 Ab for 5 hrs in serum-free medium. Then 0.5% serum was added, and incubation was resumed for another 72 hrs before performing protein preparation. Anti-human primary antibodies included: BCL9 (2D4, Abnova), CyPA (ERPR7511, Abcam), CD147 (#13287, Cell Signaling), pSTAT3 (#9131, Cell Signaling), pERK (#4370, Cell Signaling), PARP (#9542, Cell Signaling), pAKT (#9271, Cell Signaling), Active--catenin (05-665, Millipore), Factor VIII (A0082, DAKO), MMP-9 (MAB911, R&D), CyPB (MAB5410, R&D), and horseradish peroxidase(HRP)-conjugated actin (C-11, Santa Cruz). Actin Ab was used as a loading control. Secondary antibodies included: anti-rabbit IgG (HRP)-conjugated (W402b, Promega), and anti-mouse IgG (HRP)-conjugated (W401b, Promega). Protein concentrations were measured in triplicate by Bradford assay (BioRad). Optimal antibody concentrations were used according to the manufacturer's recomendations.
(103) Lentiviral Infection
(104) Validated expression plasmids for pLKO-shCyPA: #1, CCGGGTTCCTGCTTTC ACAGAATTACTCGAGTAATTCTGTGAAAGCAGGAACTTTTTG (SEQ ID NO:3); #2, CCGGCTGACTGTGGACAACTCGAATCTCGAGATTCGAGTTGTCCACAGTCA GTTTTTG (SEQ ID NO:4) and pLKO-shCD147: #1, CCGGCCAGAATGACAAAGGCAAGAACTCGAGT (SEQ ID NO:5) TCTTGCCTTTGTCATTCTGGTTTTT (SEQ ID NO:6); #2, CCGGACAGTCTTCACTACCGTAGAACTCGAGTTCTACGGTAGTGAAGACTGTT TTTTG (SEQ ID NO:7) were purchased from Sigma. The pLKO-Control-shRNA and pLKO-shBCL9 expression vectors are described in Mani et al., Cancer Res. 69: 7577-7586 (2009). Lentiviral packaging and infection of MM1S-luc and BMEC-60 cells was done according to manufacturer's protocol (Sigma). To minimize off-target effects of shRNAs, we implemented a series of assay conditions: i) shRNAs were designed to target the 3UTR region, ii) the effect of the target shRNAs had to differ from that of a control shRNA containing scrambled nucleotide sequences, iii) the phenotypic response had to be reproducible using two distinct target shRNAs (#1 and #2), and iv) identical results had to be obtained with more than one targeted cell.
Cell Migration Assays
(105) For cell migration assays, the top chamber of transwell plates (8 M pore diameter, Corning Costar) was seeded with 210.sup.5 MM1S-luc cells, and the bottom chamber was seeded with either medium (0.1% FBS) alone, BMEC-60 cells, BMEC-60 cell-conditioned medium, or plain medium containing CyPA and/or CD147. After 12 hrs of incubation, MM1S-luc cells that had migrated to the bottom chamber were collected and quantified by Xenogen Imaging. Migration of RPMI, U266, CLL, LPL, or primary tumor cells was evaluated by counting the number of unlabeled cells in the lower chamber. Each experiment was done in triplicate and repeated twice. Recombinant HPLC-purified eCyPA was purchased from BioMart Inc. and eCyPB (PPIB) human recombinant protein was purchased from Abnova. In most instances, 50 ng/ml of eCyPA or eCyPB diluted in serum-free RPMI medium was used. CM was collected from confluent cultures of BMEC-60 cells incubated for 48 hours. When needed, the CM was treated with 100 g/ml proteinase K (19133, Qiagen) for 2 hrs and then deactivated for 15 min at 70 C. Anti-CD147 (UM-8D6) antibody and monoclonal mouse IgG1 (MOPC31C) were obtained from Ancell; anti-CXCR4 (MAB171) was from R&D systems. Migration data were normalized using the data obtained with medium alone. Results are meansSD for triplicate assays.
(106) Reporter Assays
(107) Luciferase activity was measured using the Dual Luciferase Reporter Assay System (Promega), as described in Mani et al., Cancer Res. 69: 7577-7586 (2009). To measure Wnt reporter activity, BMEC-60 cells were transfected with TOP-FLASH, FOP-FLASH plasmid (Millipore), along with an internal Renilla control plasmid (hRL-null). Transfection was performed using FuGENE (Roche) according to the manufacturer's protocol. The results were normalized to control for Renilla activity. The reported data represent the average of three independent transfection experiments in triplicate.
(108) Cell Proliferation and Viability Assays
(109) Cell proliferation was evaluated by [.sup.3H]TdR incorporation as described in Mani et al., Cancer Res. 69: 7577-7586 (2009). When proliferation of MM cells was determined in the presence of HS5 or BMEC-60 cells, the latter were previously gamma-irradiated (10,000 rads) and dispensed into 96-well plates. Then, MM1S and H929 cells were co-cultured with either BMEC-60 cells, CM alone, CyPA, or CyPB for 72 hrs. Viability of MM1s-Luc cells were co-cultured with BMEC-60 cells and then treated with drugs as described was assessed, using the tumor cell-specific in vitro bioluminescence imaging (SS-BLI).
(110) Histopathological and IHC Analysis
(111) Tissue sections were processed as described in Mani et al., Cancer Res. 69: 7577-7586 (2009). Human tissue samples were obtained from the Department of Pathology, Brigham and Women's Hospital. Sections were incubated with primary antibodies (5 g/ml) or the corresponding IgG fraction of pre-immune serum overnight at 4 C. in blocking solution (3% BSA/PBS). Anti-human primary specific antibodies included: BCL9 (ab37305, Abcam), CD138 (PN IM 2757, Beckman Coulter), CD34 (M71165, DAKO), ERG (5115-1, Epitomics), Caspase-3 (#9664, Cell Signaling), CD147 (MEM-M6/1, LifeSpan BioSciences), CyPA (ERPR7511, Abcam) and CyPB (AV44365, Sigma); and were visualized with the aid of the corresponding biotinylated antibody coupled to streptavidin-peroxidase complex (Vector Labs). For CD147 immunohistochemistry, non-decalcified BM clots were used. For negative controls, tissue sections were incubated in the absence of primary antibodies or pre-immune serum from the species of origin of the primary antibody. Optimal antibody concentrations were used according to manufacturer's recommendation.
(112) Immunofluorescence
(113) Single-cell suspensions were spun onto glass slides using a cytocentrifuge (Shandon) or were grown on polylysine-coated slides (p8920, Sigma), as described in Mani et al., Cancer Res. 69: 7577-7586 (2009). Cells were fixed at room temperature in 2% paraformaldehyde for 20 min, permeabilized in TBS-Tween 20 for 20 min, washed three times in PBS, and then blocked with 5% bovine serum albumin in PBS for 2 h before addition of primary antibodies against BCL9 (ab37305, Abcam), -catenin (CAT5-H10, Zymed), Myeloperoxidase (A0398, DAKO), CyPA (ERPR7511, Abcam), Alexa Fluor 647-conjugated CD147 (HIM6, Biolegend), or FITC-conjugated CD138 (MI15, Becton Dickinson). Cells were incubated overnight with primary antibodies at 4 C., and then washed three times in PBS before staining with secondary antibodies conjugated to Alexa Fluor 488 (A11034, Molecular Probes) or Alexa Fluor 546 (A11035, Molecular Probes). Images were acquired with the aid of a Bio-Rad Radiance 2000 laser scanning confocal or Nikon Eclipse E800 phase-contrast microscope. Optimal antibody concentrations were used according to manufacturer's recommendations.
(114) Flow Cytometry (FC)
(115) Harvested cells in aliquots of up to 110.sup.6 cells/100 L were dispensed into FACS tubes and stained for FC, as described Mani et al., Cancer Res. 69: 7577-7586 (2009). Anti-human antibodies included: CD147-Alexa Fluor 647 (HIM6, Biolegend), CD147-PE (8D12, eBioscience), CD19-FITC (SJ25C1, Becton Dickinson), CD19-APC (HIB19, Becton Dickinson), CD5-FITC (53-7.3, Becton Dickinson), CD138-APC (MI15, Becton Dickinson), and isotype control mouse IgG1 (P3.6.2.8.1, Bioscience). Optimal antibody concentrations were used according to manufacturer's recommendations.
(116) ELISA
(117) Serum levels of eCyPA and eCyPB in BM and peripheral blood samples from MM patients were measured by ELISA according to the manufacturer's protocols for eCyPA (KA1176, Abnova), eCyPB (ABIN414776, USCN Life Science), and SDF-1 (DSA00, R&D), respectively. For the measurement of eCyPA, eCyPB, and SDF-1 from cell supernatants, 110.sup.6 cells were dispensed in triplicate into 12-well plates and cultured for different times. The spent medium was then replaced with an equal volume of fresh medium, the incubation was resumed for another 12 h, and finally triplicate samples of supernatant containing equal amounts of total protein were used for ELISA analysis. Standard curves were linear, and 100 ul of each sample was used for analysis in triplicate.
(118) Mass Spectrometry (MS)
(119) Bands excised from silver-stained gels were cut into approximately 1 mm.sup.3 pieces, and the latter were analyzed by mass spectrometry, as described in Peng et al., J. Mass Spectrom. 36: 1083-1091 (2001) and Levanon et al., Oncogene 29: 1103-1113 (2010). BMEC secretomes were analyzed directly, according to a previously described protocol (Ria et al., Clin. Cancer Res. 15: 5369-5378 (2009)). Approximately 110.sup.6 BMEC-60 cells were lentivirally transduced with control shRNA or shBCL9. These, along with HS5 cells, PBMEC #1, and PBMEC #2, were dispensed into 12-well plates, which were kept for 6 h at 37 C. under 5% CO.sub.2, and rinsed twice with 2 ml of PBS. Then, 200 l of fresh PBS was added and the cells were incubated at 37 C. under 5% CO.sub.2 for another 24 h. Supernatants were collected and centrifuged for 5 min at 300 rpm to remove floating cells, and the amount of total protein in each sample was measured. Total protein was loaded onto agarose gels in amounts commensurate with the decreased levels resulting from BCL9 knockdown; after electrophoresis, the gels were silver-stained according to the manufacturer's protocol (Bio-Rad 161-0449). The remaining aliquots were processed for LC-MS/MS analysis. Proteins were reduced with 10 mM DTT at 56 C. for 1 h, alkylated with 22.5 mM IAA for 30 min at room temperature in the dark, and digested with 2.5 g of trypsin (Promega) at 37 C. overnight. Peptides were desalted using POROS10R2 (Applied Biosystems) and reconstituted with 0.1% TFA. Peptides were then analyzed by LC-MS/MS on an Orbitrap-XL mass spectrometer (Thermo Scientific), as described in Ficarro et al., Anal. Chem. 81: 3440-3447 (2009). MS/MS spectra were searched against a forward-reversed human NCBI Refseq database using Mascot (Matrix Science, version 2.2.1), and were filtered to a 1% false-discovery rate. Five different criteria were used to select proteins from MS raw data: 1) molecular weights had to be <28 kDa; 2) more than two unique target peptides had to be identified for each protein; 3) peptides giving an overly weak signal were discarded; 4) the protein was cytoplasmic or secreted; 5) nucleoprotein or cytoskeleton proteins were excluded.
(120) Statistical Analysis
(121) Statistical differences between groups were estimated by means of the unpaired Student's t-test, with p0.05 being considered significant. Analysis of tumor burden was done using factorial analysis in SPSS 13.0. mRNA expression of CD147 (GSE6477) was measured in BM plasma cells from a normal subject or a MM patient. All experiments were done blindly, without the investigator's knowing the identity of the samples, which were labelled only with code numbers.
Example 2
The BCL9 Oncogene Promotes Proliferation of Bone-Marrow-Derived Endothelial Cells
(122) BM angiogenesis is a hallmark of MM progression and a positive correlate of disease activity (
Example 3
Bone Marrow Endothelial Cells (BMECs) Promote Proliferation and Survival of MM Cells
(123) For a long time, BM-derived stromal cells were considered to be the main and only cell type with which MM cells interact functionally. However, once BM angiogenesis was recognized as a positive correlate of disease activity (
Example 4
Bone Marrow Endothelial Cells Promote Migration and Bone Marrow Colonoization of Multiple Myeloma Cells
(124) Since activation of the ERK pathway has been previously implicated in promoting cell migration, our finding of enhanced pERK expression in MM cells co-cultured with BMEC-60 cells (
(125) To further investigate the role of BMECs in the migration and chemoattraction of MM cells in vivo, we used a scaffold mouse xenograft system. Fibronectin-precoated scaffolds were cultured alone or in the presence of BMEC-60 or HS5 cells for two weeks until uniform coating of the scaffold meshwork was observed. Scaffolds were implanted subcutaneously at different sites in the flank of the same non--irradiated CB17.Cg-PrkdcscidLystbg-J/Crl mouse, as depicted in
Example 5
BCL9 Knockdown in BMECs Reduces Migration and Growth of MM Cells
(126) We knocked down expression of BCL9 in BMECs (
Example 6
Proteomic Analysis Identifies eCyPA and eCyPB as Signaling Factors Secreted by BMECs
(127) The foregoing results prompted us to perform proteomic analysis to identify signaling molecules secreted by BMECs, whose expression is regulated by BCL9, and that promote chemoattraction, migration, and proliferation of MM cells. Silver-stained agarose gels revealed qualitative and quantitative differences, particularly among lower-molecular weight proteins, in CM from BMEC-60 cells lentivirally transduced with control-shRNAs or BCL9-shRNAs, as compared with medium alone. The same was observed in HS5 cells, indicating secretion of a discrete protein by the control BMEC-60 cells, but not the others (
(128) Both procedures provided a large number of potential candidates with molecular weights of <28 kD that are known to be secreted into media, have known signaling functions, and were detected by both procedures in BMEC-60 as well as in primary BMECs. Among these, the most likely candiates in all cell supernatants were eCyPA and eCyPB (
(129) TABLE-US-00004 TABLE 2 Proteomics Analysis of BMEC-60 Gene Symbol Description MW Proteomics Analysis of Silver Stained Gel Bands Band 1 YWHAB Tyrosine 3-Monooxygenase/14-3-3 28082 Da protein beta/alpha YWHAG Tyrosine 3-Monooxygenase/14-3-3 28303 Da protien gamma PSMA3 Proteasome subnit alpha type-3 28433 Da Band 2 TAGLN2 Transgelin 2 22391 Da PRDX1 Peroxiredoxin 1 22110 Da LZIC Leucine Zipper And CTNNBIP 1 21495 Da Domain Containing Band 3 CyPB Peptidylprolyl Isomerase B 23743 Da percursor (PPIB) PRDX1 Peroxiredoxin 1 22110 Da TAGLN2 Transgelin 2 22391 Da Band 4 TANGLN2 Transgelin 2 22391 Da CFL1 Cofilin 1(non-muscle) 18502 Da GGCT Gamma-glutamylcyclotransferase 21008 Da Band 5 STMN1 Stathmin 1 17303 Da CyPA Peptidylprolyl isomerase A 18012 Da (PPIA) SOD1 Superoxide dismutase 1, 15936 Da soluble Band 6 STMN1 Stathmin 1 17303 Da ACP1 Acid Phosphatase 1, Soluble 18042 Da SOD1 Superoxide dismutase 1, 15936 Da soluble Whole Proteomics Analysis APCS Serum amyloid P component 25387 Da precursor PRDX6 Peroxiredoxin 6 25035 Da UCHL1 Ubiquitin carboxyl-terminal 24824 Da esterase L1 CyPB Peptidylprolyl isomerase B 23743 Da precursor (PPIB) GSTP1 Glutathione transferase 23356 Da ARHGDIA Rho GDP dissociation inhibitor 23207 Da (GDI) alpha ARHGDIB Rho GDP dissociation inhibitor 22988 Da (GDI) beta TAGLN2 Transgelin 2 22391 Da PEBP1 Prostatic binding protein 21057 Da GLO1 Glyoxalase I 20778 Da HN1L Hemalological and neurological 20063 Da expressed 1-like CFL1 Cofilin 1 (non-muscle) 18502 Da CyPA Peptidylprolyl isomerase A (PPIA) 18012 Da COTL1 Coactosin-like 1 15945 Da SOD1 Superoxide dismutase 1, soluble 15936 Da FABP5 Fatty acid binding protein 5 15164 Da (psoriasle-associated) PFN1 Profilin 1 15054 Da LGALS1 Galectin-1 14716 Da MTPN Myatrophin 12895 Da MIF Marcrophage migration inhibitory 12476 Da factor TXN Thioreoxin 11737 Da RPLP2 Ribosomal protein P2 11665 Da CSTB Cystatin B 11140 Da HSPE1 Heat shock 10 kDa protein 1 10932 Da
(130) TABLE-US-00005 TABLE 3 Proteomics Analysis of PBMEC #1 and PBMEC #2 Gene Symbol Description Mw Whole Proteomics Analysis of PBMEC #1 CyPA peptidylprolyl isomerase A 18012 Da TXNDC17 thioredoxin-like 5 13941 Da CLIC1 chloride intracellular channel 1 26923 Da MYL6 myosin, light chain 6, alkali, smooth 16930 Da muscle and non-muscle isoform 1 UCHL1 ubiquitin carboxyl-terminal esterase L1 24824 Da COTL1 coactasin-like 1 15945 Da BASP1 brain abundant, membrane attached signal 22693 Da protein 1 PARK7 Parkinson disease protein 7 19891 Da PRDX2 peroxiredoxin 2 isoform a 21785 Da GSTM4 glutathione 5-transferase rsu 4 isoform 1 25561 Da GSTP1 glutathione transferase 23256 Da LGALS1 galectin-1 14716 Da PRDX1 peroxiredoxin 1 22110 Da PEBP1 proslatic binding protein 21057 Da PEA15 phosphoprotein enriched in astrocytes 15 15040 Da TPT 1 Tumor protein, translationlly-controlled 1 19595 Da YWHAZ Tyrosine 3/tryptophan 5-monooxygenase 27771 Da activation protien, zeta ARHGDIA Rho GDP dissociation inhibitor (GDI) 23207 Da alpha GSTO1 Glutathione-S-transferase omega 1 27566 Da PRDX6 Peroxiredoxin 6 25035 Da TAGLN Transgelin 22611 Da PGLS 6-phosphogluconolactonase 27547 Da CyPB Peptidylprolyl isomerase B precursor 23743 Da YWHAB Tyrosine 3-Monooxygenase/14-3-3 protein 28062 Da beta/alpha YWHAG Tyrosine 3-Monooxygenase/14-3-3 protein 28303 Da gamma CAPNS1 Calpain, small subunit 1 28316 Da Whole Proteomics Analysis of PBMEC #2 CyPa Peptidylprolyl isomerase A 18012 Da ORM1 Orosomucoid 1 precursor 23512 Da BASP1 Brain abundant, membrane attached 22693 Da signal protein 1 SDC2 Syndecan 2 precursor 22160 Da APCS Serum amyloid P component precursor 25367 Da CALM2 Calmodulin 2 18838 Da CSTB Cystatin B 11140 Da GSTP1 Glutathione transferase 23356 Da LGALS1 Galectin-1 14716 Da PRDX1 Peroxiredoxin 1 22110 Da PEBP1 Prostatic binding protein 21057 Da TAGLN2 Transgelin 2 22391 Da TTR Transthyrelin precursor 15587 Da YWHAH Tyrosine 3-Monooxygenase/14-3-3 protein 26219 Da eta ARHGDIA Rho GPD dissociation inhibitor (GDI) 23407 Da alpha PRDX6 Peroxiredoxin 6 25035 Da CyPB Peptidylprolyl isomerase B precursor 25743 Da C1QC Complement component 1, q subcomponent, 25774 Da C chain precursor NME2 Nucleoside diphosphate kinase B 17298 Da PGAM1 Phosphoglycerate mutase 1 26804 Da [Homo sapiens]
(131) Immunohistochemical studies also revealed that BM myeloid cells express significant amounts of CyPA, but not CyPB (
(132) The foregoing results prompted us to next examine serum levels of eCyPA and eCyPB in MM patients. To this end, serum from BM and PB collected from the same patient at the time of diagnosis were analyzed by ELISA. As shown in
(133) eCyPA levels were also examined in MGUS, SMM, MM patients, and MM treated patients.
Example 7
eCyPA Promotes Migration, Proliferation and Bone Marrow Homing of Multiple Myeloma Cells
(134) Because of the documented role of CyPA in neutrophil migration, it was of interest to further probe the role of eCyPA in MM cell migration in vitro and in vivo. As shown in
(135) We next examined the role of eCyPA in vivo using the scaffold xenograft mouse model (
Example 8
CyPA Promotes Migration and Growth of MM Through the CD147 Receptor
(136) Because recent studies have established CD147 as the principal signaling receptor mediating extracellular chemotaxis by eCyPA, we evaluated CD147 expression in MM cells using flow cytometric, immunohistochemical, and gene expression profiling analysis (Affimetrix). These studies showed that most myeloma cell lines, including MM1S-luc (
(137) We then evaluated whether CD147 inactivation on MM cells could block the action of eCyPA. Knockdown of CD174 expression in MM1S and H929 cells with CD147-shRNAs (
Example 9
Targeting the eCyPA/CD147 Complex for Multiple Myeloma Therapy
(138) To test the targeting of the eCyPA/CD147 complex as a potential strategy for clinical MM therapy, we first evaluated whether an anti-CD147 Ab known to inhibit neutrophil migration in a mouse model of inflammation 35 also inhibits MM cell migration. Transwell assays revealed that eCyPA-induced MM1S-luc cell migration was markedly reduced if the cells were pre-treated with the CD147 Ab (
(139) Our observation of decreased pSTAT in MM cells either transduced with CD147-shRNA (
Example 10
Decreased CD147 Expression in Circulating MM Cells
(140) Since our previous results indicated that eCyPA secreted by BMECs is an important driver of BM homing by MM cells via binding of the CD147 receptor expressed on MM cells, we measured CD147 expression in plasma cells from the lymph nodes and BM of healthy subjects, as well as in cells in plasma cells from BM and PB of MM patients. Due to the paucity of plasma cells in BM and lymph nodes of normal individuals as well as their relatively small numbers in the PB of MM patients, immunoblotting studies were not feasible. In these instances, therefore, CD147 expression was determined by double-wavelength immunofluorescence analysis of cytospin preparations using CD138 as a plasma cell marker. These studies revealed that all BM plasma cells analyzed in 10/10 MM patients expressed high CD147 levels (
Example 11
CLL and LPL Cells Express CD147 and Migrate in Response to eCyPA
(141) Since CLL and LPL are B-cell malignancies that, like MM, preferentially colonize the BM, it was of interest to also examine whether cell lines and primary tumor cells derived from patients express CD147, and whether eCyPA is chemotactic to these cells. Immunostains (
(142) On the basis of the present findings and the generally recognized trafficking model of normal lymphocytes and BM recruitment of hematopoietic stem cells (HSCs), we propose a mechanism that could explain both the preferential BM colonization of MM cells during early stages of disease and loss of preferential homing during the late stages of disease progression (e.g., plasma cell leukemia) (
(143) The role we have uncovered for the eCyPA/CD147 complex in MM identifies this interaction as an attractive target for therapeutic intervention. Agents potentially disruptive of this interaction can be grouped into those that can directly target CD147, eCyAP, or their mutual interaction, or those which act indirectly via inhibition of the Wnt/-catenin/BCL9 transcriptional complex. Indeed, using CD147 Ab as a tool to block eCyPA- and BMECs-induced migration of MM cells (
(144) In summary, our studies have uncovered a pivotal role of the eCyPA/CD147 axis in the functional interaction between MM cells and BMECs that contributes to BM homing as well as initiation and/or progression of MM, and have established an important functional link between the oncogenic Wnt/-catenin/BCL9 pathway and the eCyPA/CD147 system which implicates chronic inflammation in the pathogenesis of MM. Translational applications of our studies to the clinical setting include: (1) identifying biomarkers of disease progression within the eCyPA/CD147 cascade, and (2) developing novel therapies which target eCyPA/CD147 interactions in MM and other B-cell malignancies that preferentially colonize and grow within the BM niche.
(145) It is to be understood that the foregoing description is intended to illustrate and not to limit the scope of the invention, which is defined by the scope of the appended claims. Other embodiments are within the scope of the following claims.