BAG3 as biochemical serum and tissue marker
10359433 ยท 2019-07-23
Assignee
Inventors
Cpc classification
G01N2800/324
PHYSICS
G01N2800/325
PHYSICS
G01N2333/47
PHYSICS
C12Q1/6883
CHEMISTRY; METALLURGY
International classification
G01N33/53
PHYSICS
C12Q1/6883
CHEMISTRY; METALLURGY
Abstract
The present invention concerns the field of diagnostic biological markers. Specifically the invention relates to anti-BAG3 antibodies for use as biological markers for the diagnosis of a pathological state. Furthermore, the invention involves specific ELISA methods and kits, for detecting and evaluating, anti-BAG3 antibodies or BAG3/antibody complexes in a biological sample.
Claims
1. A method for detecting the level of an immune complex of an anti-BAG3 autoantibody bound to soluble BAG3 (Bcl2-associated athanogene 3) in a biological sample, comprising: a. obtaining a biological sample from serum, plasma, urine, or saliva of a human; b. contacting the biological sample with a microplate coated with an anti-BAG3 antibody to bind the immune complex in the biological sample, if present, to the microplate; and c. detecting the level of the bound immune complex with an anti-human IgG antibody.
2. The method according to claim 1, wherein the microplate is coated with an anti-BAG3 antibody AC-1, AC-2, or AC-3.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14) Representative images of BAG3 staining using the monoclonal anti-BAG3 antibody AC-1 in normal pancreas tissue. Sections were counterstained with hematoxylin. Staining revealed a moderate positivity of Langerhans islets, while normal pancreatic ducts and pancreatic acinar cells had no BAG3 expression.
(15)
(16) Representative images of BAG3 low positive and BAG3 high positive tumor samples stained using a monoclonal anti-BAG3 antibody revealed with a biotinylated secondary antibody. Sections were counterstained with hematoxylin. Two different magnifications are shown: 100 (left panels) and 400 (right panels). We assigned a score based on the proportion of positive cancer cells in the sample by counting the number of positive cells over the total cancer cells in 10 non-overlapping fields using a 400 magnification. The median percentage of BAG3 positive cells, calculated as described, was 40% and this value was used as a cut-off to separate low and high positive samples.
(17)
(18) Survival curves were made comparing 39 patients with low BAG3 staining (40% of positive cells) and 27 patients with high BAG3 staining (>40% of positive cells). All patients analyzed underwent R0 resection of the pancreatic adenocarcinoma. Median survival increases from 12 months in the high positive group to 23 months in the low positive group. Log-rank test p-value=0.0013.
(19)
(20)
(21)
(22) bag3 mRNA relative expression evaluated by qRT-PCR is shown in a graph where values are reported as mean+S.D. The blue line represents the median value calculated.
(23)
(24) Survival analysis was made for all patients analyzed with qRT-PCR. 13 patients with high bag3 expression had shorter survival (median survival=19.0 months) as compared to 12 patients with low bag3 expression (median survival=32.0 months). Log-rank test p-value=0.0198.
(25)
(26) Pancreatic cancer cell lines (PSN1, Capan-1, AsPC-1, PANC-1 and MIA PaCa-2) were treated with different concentrations of gemcitabine as indicated in the graph. After 48 hours, apoptotic cell death was analyzed. Graph depicts mean percentage of Sub G0/G1 cells (S.D.). Data are representative of three independent experiments.
(27)
(28) Western blot analysis of BAG3 in pancreatic cancer cell lines; GAPDH housekeeping protein contents were used to monitor equal loading conditions.
(29)
(30) MIA PaCa-2 and PANC-1 cell lines were treated with 2 M gemcitabine (GEM) for the indicated times BAG3 protein expression levels were monitored by western blot.
(31)
(32) bag3 mRNA levels were analyzed by RT-PCR; graph depicts relative bag3 mRNA levels (S.D.) and data are representative of three indipendent experiments.
(33)
(34) MIA PaCa-2 and PANC-1 cell lines were transfected with BAG3 siRNA or a non-targeted siRNA (NTsiRNA) for 72 hours and then treated with 2 M gemcitabine (GEM) for 24 h. BAG3 levels were analyzed by western blot and GAPDH levels were detected to monitor equal loading conditions.
(35)
(36) MIA PaCa-2 and PANC-1 cells were transfected as described above and treated with 2 aM gemcitabine (GEM) for 24 h or 48 h. Apoptotic cell death was analyzed as described. Graph depicts mean percentage of Sub G0/G1 cells (S.D.). Data are representative of three independent experiments.
(37)
(38)
(39)
(40) Results are plotted as arbitrary unitsS. P value was calculated with student's t test.
DETAILED DESCRIPTION OF THE INVENTION
(41) The present invention concerns anti-BAG3 antibodies for use as biochemical markers in the diagnosis of a pathological state.
(42) With the term diagnosis in the present invention we refer to medical diagnosis (often simply termed diagnosis) that refers to the process of attempting to determine or identify a possible disease or disorder. The diagnosis of the present invention encompasses also the early diagnosis
(43) With the term early diagnosis we refer to the capacity of the test to discriminate a pathological state before specific or aspecific symptoms.
(44) Anti-BAG3 antibodies have now been advantageously detected in serum, plasma, urine or saliva. Until now such antibodies had never been found in serum either in physiological or pathological condition. The detection of anti-BAG3 antibodies in serum has the advantage of being a rapid and non-invasive technique be exploited for diagnostic, early diagnosis and prognostic purposes, risk stratification, as a tool for the identification and for monitoring therapies.
(45) A further advantage of the detection of antibodies is that a very small amount of serum is required for the detection. In fact, soluble BAG3 protein can also be detected in the serum of patients suffering from some pathologies, but the amount of serum requested for the detection of the soluble protein is much higher than that required for the detection of antibodies. Furthermore, it is possible that soluble BAG3 protein levels can be much lower than those of antibodies and/or that, respect to soluble BAG3 protein, antibodies can be detectable in earlier phases of specific pathologies and/or can more efficiently predict risk of complications or monitor the effects of therapies.
(46) A further embodiment of the present invention is that said anti-BAG3 antibodies can be advantageously detected in different biological samples selected from serum, plasma, urine or saliva.
(47) In the present invention, by serum is intended the component of blood that is neither a blood cell nor a clotting factor; it is the blood plasma with the fibrinogens removed. Serum includes all proteins not used in blood clotting (coagulation) and all the electrolytes, antibodies, antigens, hormones, and any exogenous substances.
(48) In the present invention, by plasma is intended the straw-coloured/pale-yellow liquid component of blood that normally holds the blood cells in whole blood in suspension. It contains clotting factors, such as fibrinogens.
(49) In a further embodiment, the invention provides the use of anti-BAG3 antibodies as biochemical markers, wherein said anti-BAG3 antibodies are bound to soluble BAG3 to form immune complexes.
(50) Anti-BAG3 antibodies, either free or bound to soluble BAG3 to form immune complexes have advantageously been now detected in a biological sample, and may be used as a marker in the diagnosis of a pathological condition. The detection of such antibodies and/or immune complexes in a biological sample also has the advantage of being a rapid and non-invasive technique for diagnostic and/or prognostic purposes.
(51) According to a preferred embodiment of the present invention said diagnosis is in vivo or ex vivo.
(52) A further embodiment of the present invention is that recipient of said diagnosis is a mammalian, preferably a human.
(53) In the present invention, by immune complex or protein/antibody complex is intended the integral binding of an antibody to a soluble antigen, the bound antigen acting as a specific epitope, bound to an antibody is referred to as a singular immune complex.
(54) Such immune complexes have the same advantages seen as for the detection of antibodies, since a very small amount of serum is required also for the detection of the immune complex. The amount of serum required for the detection of soluble BAG3 is much higher also than that required for the detection of the protein/antibody (immune) complexes. Immune complexes as well as free antibodies can be detectable in earlier phases of specific pathologies and can more efficiently predict risk of complications or monitor the effects of therapies.
(55) A still further embodiment of the invention is the use of anti-BAG3 antibodies or said immune complexes (formed by anti-BAG3 antibodies bound to soluble BAG3) as biological markers of a pathological state, wherein said pathological state is a heart disease, cancer, diabetes, inflammation and inflammatory related diseases of the skin, nerves, bones, blood vessels and connective tissues.
(56) Preferably said heart disease is selected from the group consisting of: angina pectoris, pre-infarction angina, ischemia, myocardial infarction, heart failure, acute coronary disease, acute heart failure, chronic heart failure and iatrogenic heart disease.
(57) According to a preferred embodiment of the present invention said cancer is selected from: pancreatic cancer, bladder cancer and prostate cancer.
(58) A further embodiment of the present invention is a method for detecting the presence of an anti-BAG3 antibody or an anti-BAG3 antibody bound to soluble BAG3 to form an immune complex in a biological sample, comprising the steps of: a. obtaining a biological sample, consisting of serum, plasma, urine or saliva, b. determining the presence of anti-BAG3 or BAG3 associated antibodies in the biological sample.
(59) The method according to the present invention has the advantage of allowing to detect significant differences between anti-BAG3 antibodies and/or BAG3/antibodies complexes between healthy individuals and patients affected by BAG3-involving pathologies. The proposed assay method allows a statistically significant separation of the group of cardiac patients from the group of healthy people. It can also stratify such patients with heart disease in subgroups of patients at increased risk (heart failure, HF).
(60) In a still further aspect the invention relates to a method for detecting the presence of an anti-BAG3 antibody in a biological sample or an anti-BAG3 antibody bound to soluble BAG3 to form an immune complex, further comprising the step of: c. comparing the values obtained from the biological sample with reference values or with the values obtained from healthy donors.
(61) In a preferred aspect the method according to the present invention is a method wherein said determination step b. is performed by an ELISA test.
(62) According to a preferred embodiment in the method of the present invention said serum, plasma, urine or saliva is from a mammalian, preferably a human.
(63) The method according to the present invention has the advantage of allowing the rapid and non-invasive detection of the biological markers allowing the evaluation of pathologies, risks for diseases and/or their complications, and monitoring of therapies.
(64) According to a further aspect the invention relates to a detection method wherein the presence of said anti-BAG3 antibody or said anti-BAG3 antibody bound to soluble BAG3 to form an immune complex is associated with a pathological condition.
(65) In a preferred embodiment said pathological condition is chosen from the group consisting of heart disease, cancer, diabetes, inflammation and inflammatory related diseases of the skin, nerves, bones, blood vessels and connective tissues.
(66) In particular said heart disease is selected from the group consisting of: angina pectoris, pre-infarction angina, myocardial infarction, ischemia, heart failure, acute coronary disease, acute heart failure, chronic heart failure or iatrogenic heart disease.
(67) According to a preferred embodiment of the present invention said cancer is selected from: pancreatic cancer, bladder cancer and prostate cancer.
(68) The invention further relates to an ELISA kit for the detection of anti-BAG3 antibodies or anti-BAG3 antibodies bound to soluble BAG3 to form an immune complexes in a biological sample.
(69) The ELISA kit according to the present invention comprises a BAG3 recombinant protein for capturing anti-BAG3 antibodies or BAG3-specific mouse monoclonal antibodies AC-1, AC-2, AC-3, AC-4, AC-5, AC-rb1a, AC-rb1b, AC-rb2a, AC-rb2b, AC-rb3a, AC-rb3b, AC-rb4a and AC-rb4b, for capturing soluble BAG3 and antibodies able to recognize human immunoglobulins.
(70) Such antibodies can be enzyme-linked antibodies able to recognize human immunoglobulins.
(71) The invention also relates to a kit for the detection of BAG3-associated antibodies in a biological sample and is performed by ELISA with BAG3-specific mouse monoclonal antibodies AC-1, AC-2, AC-3, AC-4, AC-5, AC-rb1a, AC-rb1b, AC-rb2a, AC-rb2b, AC-rb3a, AC-rb3b, AC-rb4 and AC-rb4b, for capturing soluble BAG3 and enzyme-linked antibodies for the detection able to recognize human immunoglobulins.
(72) Preferably said biological sample is a serum, plasma, urine or saliva sample.
(73) In a preferred embodiment of the present invention said serum, plasma, urine or saliva sample is from a mammalian, preferably a human.
(74) The invention still further relates to a immunohistochemistry (IHC) kit for the detection of BAG3 protein in a biological sample, wherein said biological sample is preferably a tissue sample. Tissue samples can be biopsies, frozen tissues, paraffin embedded tissues.
(75) The IHC kit according to the present invention comprises BAG3-specific antibodies and reagents including probes needed for the staining.
(76) Said BAG3-specific antibodies can be mouse monoclonal antibodies AC-1, AC-2 and AC-3 and/or enzyme-linked antibodies for the detection able to recognize mouse immunoglobulins.
(77) In particular, the IHC kit advantageously allows to reveal BAG3 protein in 100% of pancreatic carcinoma tissue samples from patients that undergo pancreas resection and is expressed in most bladder carcinoma samples. Furthermore, BAG3 protein can be revealed with the kit for BAG3 detection by IHC also in normal pancreas tissue in Langerhans islets while other normal tissues result negative (such for example normal urocystis). BAG3 positivity can be also observed in synovial fibroblasts and inflammatory infiltrates in rheumatoid arthritis tissue samples.
(78) Long-term survival of patients affected by PDAC is very poor: only about 4% of patients will live 5 years after diagnosis. Indeed, surgical reception is presently the only chance of cure, but only approximately 20% of patients are diagnosed with resectable disease; furthermore, in a large proportion (about 80%) of such subset of patients the metastatization process is already occurring at diagnosis, and indeed distant metastases appear after surgical resection. Hence we need to better understand early stages in the development of pancreatic cancer and identify molecules that can allow detecting them. Also, markers that can allow a better prognosis and help the choice of therapies are highly required.
(79) Advantageously the BAG3 IHC kit allows the identification of the prognosis of PDAC patients. It was seen that the intensity of BAG3 expression identified by IHC, correlates with patients' survival. Therefore it can be used for both prognosis and for making a choice of therapy.
(80) A still further aspect of the invention is a kit for the detection of BAG3 gene expression in a biological sample comprising a set of amplification primers. Preferably said amplification primers are suitable for the detection by quantitative real-time RT-PCR.
(81) Specific primers bag3 primers according to primer sets 1 to 5, which are described below and identified by the SEQ ID NO. 1 to SEQ ID NO. 10, allow the detection and quantification of BAG3 expression by quantitative real-time PCR.
(82) TABLE-US-00001 Primerset1 fw:SEQIDNO.1: AACGGTGACCGCGACCCTTT; rev:SEQIDNO.2: CCTTCCCTAGCAGGCGGCAG Primerset2 fw:SEQIDNO.3: CCGGCTGGCCCTTCTTCGTG; rev:SEQIDNO.4: CAGCCTAGAGCCCTCCCGGG Primerset3 fw:SEQIDNO.5: GTCACCTCTGCGGGGCATGC; rev:SEQIDNO.6: GGTGACTGCCCAGGCTGCTC Primerset4 fw:SEQIDNO.7: CCAGCCTCCCACGGACCTGA; rev:SEQIDNO.8: CTGGTGACTGCCCAGGCTGC Primerset5 fw:SEQIDNO.9: CAGGAGCAGCACGCCACTCC; rev:SEQIDNO.10: TGGTCCAACTGGGCCTGGCT.
(83) The RT-PCR kit for bag3 mRNA detection in a biological sample allows to correlate the levels of bag3 gene expression with patients' survival and can be used for prognosis and for choice of therapy. Preferably said biological sample is a tissue sample.
(84) A still further aspect of the invention is represented by anti-BAG3 monoclonal antibodies, their fragments, and peptides corresponding to specific aminoacidic sequences of BAG3 protein that are able to block macrophage activation and can therefore be used for therapy of inflammatory, oncologic or other diseases involving macrophage activation. See in particular
(85) This invention relates to the use of BAG3-specific mouse monoclonal antibodies AC-1, AC-2 and AC-3 or same modified as F(ab), F(ab)2, F(ab) or humanized; or peptides comprising sequences as follows:
(86) TABLE-US-00002 PEP1: (SEQIDNO.11) DRDPLPPGWEIKIDPQ PEP2: (SEQIDNO.12) SSPKSVATEERAAPS PEP3: (SEQIDNO.13) DKGKKNAGNAEDPHT PEP4: (SEQIDNO.14) NPSSMTDTPGNPAAP
as molecules able to bind and/or block soluble BAG3 effects.
EXAMPLES
Example 1
(87) Serum Deprivation-Induced Stress in Cultured Human Primary Cardiomyocytes and the Rat Cardiomyocyte Cell Line H9c2
(88) Cardiomyocytes are known to release protective factors in mounting a response against stressful agents. Since stress-induced proteins, such as Hsp70, Hp27, Hsp90 and others, although exerting an intracellular activity, can also be secreted in response to stress, BAG3 release by cardiomyocytes was analyzed in stressful conditions. For this purpose, we analyzed the effect of serum deprivation-induced stress in cultured human primary cardiomyocytes or the rat cardiomyocyte cell line H9c2. As shown in
(89) To further verify the existence of a soluble form of BAG3, we investigated its presence in two blood sera from patients affected by chronic heart failure (CHF). Through western blot analysis, we could identify a band recognized by anti-BAG3 antibody. We excised the band and subjected it to mass spectrometry, confirming its identity (
(90) Peptides recognized and matched by mass spectrometry on the entire BAG3 protein sequence are indicated in bold:
(91) TABLE-US-00003 (SEQIDNO:15) MSAATHSPMMQVASGNGDRDPLPPGWEIKIDPQTGWPFFV DHNSRTTTWNDPRVPSEGPKETPSSANGPSREGSRLPPAR EGHPVYPQLRPGYIPIPVLHEGAENRQVHPFHVYPQPGMQ RFRTEAAAAAPQRSQSPLRGMPETTQPDKQCGQVAAAAAA QPPASHGPERSQSPAASDCSSSSSSASLPSSGRSSLGSHQ LPRGYISIPVIHEQNVTRPAAQPSFHQAQKTHYPAQQGEY QTHQPVYHKIQGDDWEPRPLRAASPFRSSVQGASSREGSP ARSSTPLHSPSPIRVHTVVDRPQQPMTHRETAPVSQPENK PESKPGPVGPELPPGHIPIQVIRKEVDSKPVSQKPPPPSE KVEVKVPPAPVPCPPPSPGPSAVPSSPKSVATEERAAPST APAEATPPKPGEAEAPPKHPGVLKVEAILEKVQGLEQAVD NFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQAR RDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQP LQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATS NPSSMTDTPGNPAAP.
(92) The human BAG 3 protein has the amino acid sequence according to SEQ ID NO:15.
Example 2
(93) Anti-BAG3 Antibodies in CHF Patients' Sera
(94) We found that sera from CHF patients recognized BAG3 protein in western blotting, using an anti-human IgG as secondary antibody (results representative of experiments with sera from three different patients are shown in
Example 3
(95) BAG3 Binding to Macrophages
(96) We addressed the functional significance of BAG3 release by cardiomyocytes. We excluded that the protein could be involved in an autocrine pathway, because it did not apparently bind to the cardiomyocyte surface, as we assessed in experiments using fluorescein isothiocyanate (FITC)-conjugated BAG3 (
(97) TABLE-US-00004 TABLE I FITC-rBAG3 FITC-BSA Competiton assays % of % of % of positive positive positive % cells (S.D.) cells (S.D.) cells (S.D.) inhibition FITC-rBAG3 15.7 (0.45) FITC-BSA 4.04 (0.06) (FITC-rBAG3)- 11.06 (0.45) (FITC-BSA) FITC-rBAG3 + 0.18 (0.05) 98.4 Pep1 FITC-rBAG3 + 1.21 (0.63) 89.1 Pep2 FITC-rBAG3 + 5.86 (0.43) 47.2 Pep3 FITC-rBAG3 + 0.68 (0.20) 93.8 Pep4 FITC-rBAG3 + 12.1 (0.21) 0.0 Pep Scr FITC-rBAG3 + 12.3 (0.40) 0.0 Mouse IgG F(ab)2 FITC-rBAG3 + 14.7 (0.20) 0.0 Rabbit IgG F(ab)2 FITC-rBAG3 + 4.11 (0.26) 62.8 AC1 IgG F(ab)2 FITC-rBAG3 + 3.76 (0.43) 66.0 AC2 IgG F(ab)2 FITC-rBAG3 + 3.19 (0.21) 71.1 TOS2 IgG F(ab)2
(98) To explore functional consequences of BAG3 binding to macrophages, we tested the effect of recombinant BAG3 on the expression of inducible nitric oxide synthase (iNOS) and cyclooxygenase (Cox)-2 in the cells. As shown in
(99) In sera from CHF patients we could detect significant amounts of anti-BAG3 antibodies (
(100) Therefore, production of anti-BAG3 antibodies, detected by ELISA, appears a biomarker of chronic heart failure. Its utility for risk stratification and therapy monitoring is worthy of investigation.
(101) BAG3 release by stressed cardiomyocytes and subsequent activation of macrophages, leading to local release of NO, might constitute a protective circuit in heart ischemia.
(102) Indeed, vasodilation, neoangiogenesis and remodelling might be targeted. BAG3 release and its transient or chronic effects deserve investigation and could contribute to our understanding of ischemia and other heart stress states.
(103) Furthermore, BAG3-specific mouse monoclonal antibodies AC-1, AC-2 and AC-3 and/or others or same modified as F(ab), F(ab)2, F(ab) or humanized; or peptides comprising sequences PEP 1 to 4 and/or others are molecules able to bind and/or block soluble BAG3 effects to be used for therapy of inflammatory, oncologic or other diseases involving macrophage activation.
Example 4
(104) BAG3 Expression in PDAC by Immunohistochemistry.
(105) We have developed an immunohistochemistry (IHC) kit, including our anti-BAG3 monoclonal antibodies and able to detect BAG3 protein by immunohistochemistry (IHC). This kit revealed BAG3 expression in all the 346 (100%) PDAC biopsies that we analyzed. BAG3 staining revealed a moderate positivity of Langerhans islets, while normal pancreatic ducts and pancreatic acinar cells had no BAG3 expression. This was true in both normal pancreas and non-neoplastic pancreatic tissue adjacent to the tumor mass. BAG3 staining was observed predominantly in the cytoplasm of tumor cells. The intensity of staining of BAG3 was variable as was the number of positive cancer cells. Furthermore, Langerhans insulae were positive and constituted a good internal control of IHC (
(106) We investigated also the expression of BAG3 in correlation with patients' survival and in response to therapy. We analyzed a cohort of 346 PDAC samples from the same number of patients (Table II) describing data of all tumour samples analyzed by immunohistochemistry and data of the subgroup of R0 patients analyzed with survival data; We assigned a score based on the proportion of positive cancer cells in the sample by counting the number of positive cells over the total cancer cells in 10 non-overlapping fields using a 400 magnification.
(107) TABLE-US-00005 TABLE II Nodal stage N No. age sex Local tumor stage T (%) (%) Tumor grade G (%) Tot average S.D. M F T1 T2 T3 T4 N0 N1 G1 G2 G3 PDAC patients data 346 63.0 10.5 181 165 5 59 264 18 130 216 16 177 153 (1.4) (17.1) (76.3) (5.2) (37.6) (62.4) (4.6) (51.2) (44.2) PDAC patients with 66 61.9 11.3 36 30 0 1 65 0 13 53 3 37 26 survival data (0.0) (1.5) (98.5) (0.0) (19.7) (80.3) (4.5) (56.1) (39.4)
(108) The median percentage of BAG3 positive cells, calculated as described, was 40% and this value was used as a cut-off to separate low and high positive samples. Based on this classification 190 patient samples (55%) were classified as low positive (40% of positive cells), and 156 (45%) were classified as high positive (>40% of positive cells) (
(109) TABLE-US-00006 TABLE III Parameter HR 95% CI p-value Age (years) 0.99 0.97-1.02 0.601 Sex (M vs. F) 0.86 0.48-1.55 0.617 Tumor grade (G2 vs. G1) 0.84 0.24-2.98 0.789 Tumor grade (G3 vs. G1) 1.55 0.45-5.37 0.486 Local tumor stage (T3 vs. T2) 2.5 0.30-21.17 0.400 Nodal stage (N1 vs. N0) 1.17 0.58-2.37 0.668 BAG3 Positivity (High vs. Low) 2.7 1.53-4.78 <0.001 events = 66 n = 66
Example 5
(110) BAG3 Protein in Response to Therapy
(111) The first-line chemotherapy for treatment of pancreatic cancer is gemcitabine. In order to investigate the role of BAG3 protein in response to therapy, we analyzed the effect of BAG3 down-modulation in human PDAC cells. We transfected the cells with a specific siRNA targeting bag3 mRNA or with a non specific (NT) siRNA, and treated cells with gemcitabine for the indicated times. Silencing of BAG3 enhanced cell apoptosis in response to the drug (
(112) These results demonstrate the over expression of BAG3 protein and mRNA in pancreatic adenocarcinoma and the association of high expression levels with a higher risk of death, assigning to BAG3 a role of marker useful for prognosis and therapy choice. Furthermore they show that BAG3 down-modulation enhances apoptosis in PDAC cells. Due to its wide expression in all the lesions tested and to its involvement in sustaining pancreatic cancer cell survival, BAG3 represents a valuable target for innovative therapies in PDAC.
Example 6
(113) BAG3 Protein in Sera of Pancreatic Cancer Patients
(114) Because of its wide expression in pancreatic cancer patients, we investigated whether BAG3 was present in sera of pancreatic cancer patients. We found that indeed BAG3 was detectable. Also anti-BAG3 antibodies were detectable, although in prevalence complexed with BAG3. We therefore developed an ELISA test for detecting BAG3/antibody complexes. We analyzed sera from 51 healthy donors and 55 patients affected by PDAC (Table IV).
(115) TABLE-US-00007 TABLE IV AGE N (T0T) (median + s.e.) M F healthy donors 51 58.7 + 1.6 35 16 PDAC patients 55 64.0 + 1.3 30 25
(116) As shown in
Example 7
(117) BAG3 Expression by Quantitative Real-Time PCR
(118) The immunohistochemical data on BAG3 expression was also confirmed measuring bag3 mRNA levels in 25 PDAC tissue samples (Table V).
(119) TABLE-US-00008 TABLE V Nodal stage N sex Local tumor stage T (%) (%) Tumor grade G (%) No. Tot age average + S.D. M F T1 T2 T3 T4 N0 N1 G1 G2 G3 25* 65.4 11.9 21 4 2 (8.0) 3 (12.0) 20 (80.0) 6 (24.0) 19 (76.0) 3 (12.5) 13 (54.2) 8 (33.3)
(120) In particular, there were 16 survivors out of the 25 patients, while 9 patients died of pancreatic cancer progression, at the time of the analysis. The median of expression of bag3 mRNA in tumors analyzed was set at 0.0068 (Q1=0.004; Q3=0.010) (
(121) bag3 primers that detect BAG3 expression by quantitative real-time RT-PCR. We developed a RT-PCR kit containing specific primers for bag3 mRNA detection and quantification.
Example 8
(122) We evaluated BAG3 antibodies levels prior to diagnosis of PDAC in a case control study set within the prospective biobank derived from UKCTOCS (Menon et al., BMJ, 337:a2079, 2008). The trial cohort of 202,000 postmenopausal women donated a single serum at recruitment and 50,000 women continued to donate serum samples annually.
(123) Women diagnosed with pancreatic cancer post-randomisation were identified by cancer registry data and postal follow up questionnaires.
(124) For these women diagnosed for PDAC we obtained sera samples at different time points prior PDAC diagnosis. Control sera were obtained from healthy subjects and we measure BAG3 antibody titers in about five control subjects compared to each PDAC case. Furthermore, control sera came from subjects age matched with the respective PDAC case. This control sera matching was used for each time point.
(125) Detection of BAG3-specific antibodies in patients sera from 49 female subjects at 0-1 years pre diagnosis for pancreatic adenocarcinoma were compared with sera from 235 female control subjects sera for the presence of BAG3 specific antibodies in a specific ELISA test.
(126) BAG3 antibodies concentrations were detected in a specific ELISA assay.
(127) As shown in
(128) Others time points included: 53 subjects at 1-2 years pre diagnosis for PDAC compared to 251 controls; 44 subjects at 2-3 years pre diagnosis for PDAC compared to 212 controls; 42 subjects at 3-4 years pre diagnosis for PDAC compared to 187 controls.
(129) As shown in
(130) Methods
(131) Cell Cultures
(132) HCMa (Human Cardiac Myocytes-adult) were purchased from Sciencell Research Laboratories (San Diego, Calif.) and grown in Cardiac Myocyte Medium (CMM, FBS 5%, Cardiac Myocyte Growth Supplement 1%, penicillin/streptomycin solution 1%) (Sciencell Research Laboratories, San Diego, Calif.). All experiments were performed on low-passage cell cultures. Embryonic rat cardiomyoblasts (line H9c2) was purchased from the American Type Culture Collection (ATCC, Manassas, Va., USA) and grown in Dulbecco's Modified Eagle's Medium (DMEM) supplemented with 10% fetal bovine serum (FBS), 100 U/mL penicillin and 100 g/mL streptomycin. J774A.1, murine monocyte macrophage cell line (ATCC, Manassas, Va., USA), was grown in DMEM supplemented with 10% fetal bovine serum (FBS), 25 mM HEPES, 2 mM glutamine, 100 u/mL penicillin and 100 g/mL streptomycin.
(133) The pancreatic cancer cell lines (MIA PaCa-2, AsPC-1, PSN1, Capan-1 and PANC-1) were received from the American Type Culture Collection (ATCC; Manassas, Va.) cell bank. MIA PaCa-2 cells were cultured in Dulbecco's Modified Eagle's Medium (DMEM) and supplemented with 10% FBS and 2.5% horse serum. AsPC-1 and PSN1 cells were grown in RPMI-1640 Medium supplemented with 10% FBS. Capan-1 were cultured in RPMI-1640 containing 20% FBS while PANC-1 were cultured in DMEM supplemented with 10% FBS. All media for the above cell lines were purchased from BioWhittaker-Lonza (Bergamo, Italy) MediaTech (Manassas, Va.) and were supplemented with 100 units of penicillin/mL and 2 g streptomycin/mL (Sigma-Aldrich, St. Louis, Mo.). The cells were incubated at 37 C. in a 5% CO.sub.2 environment. Cells were treated with Gemcitabine (2,2-difluorodeoxycytidine; GEM, Gemzar) provided by Eli Lilly (Sesto Fiorentino, Italy) at the indicated concentrations.
(134) Dissociation of BAG3 Antibodies in Human Sera
(135) Sera were diluted 1:40 with dissociation buffer (PBS with 1.5% BSA and 0.2 M glycine-acetate pH 2.5) to a 500 l final volume and incubated for 20 min at room temperature. The sera were then pipetted into the sample reservoir of Microcon centrifugal filter device, YM-100 (100,000 MW cut-off; Millipore, Billerica, Mass., USA) and centrifuged at 14,100 rpm for 20 min at room temperature. The sample reservoir was then separated from the flow through, placed inverted into a second tube and centrifuged at 5,000 rpm for 3 min at room temperature. The collected solution containing the antibody dissociated was adjusted to pH 7.0 with 1 M Tris buffer, pH 9.0. The retentate volume was reconstituted to the initial volume (500 pl) with dilution buffer (PBS with 1.5% BSA and 0.1% Tween-20).14 For detection of BAG3 protein by immunoblotting, the dissociated antibodies were diluted 1:200 in TBST containing 5% bovine serum albumin overnight at 4 C.
(136) Western Blot Analysis
(137) Cells were harvested and lysed in a buffer containing 20 mM HEPES (pH 7.5), 150 mM NaCl, 0.1% Triton (TNN buffer) supplemented with a protease inhibitors cocktail (1 mM phenylmethylsulfonyl fluoride, 1 mg/ml pepstatin A, 2 mg/ml aprotinin) by 3 cycles of freezing and thawing. Soluble proteins were collected after a centrifugation at 10,000 g for 15 min and their amount was determined by Bradford assay (Bio-Rad, Hercules, Calif.). 25 g of total protein and serum samples (1:2 in PBS-T 0.05%) were run on 8% or 10% SDS-PAGE gels and electrophoretically transferred to nitrocellulose membrane. Nitrocellulose blots were blocked with 10% non-fat dry milk in TBST buffer (20 mM Tris-HCl pH 7.4, 500 mM NaCl, and 0.1% Tween 20) and incubated with primary antibodies in TBST containing 5% bovine serum albumin or 5% non-fat dry milk, overnight at 4 C. Immunoreactivity was detected by sequential incubation with horseradish peroxidase-conjugated secondary antibodies purchased from Pierce (Rockford, Ill.) and ECL detection reagents purchased from Amersham Life Sciences Inc. (Arlington Heights, Ill., USA).
(138) Scanning densitometry of the bands was performed with an Image Scan (SnapScan 1212; Agfa-Gevaert NV). The area under the curve related to each band was determined using Gimp2 software. Background was subtracted from the calculated values.
(139) Mass Spectrometry
(140) Protein bands were excised and gel pieces were subsequently washed with MilliQ Water and Acetonitrile and the proteins were digested in situ as described in Shevchenko protocol. Briefly, gel slices were reduced in 1,4-dithiothreitol (10 mM) and alkylated with iodoacetamide (50 mM), then washed and rehydrated in trypsin solution (12 ng/L) on ice for 1 h. After the addition of 30 L ammonium bicarbonate (10 mM, pH 7.5), samples were digested overnight at 25 C. 5 L of the obtained peptide mixture were injected onto a nano Acquity LC system (Waters Corp. Manchester, United Kingdom). The peptides were separated on a 1.7 m BEH C-18 column (Waters Corp. Manchester, United Kingdom) at a flow rate of 200 nl/min. The gradient (Solution A: 0.1% formic acid, solution B: 0.1% formic acid, 100% ACN) started at 5% and ended at 50% B after 55 min. MS and MS/MS data were acquired using a Q-TOF Premier mass spectrometer (Waters Corp., Micromass, Manchester, United Kingdom). Doubly and triply charged peptide-ions were automatically chosen by the MassLynx software and fragmented. MS data were automatically processed and peaklists for protein identifications by database searches were generated by the ProteinLynx software. Database searches were carried out with MASCOT server using the SwissProt protein database. The SwissProt human database (405506 sequences; 146166984 residues) was searched allowing 1 missed cleavage, carbamidomethyl (C) as fixed modification. The peptide tolerance was set to 60 ppm and the MS/MS tolerance to 0.8 Da.
(141) Purification of Exocytic Vesicles by Differential Ultracentrifugation
(142) Serum-free medium of H9c2 was cleared of cells and large debris by serial centrifugation at 4 C. (2000g for 15 min, 10,000g for 30 min). After each of the first two centrifugations, pellets are discarded, and the supernatant is kept for the next step. The final supernatant is then ultracentrifuged at 150,000g for 90 min at 4 C. (with a SW50.1 rotor, and an Optima L-90K Ultracentrifuge, Beckman Coulter) to pellet exosomes. The pellet is washed in PBS to eliminate contaminating proteins and centrifuged one last time at 150,000g for 90 min at 4 C.16 After washing, the pellet (exosomes) was resuspended in 20 l of PBS and analyzed with the anti-BAG3 TOS-2 polyclonal antibody in comparison with a whole-cell lysate by western blot. Rab-4 was analyzed as a marker for exocytic vesicles.
(143) FACS Analysis
(144) rBAG3 bindingJ774 A.1 cells were blocked with 2% FBS+0.1% NaN3 in PBS for 15 min on ice and incubated (2.5105/100 l) with different concentration of FITC-rBAG3 protein (7, 14 and 70 nm) or FITC-BSA (70 nM) in PBS containing 2% FBS+0.1% NaN3 for 30 min at 4 C. in the dark. After washing with PBS, the cells were resuspended in PBS+2% FBS+0.1% NaN3 and analyzed with a FACScan (BD Biosciences) flow cytometer.
(145) CompetitionJ774 A.1 cells (2.5105/100 l) were incubated with 625 nM of BAG3 peptides (peptide 1, peptide 2, peptide 3, peptide 4 or scrambled peptide) or with 420 nM of F(ab)2 fragments from anti-BAG3 monoclonal and polyclonal antibodies (mouse monoclonal AC1, AC2 and rabbit polyclonal TOS2) or F(ab)2 fragments from mouse IgG or F(ab)2 fragments from rabbit IgG in PBS containing 2% FBS+0.1% NaN3 for 30 min on ice. After incubation the cells were washing with PBS and then were incubated with of FITC-rBAG3 protein (14 nM), in PBS containing 2% FBS+0.1% NaN.sub.3 for 30 min at 4 C. in the dark. After washing with PBS, the cells were resuspended in PBS+2% FBS+0.1% NaN3 and analyzed by flow cytometer (BD Biosciences).
(146) IL6 Detection by ELISA
(147) IL6 was measured in supernatant of J774 A.1 cells (510.sup.4/in 96-well microplates) treated with LPS (10 ng/ml) or with rBAG3 (14 nM) or BSA (14 nM) for 10 or 20 hours in absence or presence of polymyxin B sulfate (5 g/ml). After treatment 50 L of cell culture medium were collected and analyzed in triplicate with a mouse IL6 Kit (eBioscience).
(148) Fluorescence
(149) Cells were cultured on coverslips in six-well plates to 60-70% confluence and equal amount of rBAG3-FITC and BSA-FITC proteins were added in HCMa and J774 A1 culture media with 0.1% NaN.sub.3 for 1 h. Coverslips were washed in 1PBS and fixed in 3.7% formaldehyde in 1PBS for 30 min at room temperature, and then incubated for 5 min with 1PBS 0.1M glycine. Following incubation with a 1:100 dilution of anti--integrin monoclonal antibody at 4 C., coverslips were washed three times with 1PBS. After incubation with a 1:500 dilution of goat anti-mouse IgG DyLight 594-conjugated antibodies (Jackson ImmunoResearch, West Grove, Pa., USA) at room temperature for 45 min, coverslips were again washed for three times in 1PBS. Once incubation with Hoechst 33342 (Sigma Aldrich, 2 g/ml) at room temperature for 10 min, coverslips were again washed for 3 times in PBS and then in distilled water. The coverslips were then mounted on a slide with interspaces containing 47% (v/v) glycerol. Samples were analyzed using a confocal laser scanning microscope (Zeiss LSM confocal microscope, Germany). Images were acquired in sequential scan mode by using the same acquisitions parameters (laser intensities, gain photomultipliers, pinhole aperture, objective 63, zoom 2) when comparing experimental and control material. For production of figures, brightness and contrast of images were adjusted by taking care to leave a light cellular fluorescence background for visual appreciation of the lowest fluorescence intensity features and to help comparison among the different experimental groups. Final figures were assembled using Adobe Photoshop 7 and Adobe Illustrator 10. Leica Q9 Confocal Software and ImageJ were used for data analysis.
(150) Measurement of Antibody titers by ELISA
(151) NUNC Maxisorp 96 well ELISA plates were coated with recombinant BAG3 protein 1 g/ml (50l/well) in PBS, pH 7 and incubated overnight at 4 C. Plates were washed 2 times with washing buffer (PBS+0.05% Tween-20), and then blocked (150 l/well) for one hour at room temperature with 0.5% fish gelatin in PBS. Following blocking, the plates were washed 2 times with washing buffer and sera were diluted 1:70 with 0.5% fish gelatin in washing buffer and then applied (50 l/well) in triplicate and incubated at room temperature for two hour. The plates were then washed 6 times with washing buffer. Anti-human IgG (H+L) antibody (Sigma Aldrich) was diluted 1:20,000 with 0.5% fish gelatin in washing buffer, added at 50 l/well and incubated at 4 C. for 30 minutes. After incubation, the plates were washed 6 times, developed with TMB (50 l/well) (eBioscience), the reaction stopped with 4.5 M sulfuric acid (25 l/well) and the plates were analyzed spectrophotometrically at 450 nm.
(152) NO.sub.2.sup. Assay
(153) Nitrite content (NO.sub.2.sup.), a stable metabolite of NO released by cells in the culture supernatant, was measured in J774 A.1 cells (5104/in 96-well microplates) treated with LPS (10 ng/ml) or with rBAG3 (7, 14 and 28 nM) or BSA (28 nM) for 24 hours in absence or presence of polymyxin B sulfate (Sigma-Aldrich, St. Louis, Mo., USA) 5 g/ml. NO2.sup. amounts were measured by Griess reaction. Briefly, 100 L of cell culture medium were mixed with 100 L of Griess reagentequal volumes of 1% (w:v) sulphanilamide in 5% (v:v) phosphoric acid and 0.1% (w:v) naphtylethylenediamine-HCland incubated at room temperature for 10 min, and then the absorbance was measured at 550 nm in a microplate reader Titertek (Dasit, Cornaredo, Milan, Italy). The amount of NO2- (as M) in the samples was calculated from a sodium nitrite standard curve.
(154) Measurement of BAG3/Antibody Immunocomplexes by ELISA
(155) NUNC Maxisorp 96 well ELISA plates were coated with anti-BAG3 monoclonal antibody AC-1, AC-2 or AC-3 in PBS, pH 7 and incubated overnight at 4 C. Plates were washed 2 times with washing buffer (PBS+0.05% Tween-20), and then blocked (150 l/well) for one hour at room temperature with 0.5% fish gelatin in PBS. Following blocking, the plates were washed 2 times with washing buffer and sera were diluted 1:70 with 0.5% fish gelatin in washing buffer and then applied (50 l/well) in triplicate and incubated at room temperature for two hour. The plates were then washed 6 times with washing buffer. Anti-human IgG (H+L) antibody (Sigma Aldrich) was diluted 1:20,000 with 0.5% fish gelatin in washing buffer, added at 50 l/well and incubated at 4 C. for 30 minutes. After incubation, the plates were washed 6 times, developed with TMB (50 l/well) (eBioscience), the reaction stopped with 4.5 M sulfuric acid (25 l/well) and the plates were analyzed spectrophotometrically at 450 nm.
(156) Immunohistochemistry
(157) Immunohistochemistry protocol included: deparaffination in xylene, re-hydration through descending concentrations of alcohol up to pure water, non-enzymatic antigen retrieval in citrate buffer, pH 6.0, for 30 minutes at 95 C., and endogenous peroxidase quenching with H2O2 in methanol for 20 minutes. After rinsing with PBS, the samples were blocked with 5% normal horse serum in 0.1% PBS/BSA. To detect BAG3, samples were incubated for 1 hour at room temperature with BAG3 monoclonal antibody AC-1, AC-2 or AC-3 at the concentration of 3 g/ml. After washing thoroughly with PBS, sections were incubated with a biotinylated secondary anti-mouse IgG for 20 minutes, then rinsed, incubated with avidin-biotin-complexes peroxidase (purchased from Novocastra-Leica Microsystems, Milano, IT) and developed with diaminobenzidine (Sigma-Aldrich, St. Louis, Mo.). Finally, the sections were counterstained with hematoxylin, dehydrated in alcohol, cleared in xylene, and mounted with Permount (Fisher Scientific, Milan, IT).
(158) Quantitative Real-Time RT-PCR
(159) Tissue specimens of resected pancreatic cancer were taken, immediately frozen in liquid nitrogen, and stored at 80 C. until RNA extraction. Total RNA was isolated from frozen tissues and from pancreatic cancer cell lines by means of phenol extraction (TRIzol Reagent, Invitrogen Corporation, Carlsbad, Calif., USA). In tissue samples Cancer cellularity was enriched by cryostat sectioning and dissection of most cellular areas. RNA concentration and purity (A260:A280>2.0; A260/A230>1.8) were validated by NanoDrop Spectrophotometer (Thermo Fisher, Waltham, Mass., USA). 1.0 g of total RNA was reverse-transcribed using the High-Capacity cDNA Reverse Transcription Kit according to the manufacturer's instructions (Applied Biosystems, Applera, Foster City, Calif., USA). Quantitative real-time PCR assay was used to assess the differential expression of BAG3 in tumor tissue samples. Primers for the human bag3 gene were synthesized by Primm srl (Milano, Italy) (forward primer: (SEQ ID NO:16) CCT GTT AGC TGT GGT TG; reverse primer: (SEQ ID NO:17) AAC ATA CAG ATA TTC CTA TGG C). All qPCRs were performed in a 25-l final volume, in three replicates per sample, by using QuantiFast SYBR Green PCR kit (QIAGEN, Hamburg, Germany) and run in an ABI PRISM 7700 Sequence Detection System (Applied Biosystems, Applera, Foster City, Calif., USA) according to the following conditions: 95 C. for 5 min, 40 cycles at 95 C. for 10 s and at 60 C. for 30 sec. Data were acquired as threshold cycle (Ct) value using the S.D.S software v 2.1. In each sample, bag3 mRNA relative expression levels was obtained using the comparative method, after normalizing for the expression of the endogenous GAPDH.
(160) From the above description and the above-noted examples, the advantage attained by the biological markers described and obtained according to the present invention are apparent.