NON-HUMAN ANIMALS HAVING A DISRUPTION IN A C9ORF72 LOCUS
20190216062 ยท 2019-07-18
Inventors
- Amanda Atanasio (Valhalla, NY)
- Burcin Ikiz (San Francisco, CA, US)
- Guochun Gong (Pleasantville, NY, US)
- Michael L. Lacroix-Fralish (Yorktown Heights, NY)
- Ka-Man Venus Lai (San Francisco, CA, US)
- David M. Valenzuela (Yorktown Heights, NY)
Cpc classification
A61P29/00
HUMAN NECESSITIES
A61K49/0008
HUMAN NECESSITIES
A01K2267/0318
HUMAN NECESSITIES
A61P25/28
HUMAN NECESSITIES
C12N15/8509
CHEMISTRY; METALLURGY
A01K2267/0381
HUMAN NECESSITIES
A01K2267/0393
HUMAN NECESSITIES
International classification
Abstract
A non-human animal model for neurodegenerative and/or inflammatory diseases is provided, which non-human animal comprises a disruption in a C9ORF72 locus. In particular, non-human animals described herein comprise a deletion of an entire coding sequence of a C9ORF72 locus. Methods of identifying therapeutic candidates that may be used to prevent, delay or treat one or more neurodegenerative (e.g., amyotrophic lateral sclerosis (ALS, also referred to as Lou Gehrig's disease) and frontotemporal dementia (FTD)), autoimmune and/or inflammatory diseases (e.g., SLE, glomerulonephritis) are also provided.
Claims
1. A rodent comprising in its genome a deletion of the entire coding sequence in a C9orf72 locus.
2.-14. (canceled)
15. An isolated rodent cell or tissue whose genome comprises a deletion of the entire coding sequence in a C9orf72 locus.
16. An immortalized cell line made from the isolated rodent cell of claim 15.
17. A rodent embryonic stem cell whose genome comprises a deletion of the entire coding sequence in a C9orf72 locus.
18. A rodent embryo generated from the embryonic stem cell of claim 17.
19. A method of making a rodent of claim 1, whose genome comprises a deletion of the entire coding sequence in a C9orf72 locus, the method comprising modifying the genome of a rodent so that it comprises a deletion of the entire coding sequence in a C9orf72 locus, thereby making said rodent.
20.-37. (canceled)
38. A rodent obtainable by the method of claim 19.
39. A method of identifying a therapeutic candidate for the treatment of a disease or condition in a rodent, the method comprising (a) administering a candidate agent to a rodent of claim 1; (b) performing one or more assays to determine if the candidate agent has an effect on one or more signs, symptoms and/or conditions associated with the disease or condition; and (c) identifying the candidate agent that has an effect on the one or more signs, symptoms and/or conditions associated with the disease or condition as the therapeutic candidate.
40.-42. (canceled)
43. A method of making a population of motor neurons the exhibits mitochondrial dysfunction and/or increased oxidative stress compared to wildtype motor neuron cells, the methods comprising establishing from embryoid bodies derived from a genetically engineered rodent embryonic stem (ES) cell comprising in its genome a deletion of the entire coding sequence in a C9orf72 locus, and differentiating the embryoid bodies into a population of motor neuron, wherein the population of motor neurons demonstrate mitochondrial dysfunction or increased oxidative stress compared to wildtype motor neurons.
44. The method of claim 43, wherein the deletion comprises a deletion of at least exons 2-11, in whole or in part.
45. The method of claim 43, wherein the C9orf72 locus comprises a reporter gene.
46. The method of claim 45, wherein the reporter gene is operably linked to a C9orf72 promoter.
47. The method of claim 46, wherein the C9orf72 promoter is an endogenous promoter.
48. The method of claim 43, wherein the C9orf72 locus lacks a C9orf72 genomic sequence comprising the coding portion of exon 2 through the coding portion of exon 11, and comprises a reporter gene.
49. The rodent of claim 48, wherein the reporter gene is operably linked to exon 1 of the C9orf72 locus.
50. The method of claim 43, wherein the rodent ES cell is a rat ES cell or a mouse ES cell.
51. The method of claim 43, wherein the rodent is homozygous for the deletion.
52. The method of claim 43, wherein the rodent is heterozygous for the deletion.
53. A method for screening a candidate agent for reducing mitochondrial dysfunction and/or oxidative stress in a motor neuron comprising (a) culturing the population of motor neurons made according to the method of claim 43 in the presence or absence of an agent; (b) determining whether the agent prevents, inhibits, and/or reduces mitochondrial dysfunction and/or oxidative stress in the population of motor neurons compared to a control population of motor neurons cultured in the absence of the agent; wherein the prevention, inhibition, and/or reduction of oxidative stress in the motor neurons is indicative of a candidate agent for reducing mitochondrial dysfunction and/or oxidative stress in a motor neuron.
Description
BRIEF DESCRIPTION OF THE DRAWING
[0067] The Drawing included herein, which is composed of the following Figures, is for illustration purposes only and not for limitation. The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
DEFINITIONS
[0081] This invention is not limited to particular methods and experimental conditions described herein, as such methods and conditions may vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention is defined by the claims.
[0082] Unless defined otherwise, all terms and phrases used herein include the meanings that the terms and phrases have attained in the art, unless the contrary is clearly indicated or clearly apparent from the context in which the term or phrase is used. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, particular methods and materials are now described. All publications mentioned herein are hereby incorporated by reference.
[0083] Administration includes the administration of a composition to a subject or system (e.g., to a cell, organ, tissue, organism, or relevant component or set of components thereof). Those of ordinary skill will appreciate that route of administration may vary depending, for example, on the subject or system to which the composition is being administered, the nature of the composition, the purpose of the administration, etc. For example, in certain embodiments, administration to an animal subject (e.g., to a human or a rodent) may be bronchial (including by bronchial instillation), buccal, enteral, interdermal, intra-arterial, intradermal, intragastric, intramedullary, intramuscular, intranasal, intraperitoneal, intrathecal, intravenous, intraventricular, mucosal, nasal, oral, rectal, subcutaneous, sublingual, topical, tracheal (including by intratracheal instillation), transdermal, vaginal and/or vitreal. In some embodiments, administration may involve intermittent dosing. In some embodiments, administration may involve continuous dosing (e.g., perfusion) for at least a selected period of time.
[0084] Amelioration includes the prevention, reduction or palliation of a state, or improvement of the state of a subject. Amelioration includes, but does not require complete recovery or complete prevention of a disease, disorder or condition (e.g., radiation injury).
[0085] Approximately, as applied to one or more values of interest, includes to a value that is similar to a stated reference value. In certain embodiments, the term approximately or about refers to a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
[0086] Biologically active includes a characteristic of any agent that has activity in a biological system, in vitro or in vivo (e.g., in an organism). For instance, an agent that, when present in an organism, has a biological effect within that organism is considered to be biologically active. In particular embodiments, where a protein or polypeptide is biologically active, a portion of that protein or polypeptide that shares at least one biological activity of the protein or polypeptide is typically referred to as a biologically active portion.
[0087] Comparable includes two or more agents, entities, situations, sets of conditions, etc. that may not be identical to one another but that are sufficiently similar to permit comparison there between so that conclusions may reasonably be drawn based on differences or similarities observed. Those of ordinary skill in the art will understand, in context, what degree of identity is required in any given circumstance for two or more such agents, entities, situations, sets of conditions, etc. to be considered comparable.
[0088] Conservative, when describing a conservative amino acid substitution, includes substitution of an amino acid residue by another amino acid residue having a side chain R group with similar chemical properties (e.g., charge or hydrophobicity). In general, a conservative amino acid substitution will not substantially change the functional properties of interest of a protein, for example, the ability of a, receptor to bind to a ligand. Examples of groups of amino acids that have side chains with similar chemical properties include: aliphatic side chains such as glycine, alanine, valine, leucine, and isoleucine; aliphatic-hydroxyl side chains such as serine and threonine; amide-containing side chains such as asparagine and glutamine; aromatic side chains such as phenylalanine, tyrosine, and tryptophan; basic side chains such as lysine, arginine, and histidine; acidic side chains such as aspartic acid and glutamic acid; and sulfur-containing side chains such as cysteine and methionine. Conservative amino acids substitution groups include, for example, valine/leucine/isoleucine, phenylalanine/tyrosine, lysine/arginine, alanine/valine, glutamate/aspartate, and asparagine/glutamine. In some embodiments, a conservative amino acid substitution can be a substitution of any native residue in a protein with alanine, as used in, for example, alanine scanning mutagenesis. In some embodiments, a conservative substitution is made that has a positive value in the PAM250 log-likelihood matrix disclosed in Gonnet, G. H. et al., 1992, Science 256:1443-1445. In some embodiments, a substitution is a moderately conservative substitution wherein the substitution has a nonnegative value in the PAM250 log-likelihood matrix.
[0089] Control includes the art-understood meaning of a control being a standard against which results are compared. Typically, controls are used to augment integrity in experiments by isolating variables in order to make a conclusion about such variables. In some embodiments, a control is a reaction or assay that is performed simultaneously with a test reaction or assay to provide a comparator. A control also includes a control animal. A control animal may have a modification as described herein, a modification that is different as described herein, or no modification (i.e., a wild type animal). In one experiment, a test (i.e., a variable being tested) is applied. In a second experiment, the control, the variable being tested is not applied. In some embodiments, a control is a, historical control (i.e., of a test or assay performed previously, or an amount or result that is previously known). In some embodiments, a control is or comprises a printed or otherwise saved record. A control may be a positive control or a negative control.
[0090] Disruption includes the result of a homologous recombination event with a DNA molecule (e.g., with an endogenous homologous sequence such as a gene or gene locus). In some embodiments, a disruption may achieve or represent an insertion, deletion, substitution, replacement, missense mutation, or a frame-shift of a DNA sequence(s), or any combination thereof. Insertions may include the insertion of entire genes or fragments of genes, e.g., exons, which may be of an origin other than the endogenous sequence (e.g., a heterologous sequence). In some embodiments, a disruption may increase expression and/or activity of a gene or gene product (e.g., of a protein encoded by a gene). In some embodiments, a disruption may decrease expression and/or activity of a gene or gene product. In some embodiments, a disruption may alter sequence of a gene or an encoded gene product (e.g., an encoded protein). In some embodiments, a disruption may truncate or fragment a gene or an encoded gene product (e.g., an encoded protein). In some embodiments, a disruption may extend a gene or an encoded gene product. In some such embodiments, a disruption may achieve assembly of a fusion protein. In some embodiments, a disruption may affect level, but not activity, of a gene or gene product. In some embodiments, a disruption may affect activity, but not level, of a gene or gene product. In some embodiments, a disruption may have no significant effect on level of a gene or gene product. In some embodiments, a disruption may have no significant effect on activity of a gene or gene product. In some embodiments, a disruption may have no significant effect on either level or activity of a gene or gene product.
[0091] Determining, measuring, evaluating, assessing, assaying and analyzing includes any form of measurement, and include determining if an element is present or not. These terms include both quantitative and/or qualitative determinations. Assaying may be relative or absolute. Assaying for the presence of can be determining the amount of something present and/or determining whether or not it is present or absent.
[0092] Endogenous locus or endogenous gene includes a genetic locus found in a parent or reference organism prior to introduction of a disruption, deletion, replacement, alteration, or modification as described herein. In some embodiments, the endogenous locus has a sequence found in nature. In some embodiments, the endogenous locus is a wild type locus. In some embodiments, the reference organism is a wild type organism. In some embodiments, the reference organism is an engineered organism. In some embodiments, the reference organism is a laboratory-bred organism (whether wild type or engineered).
[0093] Endogenous promoter includes a promoter that is naturally associated, e.g., in a wild type organism, with an endogenous gene.
[0094] Gene includes a DNA sequence in a chromosome that codes for a product (e.g., an RNA product and/or a polypeptide product). In some embodiments, a gene includes coding sequence (i.e., sequence that encodes a particular product). In some embodiments, a gene includes non-coding sequence. In some particular embodiments, a gene may include both coding (e.g., exonic) and non-coding (e.g., intronic) sequence. In some embodiments, a gene may include one or more regulatory sequences (e.g., promoters, enhancers, etc.) and/or intron sequences that, for example, may control or impact one or more aspects of gene expression (e.g., cell-type-specific expression, inducible expression, etc.). For the purpose of clarity we note that, as used in the present application, the term gene generally refers to a portion of a nucleic acid that encodes a polypeptide; the term may optionally encompass regulatory sequences, as will be clear from context to those of ordinary skill in the art. This definition is not intended to exclude application of the term gene to non-protein-coding expression units but rather to clarify that, in most cases, the term as used in this document refers to a polypeptide-coding nucleic acid.
[0095] Heterologous includes an agent or entity from a different source. For example, when used in reference to a polypeptide, gene, or gene product present in a, particular cell or organism, the term clarifies that the relevant polypeptide, gene, or gene product: 1) was engineered by the hand of man; 2) was introduced into the cell or organism (or a precursor thereof) through the hand of man (e.g., via genetic engineering); and/or 3) is not naturally produced by or present in the relevant cell or organism (e.g., the relevant cell type or organism type). Heterologous also includes a polypeptide, gene or gene product that is normally present in a particular native cell or organism, but has been modified, for example, by mutation or placement under the control of non-naturally associated and, in some embodiments, non-endogenous regulatory elements (e.g., a promoter).
[0096] Host cell includes a cell into which a nucleic acid or protein has been introduced. Persons of skill upon reading this disclosure will understand that such terms refer not only to the particular subject cell, but also is used to refer to the progeny of such a cell, Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the phrase host cell. In some embodiments, a host cell is or comprises a prokaryotic or eukaryotic cell. In general, a host cell is any cell that is suitable for receiving and/or producing a, heterologous nucleic acid or protein, regardless of the Kingdom of life to which the cell is designated. Exemplary cells include those of prokaryotes and eukaryotes (single-cell or multiple-cell), bacterial cells (e.g., strains of Escherichia coli, Bacillus spp., Streptomyces spp., etc.), mycobacteria cells, fungal cells, yeast cells (e.g., Saccharomyces cerevisiae, Schizosaccharomrnyces pombe, Pichia pastoris, Pichia methanolica, etc.), plant cells, insect cells (e.g., SF-9, SF-21, baculovirus-infected insect cells, Trichoplusia ni, etc.), non-human animal cells, human cells, or cell fusions such as, for example, hybridomas or quadromas. In some embodiments, the cell is a human, monkey, ape, hamster, rat, or mouse cell. In some embodiments, the cell is eukaryotic and is selected from the following cells: CHO (e.g., CHO K1, DXB-11 CHO, Veggie-CHO), COS (e.g., COS-7), retinal cell, Vero, CV1, kidney (e.g., HEK293, 293 EBNA, MSR 293, MDCK, HaK, BHK), HeLa, HepG2, WI38, MRC 5, Colo205, HB 8065, HL-60, (e.g., BHK21), Jurkat, Daudi, A431 (epidermal), CV-1, U937, 3T3, L cell, C127 cell, SP2/0, NS-0, MMT 060562, Sertoli cell, BRL 3A cell, HT1080 cell, myeloma cell, tumor cell, and a cell line derived from an aforementioned cell. In some embodiments, the cell comprises one or more viral genes, e.g., a, retinal cell that expresses a viral gene (e.g., a PER.C6 cell). In some embodiments, a host cell is or comprises an isolated cell. In some embodiments, a host cell is part of a tissue. In some embodiments, a host cell is part of an organism.
[0097] Identity, in connection with a comparison of sequences, includes identity as determined by a number of different algorithms known in the art that can be used to measure nucleotide and/or amino acid sequence identity. In some embodiments, identities as described herein are determined using a ClustalW v. 1.83 (slow) alignment employing an open gap penalty of 10.0, an extend gap penalty of 0.1, and using a Gonnet similarity matrix (MACVECTOR 10.0.2, MacVector Inc., 2008).
[0098] Improve, increase, eliminate, or reduce includes indicated values that are relative to a baseline measurement, such as a measurement in the same individual (or animal) prior to initiation of a treatment described herein, or a measurement in a control individual (or animal) or multiple control individuals (or animals) in the absence of the treatment described herein.
[0099] Isolated includes a substance and/or entity that has been (1) separated from at least some of the components with which it was associated when initially produced (whether in nature and/or in an experimental setting), and/or (2) designed, produced, prepared, and/or manufactured by the hand of man. Isolated substances and/or entities may be separated from about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% of the other components with which they were initially associated. In some embodiments, isolated agents are about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure. In some embodiments, a substance is pure if it is substantially free of other components. In some embodiments, as will be understood by those skilled in the art, a substance may still be considered isolated or even pure, after having been combined with certain other components such as, for example, one or more carriers or excipients (e.g., buffer, solvent, water, etc.); in such embodiments, percent isolation or purity of the substance is calculated without including such carriers or excipients. To give but one example, in some embodiments, a biological polymer such as a polypeptide or polynucleotide that occurs in nature is considered to be isolated when: a) by virtue of its origin or source of derivation is not associated with some or all of the components that accompany it in its native state in nature; b) it is substantially free of other polypeptides or nucleic acids of the same species from the species that produces it in nature; or c) is expressed by or is otherwise in association with components from a cell or other expression system that is not of the species that produces it in nature. Thus, for instance, in some embodiments, a polypeptide that is chemically synthesized or is synthesized in a cellular system different from that which produces it in nature is considered to be an isolated polypeptide. Alternatively or additionally, in some embodiments, a polypeptide that has been subjected to one or more purification techniques may be considered to be an isolated polypeptide to the extent that it has been separated from other components: a) with which it is associated in nature; and/or b) with which it was associated when initially produced.
[0100] Locus or Loci includes a specific location(s) of a gene (or significant sequence), DNA sequence, polypeptide-encoding sequence, or position on a chromosome of the genome of an organism. For example, a C9ORF72 locus may refer to the specific location of a C9ORF72 gene, C9ORF72 DNA sequence, C9ORF72-encoding sequence, or C9ORF72 position on a chromosome of the genome of an organism that has been identified as to where such a sequence resides. A C9ORF72 locus may comprise a regulatory element of a C9ORF72 gene, including, but not limited to, an enhancer, a promoter, 5 and/or 3 UTR, or a combination thereof. Those of ordinary skill in the art will appreciate that chromosomes may, in some embodiments, contain hundreds or even thousands of genes and demonstrate physical co-localization of similar genetic loci when comparing between different species. Such genetic loci can be described as having shared synteny.
[0101] Non-human animal includes any vertebrate organism that is not a human. In some embodiments, a non-human animal is a cyclostome, a bony fish, a cartilaginous fish (e.g., a shark or a ray), an amphibian, a reptile, a mammal, and a bird. In some embodiments, a non-human mammal is a primate, a goat, a sheep, a pig, a dog, a cow, or a rodent. In some embodiments, a non-human animal is a rodent such as a rat or a mouse.
[0102] Nucleic acid includes any compound and/or substance that is or can be incorporated into an oligonucleotide chain. In some embodiments, a nucleic acid is a compound and/or substance that is or can be incorporated into an oligonucleotide chain via a phosphodiester linkage. As will be clear from context, in some embodiments, nucleic acid refers to individual nucleic acid residues (e.g., nucleotides and/or nucleosides); in some embodiments, nucleic acid refers to an oligonucleotide chain comprising individual nucleic acid residues. In some embodiments, a nucleic acid is or comprises RNA; in some embodiments, a nucleic acid is or comprises DNA. In some embodiments, a nucleic acid is, comprises, or consists of one or more natural nucleic acid residues. In some embodiments, a nucleic acid is, comprises, or consists of one or more nucleic acid analogs. In some embodiments, a nucleic acid analog differs from a nucleic acid in that it does not utilize a phosphodiester backbone. For example, in some embodiments, a nucleic acid is, comprises, or consists of one or more peptide nucleic acids, which are known in the art and have peptide bonds instead of phosphodiester bonds in the backbone, are considered within the scope of the present invention. Alternatively or additionally, in some embodiments, a nucleic acid has one or more phosphorothioate and/or 5-N-phosphoramidite linkages rather than phosphodiester bonds. In some embodiments, a nucleic acid is, comprises, or consists of one or more natural nucleosides (e.g., adenosine, thymidine, guanosine, cytidine, uridine, deoxyadenosine, deoxythymidine, deoxyguanosine, and deoxycytidine). In some embodiments, a nucleic acid is, comprises, or consists of one or more nucleoside analogs (e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo-pyrimidine, 3-methyl adenosine, 5-methylcytidine, C-5 propynyl-cytidine, C-5 propynyl-uridine, 2-aminoadenosine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5-propynyl-uridine, C5-propynyl-cytidine, C5-methylcytidine, 2-aminoadenosine, 7-deazaadenosine, 7-deazaguanosine, 8-oxoadenosine, 8-oxoguanosine, O(6)-methylguanine, 2-thiocytidine, methylated bases, intercalated bases, and combinations thereof). In some embodiments, a nucleic acid comprises one or more modified sugars (e.g., 2-fluororibose, ribose, 2-deoxyribose, arabinose, and hexose) as compared with those in natural nucleic acids. In some embodiments, a nucleic acid has a nucleotide sequence that encodes a functional gene product such as an RNA or protein. In some embodiments, a nucleic acid includes one or more introns. In some embodiments, a nucleic acid includes one or more exons. In some embodiments, a nucleic acid is prepared by one or more of isolation from a natural source, enzymatic synthesis by polymerization based on a complementary template (in vivo or in vitro), reproduction in a recombinant cell or system, and chemical synthesis. In some embodiments, a nucleic acid is at least 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 20, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 600, 700, 800, 900, 1000, 1500, 2000, 2500, 3000, 3500, 4000, 4500, 5000 or more residues long. In some embodiments, a nucleic acid is single stranded; in some embodiments, a nucleic acid is double stranded. In some embodiments, a nucleic acid has a nucleotide sequence comprising at least one element that encodes, or is the complement of a sequence that encodes, a polypeptide. In some embodiments, a nucleic acid has enzymatic activity.
[0103] Operably linked includes a juxtaposition wherein the components described are in a relationship permitting them to function in their intended manner. A control sequence operably linked to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under conditions compatible with the control sequences. Operably linked sequences include both expression control sequences that are contiguous with the gene of interest and expression control sequences that act in trans or at a distance to control the gene of interest. The term expression control sequence includes polynucleotide sequences, which are necessary to affect the expression and processing of coding sequences to which they are ligated. Expression control sequences include: appropriate transcription initiation, termination, promoter and enhancer sequences; efficient RNA processing signals such as splicing and polyadenylation signals; sequences that stabilize cytoplasmic mRRNA; sequences that enhance translation efficiency (i.e., Kozak consensus sequence); sequences that enhance protein stability; and when desired, sequences that enhance protein secretion. The nature of such control sequences differs depending upon the host organism. For example, in prokaiyotes, such control sequences generally include promoter, ribosomal binding site and transcription termination sequence, while in eukaryotes typically such control sequences include promoters and transcription termination sequence. The term control sequences is intended to include components whose presence is essential for expression and processing, and can also include additional components whose presence is advantageous, for example, leader sequences and fusion partner sequences.
[0104] Phenotype includes a trait, or to a class or set of traits displayed by a cell or organism. In some embodiments, a, particular phenotype may correlate with a particular allele or genotype. In some embodiments, a phenotype may be discrete; in some embodiments, a phenotype may be continuous.
[0105] Physiological conditions includes its art-understood meaning referencing conditions under which cells or organisms live and/or reproduce. In some embodiments, the term includes conditions of the external or internal mileu that may occur in nature for an organism or cell system. In some embodiments, physiological conditions are those conditions present within the body of a, human or non-human animal, especially those conditions present at and/or within a surgical site. Physiological conditions typically include, e.g., a temperature range of 20-40 C., atmospheric pressure of 1, pH of 6-8, glucose concentration of 1-20 mM, oxygen concentration at atmospheric levels, and gravity as it is encountered on earth. In some embodiments, conditions in a laboratory are manipulated and/or maintained at physiologic conditions. In some embodiments, physiological conditions are encountered in an organism.
[0106] Polypeptide includes any polymeric chain of amino acids. In some embodiments, a polypeptide has an amino acid sequence that occurs in nature. In some embodiments, a polypeptide has an amino acid sequence that does not occur in nature. In some embodiments, a polypeptide has an amino acid sequence that contains portions that occur in nature separately from one another (i.e., from two or more different organisms, for example, human and non-human portions). In some embodiments, a polypeptide has an amino acid sequence that is engineered in that it is designed and/or produced through action of the hand of man.
[0107] Prevent or prevention in connection with the occurrence of a disease, disorder, and/or condition, includes reducing the risk of developing the disease, disorder and/or condition and/or to delaying onset of one or more characteristics or symptoms of the disease, disorder or condition. Prevention may be considered complete when onset of a disease, disorder or condition has been delayed for a predefined period of time.
[0108] Reference includes a standard or control agent, animal, cohort, individual, population, sample, sequence or value against which an agent, animal, cohort, individual, population, sample, sequence or value of interest is compared. In some embodiments, a reference agent, animal, cohort, individual, population, sample, sequence or value is tested and/or determined substantially simultaneously with the testing or determination of the agent, animal, cohort, individual, population, sample, sequence or value of interest. In some embodiments, a reference agent, animal, cohort, individual, population, sample, sequence or value is a historical reference, optionally embodied in a tangible medium. In some embodiments, a reference may refer to a control. A reference also includes a reference animal. A reference animal may have a modification as described herein, a modification that is different as described herein or no modification (i.e., a wild type animal). Typically, as would be understood by those skilled in the art, a reference agent, animal, cohort, individual, population, sample, sequence or value is determined or characterized under conditions comparable to those utilized to determine or characterize the agent, animal (e.g., a mammal), cohort, individual, population, sample, sequence or value of interest.
[0109] Response includes any beneficial alteration in a subject's condition that occurs as a result of or correlates with treatment. Such alteration may include stabilization of the condition (e.g., prevention of deterioration that would have taken place in the absence of the treatment), amelioration of symptoms of the condition, and/or improvement in the prospects for cure of the condition, etc. It may refer to a subject's response or to a neuron's response. Neuron or subject response may be measured according to a wide variety of criteria, including clinical criteria and objective criteria. Examination of the motor system of a subject may include examination of one or more of strength, tendon reflexes, superficial reflexes, muscle bulk, coordination, muscle tone, abnormal movements, station and gait. Techniques for assessing response include, but are not limited to, clinical examination, stretch flex (myotatic reflex), Hoffmann's reflex, and/or pressure tests. Methods and guidelines for assessing response to treatment are discussed in Brodal, A.: Neurological Anatomy in Relation to Clinical Medicine, ed. 2, New York, Oxford University Press, 1969; Medical Council of the U.K.: Aids to the Examination of the Peripheral Nervous System, Palo Alto, Calif., Pendragon House, 1978; Monrad-Krohn, G. H., Refsum, S.: The Clinical Examination of the Nervous System, ed. 12, London, H.K. Lewis & Co., 1964; and Wolf, J. K.: Segmental Neurology, A Guide to the Examination and interpretation of Sensory and Motor Function, Baltimore, University Park Press, 1981. The exact response criteria can be selected in any appropriate manner, provided that when comparing groups of neurons and/or patients, the groups to be compared are assessed based on the same or comparable criteria for determining response rate. One of ordinary skill in the art will be able to select appropriate criteria.
[0110] Risk, as will be understood from context, of a disease, disorder, and/or condition comprises likelihood that a particular individual will develop a disease, disorder, and/or condition (e.g., a radiation injury). In some embodiments, risk is expressed as a percentage. In some embodiments, risk is from 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90 and up to 100%. In some embodiments, risk is expressed as a risk relative to a risk associated with a reference sample or group of reference samples. In some embodiments, a reference sample or group of reference samples have a known risk of a disease, disorder, condition and/or event (e.g., a radiation injury). In some embodiments a reference sample or group of reference samples are from individuals comparable to a particular individual. In some embodiments, relative risk is 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more.
[0111] Substantially includes the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest. One of ordinary skill in the biological arts will understand that biological and chemical phenomena rarely, if ever, go to completion and/or proceed to completeness or achieve or avoid an absolute result. The term substantially is therefore used herein to capture the potential lack of completeness inherent in many biological and chemical phenomena.
[0112] Substantial homology includes a comparison between amino acid or nucleic acid sequences. As will be appreciated by those of ordinary skill in the art, two sequences are generally considered to be substantially homologous if they contain homologous residues in corresponding positions. Homologous residues may be identical residues. Alternatively, homologous residues may be non-identical residues with appropriately similar structural and/or functional characteristics. For example, as is well known by those of ordinary skill in the art, certain amino acids are typically classified as hydrophobic or hydrophilic amino acids, and/or as having polar or non-polar side chains. Substitution of one amino acid for another of the same type may often be considered a homologous substitution. Typical amino acid categorizations are summarized below.
TABLE-US-00001 Alanine Ala A Nonpolar Neutral 1.8 Arginine Arg R Polar Positive 4.5 Asparagine Asn N Polar Neutral 3.5 Aspartic acid Asp D Polar Negative 3.5 Cysteine Cys C Nonpolar Neutral 2.5 Glutamic acid Glu E Polar Negative 3.5 Glutamine Gln Q Polar Neutral 3.5 Glycine Gly G Nonpolar Neutral 0.4 Histidine His H Polar Positive 3.2 Isoleucine Ile I Nonpolar Neutral 4.5 Leucine Leu L Nonpolar Neutral 3.8 Lysine Lys K Polar Positive 3.9 Methionine Met M Nonpolar Neutral 1.9 Phenylalanine Phe F Nonpolar Neutral 2.8 Proline Pro P Nonpolar Neutral 1.6 Serine Ser S Polar Neutral 0.8 Threonine Thr T Polar Neutral 0.7 Tryptophan Trp W Nonpolar Neutral 0.9 Tyrosine Tyr Y Polar Neutral 1.3 Valine Val V Nonpolar Neutral 4.2
TABLE-US-00002 Ambiguous Amino Acids 3-Letter 1-Letter Asparagine or aspartic acid Asx B Glutamine or glutamic acid Glx Z Leucine or Isoleucine Xle J Unspecified or unknown amino acid Xaa X
[0113] As is well known in this art, amino acid or nucleic acid sequences may be compared using any of a variety of algorithms, including those available in commercial computer programs such as BLASTN for nucleotide sequences and BLASTP, gapped BLAST, and PSI-BLAST for amino acid sequences. Exemplary such programs are described in Altschul, S. F. et al, 1990, J. Mol. Biol., 215(3): 403-410; Altschul, S. F. et al., 1997, Methods in Enzymology; Altschul, S. F. et al., 1997, Nucleic Acids Res., 25:3389-3402; Baxevanis, A. D., and B. F. F. Ouellette (eds.) Bioinformatics: A Practical Guide to the Analysis of Genes and Proteins, Wiley, 1998; and Misener et al. (eds.) Bioinforratics Methods and Protocols (Methods in Molecular Biology, Vol. 132), Humana Press, 1998. In addition to identifying homologous sequences, the programs mentioned above typically provide an indication of the degree of homology. In some embodiments, two sequences are considered to be substantially homologous if at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more of their corresponding residues are homologous over a relevant stretch of residues. In some embodiments, the relevant stretch is a complete sequence. In some embodiments, the relevant stretch is at least 9, 10, 11, 12, 13, 14, 15, 16, 17 or more residues. In some embodiments, the relevant stretch includes contiguous residues along a complete sequence. In some embodiments, the relevant stretch includes discontinuous residues along a complete sequence, for example, noncontiguous residues brought together by the folded conformation of a polypeptide or a portion thereof. In some embodiments, the relevant stretch is at least 10, 15, 20, 25, 30, 35, 40, 45, 50, or more residues.
[0114] Substantial identity includes a comparison between amino acid or nucleic acid sequences. As will be appreciated by those of ordinary skill in the art, two sequences are generally considered to be substantially identical if they contain identical residues in corresponding positions. As is well known in this art, amino acid or nucleic acid sequences may be compared using any of a variety of algorithms, including those available in commercial computer programs such as BLASTN for nucleotide sequences and BLASTP, gapped BLAST, and PSI-BLAST for amino acid sequences. Exemplary such programs are described in Altschul, S. F. et al., 1990, J. Mol. Biol., 215(3): 403-410; Altschul, S. F. et al., 1997, Methods in Enzymology; Altschul, S. F. et al., 1997, Nucleic Acids Res., 25:3389-3402; Baxevanis, A. D., and B. F. F. Ouellette (eds.) Bioinformatics: A Practical Guide to the Analysis of Genes and Proteins, Wiley, 1998; and Misener et al. (eds.) Bioinformatics Methods and Protocols (Methods in Molecular Biology, Vol. 132), Humana Press, 1998. In addition to identifying identical sequences, the programs mentioned above typically provide an indication of the degree of identity. In some embodiments, two sequences are considered to be substantially identical if at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more of their corresponding residues are identical over a relevant stretch of residues. In some embodiments, the relevant stretch is a complete sequence. In some embodiments, the relevant stretch is at least 10, 15, 20, 25, 30, 35, 40, 45, 50, or more residues.
[0115] Targeting vector or targeting construct includes a polynucleotide molecule that comprises a targeting region. A targeting region comprises a sequence that is identical or substantially identical to a sequence in a target cell, tissue or animal and provides for integration of the targeting construct into a position within the genome of the cell, tissue or animal via homologous recombination. Targeting regions that target using site-specific recombinase recognition sites (e.g., loxP or Frt sites) are also included. In some embodiments, a targeting construct as described herein further comprises a nucleic acid sequence or gene (e.g., a reporter gene or homologous or heterologous gene) of particular interest, a selectable marker, control and or regulatory sequences, and other nucleic acid sequences that encodes a recombinase or recombinogenic protein. In some embodiments, a targeting construct may comprise a gene of interest in whole or in part, wherein the gene of interest encodes a polypeptide, in whole or in part, that has a similar function as a protein encoded by an endogenous sequence. In some embodiments, a targeting construct may comprises a humanized gene of interest, in whole or in part, wherein the humanized gene of interest encodes a polypeptide, in whole or in part, that has a similar function as a polypeptide encoded by an endogenous sequence. In some embodiments, a targeting construct may comprise a reporter gene, in whole or in part, wherein the reporter gene encodes a polypeptide that is easily identified and/or measured using techniques known in the art.
[0116] Transgenic animal, transgenic non-human animal or Tg includes any non-naturally occurring non-human animal in which one or more of the cells of the non-human animal contain heterologous nucleic acid and/or gene encoding a polypeptide of interest, in whole or in part. In some embodiments, a heterologous nucleic acid and/or gene is introduced into the cell, directly or indirectly by introduction into a precursor cell, by way of deliberate genetic manipulation, such as by microinjection or by infection with a recombinant virus. The term genetic manipulation does not include classic breeding techniques, but rather is directed to introduction of recombinant DNA molecule(s). This molecule may be integrated within a chromosome, or it may be extrachromosomally replicating DNA. The term Tg.sup.+ includes animals that are heterozygous or homozygous for a heterologous nucleic acid and/or gene, and/or animals that have single or multi-copies of a heterologous nucleic acid and/or gene.
[0117] Treatment, Treat or Treating includes any administration of a substance (e.g., a, therapeutic candidate) that partially or completely alleviates, ameliorates, relives, inhibits, delays onset of, reduces severity of, and/or reduces incidence of one or more symptoms, features, and/or causes of a particular disease, disorder, and/or condition. In some embodiments, such treatment may be administered to a subject who does not exhibit signs of the relevant disease, disorder and/or condition and/or of a subject who exhibits only early signs of the disease, disorder, and/or condition. Alternatively or additionally, in some embodiments, treatment may be administered to a subject who exhibits one or more established signs of the relevant disease, disorder and/or condition. In some embodiments, treatment may be of a subject who has been diagnosed as suffering from the relevant disease, disorder, and/or condition. In some embodiments, treatment may be of a subject known to have one or more susceptibility factors that are statistically correlated with increased risk of development of the relevant disease, disorder, and/or condition.
[0118] Variant includes an entity that shows significant structural identity with a reference entity, but differs structurally from the reference entity in the presence or level of one or more chemical moieties as compared with the reference entity. In many embodiments, a variant also differs functionally from its reference entity. In general, whether a particular entity is properly considered to be a variant of a reference entity is based on its degree of structural identity with the reference entity. As will be appreciated by those skilled in the art, any biological or chemical reference entity has certain characteristic structural elements. A variant, by definition, is a distinct chemical entity that shares one or more such characteristic structural elements. To give but a few examples, a small molecule may have a characteristic core structural element (e.g., a macrocycle core) and/or one or more characteristic pendent moieties so that a variant of the small molecule is one that shares the core structural element and the characteristic pendent moieties but differs in other pendent moieties and/or in types of bonds present (single vs. double, E vs. Z, etc.) within the core, a polypeptide may have a characteristic sequence element comprised of a plurality of amino acids having designated positions relative to one another in linear or three-dimensional space and/or contributing to a particular biological function, a nucleic acid may have a characteristic sequence element comprised of a plurality of nucleotide residues having designated positions relative to on another in linear or three-dimensional space. For example, a variant polypeptide may differ from a reference polypeptide as a result of one or more differences in amino acid sequence and/or one or more differences in chemical moieties (e.g., carbohydrates, lipids, etc.) covalently attached to the polypeptide backbone. In some embodiments, a variant polypeptide shows an overall sequence identity with a reference polypeptide that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%. Alternatively or additionally, in some embodiments, a variant polypeptide does not share at least one characteristic sequence element with a reference polypeptide. In some embodiments, the reference polypeptide has one or more biological activities. In some embodiments, a variant polypeptide shares one or more of the biological activities of the reference polypeptide. In some embodiments, a variant polypeptide lacks one or more of the biological activities of the reference polypeptide. In some embodiments, a variant polypeptide shows a reduced level of one or more biological activities as compared with the reference polypeptide. In many embodiments, a polypeptide of interest is considered to be a variant of a parent or reference polypeptide if the polypeptide of interest has an amino acid sequence that is identical to that of the parent but for a small number of sequence alterations at particular positions. Typically, fewer than 20%, 15%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, or 2% of the residues in the variant are substituted as compared with the parent. In some embodiments, a variant has 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 substituted residue(s) as compared with a parent. Often, a variant has a very small number (e.g., fewer than 5, 4, 3, 2, or 1) number of substituted functional residues (i.e., residues that participate in a particular biological activity). Furthermore, a variant typically has not more than 5, 4, 3, 2, or 1 additions or deletions, and often has no additions or deletions, as compared with the parent. Moreover, any additions or deletions are typically fewer than about 25, about 20, about 19, about 18, about 17, about 16, about 15, about 14, about 13, about 10, about 9, about 8, about 7, about 6, and commonly are fewer than about 5, about 4, about 3, or about 2 residues. In some embodiments, the parent or reference polypeptide is one found in nature. As will be understood by those of ordinary skill in the art, a, plurality of variants of a, particular polypeptide of interest may commonly be found in nature, particularly when the polypeptide of interest is an infectious agent polypeptide.
[0119] Vector includes a nucleic acid molecule capable of transporting another nucleic acid to which it is associated. In some embodiment, vectors are capable of extra-chromosomal replication and/or expression of nucleic acids to which they are linked in a host cell such as a eukaryotic and/or prokaryotic cell. Vectors capable of directing the expression of operably linked genes are referred to herein as expression vectors.
[0120] Wild type includes an entity having a structure and/or activity as found in nature in a normal (as contrasted with mutant, diseased, altered, etc.) state or context. Those of ordinary skill in the art will appreciate that wild type genes and polypeptides often exist in multiple different forms (e.g., alleles).
DETAILED DESCRIPTION OF CERTAIN EMBODIMENTS
[0121] Non-human animals are provided having a disruption in a C90ORF72 locus. In particular, non-human animals described herein have a deletion of an entire coding sequence in a C9ORF72 locus, i.e., a deletion of a genomic segment coding for all C9ORF72 isoforms (e.g., a deletion of the coding portion of exon 2 through the coding portion of exon 11 of isoform V1). Non-human animals as described herein demonstrate weight loss and ALS-like motor abnormalites such as, for example, motor inactivity and gait impairment. Also, non-human animals described herein demonstrate splenomegaly and/or lymphadenopathy at about eight (8) weeks of age. Further, non-human animals described herein demonstrate glomerulonephritis at about 35 weeks of age. Therefore, provided non-human animals are particularly useful for the development and identification of therapeutic candidates for the treatment and/or amelioration of neurodegenerative diseases, disorders and conditions and, in some embodiments, autoimmune and/or inflammatory diseases, disorders and conditions. In particular, non-human animals described herein encompasses the introduction of a reporter gene into an endogenous C9ORF72 locus resulting in expression of the reporter gene (i.e., a reporter polypeptide) in the nervous and immune systems of the non-human animal. Such transgenic non-human animals provide a source of cells for determnnining the efficacy of therapeutic candidates to ameliorate ALS and/or FTD. Further, such transgenic non-human animals provide a useful animal model system for the development of therapeutics for the treatment of neurodegenerative, autoimmune and/or inflammatory diseases, disorders and conditions.
[0122] In some embodiments, non-humnan animals described herein develop ALS- and/or FTD-like disease due to the absence of, lack of, or decreased level of C9ORF72 (e.g., RNA, polypeptide, etc.) in cells of the non-human animals. In some embodiments, non-human animals described herein develop glomerulonephritis due to the absence of, lack of, or decrease level of C9ORF72 (e.g., RNA, polypeptide, etc.). In some embodiments, non-human animals described herein are heterozygous for a disruption in a C9ORF72 locus as described herein. In some embodiments, non-human animals described herein are homozygous for a disruption in a 9ORF72 locus as described herein. In some embodiments, non-human animals as described herein comprise a reporter gene, in whole or in part, wherein said reporter gene is operably linked to a C9ORF72 promoter. In some embodiments, C9ORF72 promoters include endogenous C9ORF72 promoters.
[0123] The present disclosure provides a comprehensive phenotypic analysis of a non-human animal line with global C9orf72 ablation and the discovery of a unique role for C9orf72 in immune system homeostasis. The present disclosure specifically demonstrates that a complete ablation of C9orf72 resulted in gait abnormalities and an indication towards hindlimb weakness that suggests possible onset of lower motor neuron pathology beginning at about 40 weeks of age. As described herein, the immune phenotype exhibited by C9orf72.sup./ non-human animals consisted of select expansions in both myeloid and lymphoid compartments, with increased activation of T cells and elevated plasma cells. Neutrophilia and monocytosis resulted in mixed infiltrates in immune organs that expanded, but did not obliterate basic architecture. C9orf72.sup./ non-human animals demonstrated elevated serum cytokines (e.g., IL-12) and tissue RNA signatures consistent with myeloid upregulation. Renal disease with accompanying pathological changes such as, for example, thickened basement membrane and cast formation, was present in the majority of non-human animals by about 35 weeks of age. At a microscopic level, glomeruli stained heavily with IgG and IgM antibody and complement C3 in a pattern indicating deposition of immune complexes. Also described herein, C9orf72.sup./ non-human animals demonstrated high titer of autoantibodies including anti-RF, ANA, anti-Sm, and anti-cardiolipin, which indicated that loss of C9orf72 expression profoundly disrupts immune homeostasis. None of the immune-related phenotype characteristics were observed in wild type or C9orf72.sup.+/ (heterozygous) non-human animals. Thus, the present invention provides, among other things, the creation of an improved in vivo system for the development of new therapies and/or identification of new therapeutic targets for the treatment of various diseases, disorders or conditions that are not achievable through the use of established in vivo systems due, in part, to the nonexistence of particular phenotypes in such established systems.
[0124] Various aspects of the invention are described in detail in the following sections. The use of sections is not meant to limit the invention. Each section can apply to any aspect of the invention. In this application, the use of or means and/or unless stated otherwise.
C9ORF72
[0125] Amyotrophic lateral sclerosis (ALS), also referred to as Lou Gehrig's disease, is the most frequent adult-onset paralytic disorder, characterized by the loss of upper and/or lower motor neurons. ALS occurs in as many as 20,000 individuals across the United States with about 5,000 new cases occurring each year. Frontotemporal dementia (FTD), originally referred to as Pick's disease after physician Arnold Pick, is a group of disorders caused by progressive cell degeneration in the frontal or temporal lobes of the brain. FTD is reported to count for 10-15% of all dementia cases. GGGGCC hexanucleotide repeat expansion between two non-coding exons of C9ORF172 have been linked to both ALS and FTD (DeJesus-Hernandez, M. et al., 2011, Neuron 72:245-256; Renton, A. E. et al., 2011, Neuron 72:257-268; Majounie, E. et al., 2012, Lancet Neurol. 11:323-330; Waite, A. J. et al., 2014, Neurobiol. Aging 35:1779.e5-1779.e13). However, the mechanism through which such repeat mutations cause disease, whether through a loss- or gain-of-function of toxicity, remains unclear. For example, zebrafish with reduced C9ORF72 expression from targeted reduction or knockdown demonstrate axonopathy and deficits in locomotor function (Ciura, S. et al., 2013, Ann. Neurol. 74(42):180-187), while mice with reduced C9ORF72 expression do not show any behavioral or pathological features associated with ALS disease (Lagier-Tourenne, C. et al., 2013, Proc. Nat. Acad. Sci. U.S.A. E4530-E4539). Further, knock-in mice that have been generated to contain 66 C9ORF72 repeat expansions exhibit RNA foci and dipeptide protein aggregates in their neurons. These mice showed cortical neuron loss and exhibited behavior and motor deficits at 6 months of age (Chew, J. et al., 2015, Science May 14. Pii:aaa9344).
[0126] Many pathological aspects related to GGGGCC hexanucleotide repeat expansions in C9ORF72 have been reported such as, for example, repeat length-dependent formation of RNA foci, sequestration of specific RNA-binding proteins, and accumulation and aggregation of dipeptide repeat proteins (e.g., reviewed in Stepto, A. et al., 2014, Acta Neuropathol. 127:377-389; see also Almreida, S. et al., 2013, Acta Neuropathol. 126:385-399; Bieniek, K. F. et al., 2014, JAMA Neurol. 71(6): 775-781; van Blitterswijk, M. et al., 2014, Mol. Neurodegen. 9:38, 10 pages). Although C9ORF72 has been reported to regulate endosomal trafficking (Farg, M. A. et al., 2014, Human Mol. Gen. 23(13):3579-3595), much of the cellular function of C9ORF72 remains unknown. Indeed, C9ORF72 is a gene that encodes an uncharacterized protein with unknown function. Despite the lack of understanding surrounding C9ORF72, several animal models, including engineered cell lines, for ALS and/or FTD have been developed (Roberson, E. D., 2012, Ann. Neurol. 72(6):837-849; Panda, S. K. et al., 2013, Genetics 195:703-715; Suzuki, N. et al., 2013, Nature Neurosci. 16(12):1725-1728; Xu, Z. et al., 2013, Proc. Nat. Acad. Sci. U.S.A. 110(19):7778-7783; Hukema, R. K. et al., 2014, Acta Neuropathol. Comm. 2:166, 4 pages). For example, transgenic mice having a lacZ gene insertion that replaced exons 2-6 of C9orf72 (311004O21Rik) have been produced by gene targeting efforts from the Knockout Mouse Project (see FIG. 1d of Suzuki, N. et al., 2013, supra; for KOMP, see Skarnes, W. C. et al., 2011, Nature 474(7351):337-342). X-gal staining was observed in the brain, spinal cord, testis and germinal centers of the spleen in these mice, however, not in muscle (tibialis anterior), heart, lung, liver, and kidney. It is unclear, however, if the remaining undeleted exons (i.e., 7-11) yield any expression and, consequently, function. Another report using a transgenic mouse strain containing 80 GGGGCC repeats operably linked with a fluorescent reporter and controlled by a tetracycline responsive element without any surrounding C9orf72 sequences demonstrated neuronal cytoplasmic inclusions similar to those seen in ALS-FTD patients, which suggests that the repeat expansion itself may be responsible for disease (Hukema, R. K. et al., 2014, Acta Neuropathol. Comm. 2:166, 4 pages). These mice have been useful to establish an initial (9orf72 expression profile in cells of the CNS and provide some understanding of the mechanism of action associated with the repeat expansion; however, it remains unclear if the specific design of these constructs in these mice indicate specific functions that can be confidently attributed to C9orf72 or are a result of something else, unrelated to C9orf72 function.
[0127] In some cases, however, construct design can influence the phenotype of the resulting transgenic animal (see, e.g., Muller, U., 1999, Mech. Develop. 81:3-21). Because the C9orf72-disrupted mice as described above utilized a targeting vector with a promoter-driven selection cassette (see FIG. 1d of Suzuki, N. et al., 2013, supra; FIG. 1 of Skarnes, W. C. et al., 2011, supra), it is not clear if the displayed expression pattern correctly correlates with normal C9ORF72 expression. Indeed, expression of the remaining exons 7-11 driven by the selection cassette-associated promoter or C9ORF72 promoter itself has not been determined. As a result, phenotypes, and perhaps C9ORF72 expression via lacZ, observed in such mice may be modified or otherwise skewed due to aspects of the targeting vector. Further, a transgenic mouse strain containing an inducible GGGGCC repeat (Hukema, 2014, supra) was designed without human flanking sequence presumably due to the fact that such surrounding sequence was thought to affect translation of repeat sequences. Thus, such in vivo systems exploiting C9ORF72-mediated biology for therapeutic applications are incomplete.
[0128] As described herein, the present disclosure specifically describes a non-human animal model for ALS and/or FTD, which non-human animal comprises a disruption in a C9ORF72 locus. In particular, the present disclosure specifically describes a rodent model for ALS and/or FTD, wherein the rodent comprises a deletion of the entire coding sequence for all C9orf72 isoforms (e.g., the coding portion of exon 2 through the coding portion of exon 11 of V1) of a C9orf72 gene via insertion of a lacZ reporter gene. The targeting vector employed by the present inventors was designed to contain a self-deleting drug selection cassette (see e.g., U.S. Pat. Nos. 8,697,851, 8,518,392 and 8,354,389, all of which are herein incorporated by reference), which allows for removal of the drug selection cassette in a development-dependent manner, thereby removing any chance of promoter affects or aberrant expression of remaining exons or effects from the selection cassette itself. As described herein, the present inventors achieved complete ablation of C9orf72. Further, the present inventors measured the motor behaviors of these rodents using rotarod, open field and CatWalk assays up to 60 weeks of age and neurological deficits throughout the same period. Without wishing to be bound by any particular theory, the present disclosure demonstrates that only 40% of C9orf72 knockout rodents survived past 60 weeks of age and the rodents ceased gaining body weight beginning around 40 weeks of age. While rotarod tests did not show significant changes due to C9orf72 deletion, rodents described herein demonstrated significant hind limb paresis, motor impairment, decreased mobility and gait abnormalities at around 50 weeks of age. Further, the present disclosure specifically demonstrates that genetic silencing of murine C9orf72 results in multiple motor and neurological abnormalities similar to those found in human motor neuron diseases. Thus, rodents described herein provide, at least in some embodiments, improved in vivo systems for development of therapeutic candidates for the treatment of neurodegenerative disease such as, for example, ALS and/or FTD. Further, rodents described herein overcome deficits in existing animal models characterized by suboptimal C9orf72 deletion for the development of C9orf72-targeted therapies.
C9ORF72 Sequences
[0129] Mouse C9ORF72 transcript variants have been reported in the art (e.g., Koppers et al., Ann Neurol (2015); 78: 426-438; Atkinson et al., Acta Neuropathologica Communications (2015) 3: 59), and are also depicted in
[0130] Human C9ORF72 transcript variants are known in the art. One human C9ORF72 transcript variant lacks multiple exons in the central and 3 coding regions, and its 3 terminal exon extends beyond a splice site that is used in variant 3 (see below), which results in a novel 3 untranslated region (UTR) as compared to variant 3. This variant encodes a significantly shorter polypeptide and its C-terminal amino acid is distinct as compared to that which is encoded by two other variants. The mRNA and amino acid sequences of this variant can be found at GenBank accession numbers NM_145005.6 and NP_659442.2, respectively, and are hereby incorporated by reference. A second human C9ORF72 transcript variant (2) differs in the 5 untranslated region (UTR) compared to variant 3. The mRNA and amino acid sequences of this variant can be found at GenBank accession numbers NM_018325.4 and NP_060795.1, respectively, and are hereby incorporated by reference. A third human C9ORF72 transcript variant (3) contains the longest sequence among three reported variants and encodes the longer isoform. The mRNA and amino acid sequences of this variant can be found at GenBank accession numbers NM_001256054.2 and NP_001242983.1, respectively, and are hereby incorporated by reference, Variants 2 and 3 encode the same protein.
TABLE-US-00003 TABLE1 MusmusculusC9orf72mRNA(NM_001081343;SEQIDNO:1) gtgtccggggcggggcggtcccggggcggggcccggagcgggctgcggttgcggtccctgcgccggcggtgaaggcgcagc agcggcgagtggCTATTGCAAGCGTTCGGATAATGTGAGACCTGGAATGCAGTGAGAC CTGGGATGCAGGG(ATGTCGACTATCTGCCCCCCACCATCTCCTGCTGTTGC CAAGACAGAGATTGCTTTAAGTGGTGAATCACCCTTGTTGGCGGCTACCTT TGCTTACTGGGATAATATTCTTGGTCCTAGAGTAAGGCATATTTGGGCTCC AAAGACAGACCAAGTGCTTCTCAGTGATGGAGAAATAACTTTTCTTGCCAA CCACACTCTAAATGGAGAAATTCTTCGAAATGCAGAGAGTGGGGCTATAGA TGTAAAATTTTTTGTCTTATCTGAAAAAGGGGTAATTATTGTTTCATTAATC TTCGACGGAAACTGGAATGGAGATCGGAGCACTTATGGACTATCAATTATA CTGCCGCAGACAGAGCTGAGCTTCTACCTCCCACTTCACAGAGTGTGTGTT GACAGGCTAACACACATTATTCGAAAAGGAAGAATATGGATGCATAAGgaaa gacaagaaaatgtccagaaaattgtcttggaaggcacagagaggatggaagatcagGGTCAGAGTATCATT CCCATGCTTACTGGGGAAGTCATTCCTGTAATGGAGCTGCTTGCATCTATG AAATCCCACAGTGTTCCTGAAGACATTGATatagctgatacagtgctcaatgatgatgacattgg tgacagctgtcacgaaggctttcttctcaaTGCCATCAGCTCACACCTGCAGACCTGTGGCTG TTCCGTTGTAGTTGGCAGCAGTGCAGAGAAAGTAAATAAGatagtaagaacgctgtgc ctttttctgacaccagcagagaggaaatgctccaggctgtgtgaagcagaatcgtcctttaagtacgaatcgggactctttgtg caaggcttgctaaagGATGCAACAGGCAGTTTTGTCCTACCCTTCCGGCAAGTTATG TATGCCCCGTACCCCACCACCCACATTGATGTGGATGTCAACACTGTCAAG CAGATGCCACCGTGTCATGAACATATTTATAATCAACGCAGATACATGAGG TCAGAGCTGACAGCCTTCTGGAGGGCAACTTCAGAAGAGGACATGGCGCA GGACACCATCATCTACACAGATGAGAGCTTCACTCCTGATTTgaatattttccaagat gtcttacacagagacactctagtgaaagccttcctggatcagGTCTTCCATTTTGAAGCCTGGCCTGT CTCTCAGGAGTACTTTCCTTGCACAGTTCCTCCTCATTCTTCACAGAAAAGC CTTGACACTAATCAAGTACATCGAGGATGAGGATGATACgcagaaggggaaaaagccctttaagtctc ttcggaacctgaagatagatcttgatttaacagcagagggcgatcttaacataataatggctctagctgagaaaattaagcc aggcctacactctttcatctttgggagacctttctacactagtgtacaagaacgtgatgttctaatgaccttttga)ccgtgtggtt tgctgtgtctgtctcttcacagtcacacctgctgttacagtgtctcagcagtgtgtgggcacatccttcctcccgagtcctgctgcaggac agggtacactacacttgtcagtagaagtctgtacctgatgtcaggtgcatcgttacagtgaatgactcttcctagaatagatgtactctttt agggccttatgtttacaattatcctaagtactattgctgtcttttaaagatatgaatgatggaatatacacttgaccataactgctgattggttt tttgttttgttttgtttgttttcttggaaacttatgattcctggtttacatgtaccacactgaaaccctcgttagctttacagataaagtgtgagtt gacttcctgcccctctgtgttctgtggtatgtccgattacttctgccacagctaaacattagagcatttaaagtttgcagttcctcagaaag gaacttagtctgactacagattagttcttgagagaagacactgatagggcagagctgtaggtgaaatcagttgttagcccttcctttatag acgtagtccttcagattcggtctgtacagaaatgccgaggggtcatgcatgggccctgagtatcgtgacctgtgacaagttttttgttgg tttattgtagttctgtcaaagaaagtggcatttgtttttataattgttgccaacttttaaggttaattttcattatttttgagccgaattaaaatgcg cacctcctgtgcctttcccaatcttggaaaatataatttcttggcagagggtcagatttcagggcccagtcactttcatctgaccacccttt gcacggctgccgtgtgcctggcttagattagaagtccttgttaagtatgtcagagtacattcgctgataagatctttgaagagcaggga agcgtcttgcctctttcctttggtttctgcctgtactctggtgtttcccgtgtcacctgcatcataggaacagcagagaaatctgacccagt gctatttttctaggtgctactatggcaaactcaagtggtctgtttctgttcctgtaacgttcgactatctcgctagctgtgaagtactgattag tggagttctgtgcaacagcagtgtaggagtatacacaaacacaaatatgttttctatttaaaactgtggacttagcataaaaagggaga atatatttattttttacaaaagggataaaaatgggccccgttcctcacccaccagatttagcgagaaaaagctttctattctgaaaggtcac ggtggctttggcattacaaatcagaacaacacacactgaccatgatggcttgtgaactaactgcaaggcactccgtcatggtaagcga gtaggtcccacctcctagtgtgccgctcattgctttacacagtagaatcttatttgagtgctaattgttgtctttgctgctttactgtgttgttat agaaaatgtaagctgtacagtgaataagttattgaagcatgtgtaaacactgttatatatcttttctcctagatggggaattttgaataaaat acctttgaaattctgtgt MusmusculusC9orf72aminoacid(NM_001081343;SEQIDNO:2) MSTICPPPSPAVAKTEIALSGESPLLAATFAYWDNILGPRVRHIWAPKTDQVLLS DGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTY GLSILLPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIVLEGTER MEDQGQSIIPMLTGEVIPVMELLASMKSHSVPEDIDIADTVLNDDDIGDSCHEG FLLNAISSHLQTCGCSVVVGSSAEKVNKIVRTLCLFLTPAERKCSRLCEAESSFK YESGLFVQGLLKDATGSFVLPFRQVMYAPYPTTHIDVDVNTVKQMPPCHEHIY NQRRYMRSELTAFWRATSEEDMAQDTIIYTDESFTPDLNIFQDVLHRDTLVKAF LDQVFHLKPGLSLRTFLAQFLLILHRKALTLIKYIEDDTQKGKKPFKSLRNLKID LDLTAEGDLNIIMALAEKIKPGLHSFIFGRPFYTSVQEDVLMTF RattusnorvegicusC9orf72mRNA(NM_001007702:SEQIDNO:3) CGTTTGTAGTGTCAGCCATCCCAATTGCCTGTTCCTTCTCTGTGGGAGTGGTGTC TAGACAGTCCAGGCAGGGTATGCTAGGCAGGTGCGTTTTGGTTGCCTCAGATCG CAACTTGACTCCATAACGGTGACCAAAGACAAAAGAAGGAAACCAGATTAAAA AGAACCGGACACAGACCCCTGCAGAATCTGGAGCGGCCGTGGTTGGGGGCGGG GCTACGACGGGGCGGACTCGGGGGCGTGGGAGGGCGGGGCCGGGGCGGGGCCC GGAGCCGGCTGCGGTTGCGGTCCCTGCGCCGGCGGTGAAGGCGCAGCGGCGGC GAGTGGCTATTGCAAGCGTTTGGATAATGTGAGACCTGGGATGCAGGG(ATGTC GACTATCTGCCCCCCACCATCTCCTGCTGTTGCCAAGACAGAGATTGCTTT AAGTGGTGAATCACCCTTGTTGGCGGCTACCTTTGCTTACTGGGATAATAT TCTTGGTCCTGAGTAAGGCACATTTGGGCTCCAAAGACAGACCAAGTACT CCTCAGTGATGGAGAAATCACTTTTCTTGCCAACCACACTCTGAATGGAGA AATTCTTCGGAATGCGGAGAGTGGGGCAATAGATGTAAAGTTTTTTGTCTT ATCTGAAAAGGGCGTCATTATTGTTTCATTAATCTTCGACGGGAACTGGAA CGGAGATCGGAGCACTTACGGACTATCAATTATACTGCCGCAGACGGAGCT GAGTTTCTACCTCCCACTGCACAGAGTGTGTGTTGACAGGCTAACGCACAT CATTCGAAAAGGAAGGATATGGATGCACAAGGAAAGACAAGAAAATGTCCA GAAAATTGTCTTGGAAGGCACCGAGAGGATGGAAGATCAGGGTCAGAGTA TCATCCCTATGCTTACTGGGGAGGTCATCCCTGTGATGGAGCTGCTTGCGT CTATGAGATCACACAGTGTTCCTGAAGACCTCGATATAGCTGATACAGTAC TCAATGATGATGACATTGGTGACAGCTGTCATGAAGGCTTTCTTCTCAATG CCATCAGCTCACATCTGCAGACCTGCGGCTGTTCTGTGGTGGTAGGCAGCA GTGCAGAGAAAGTAAATAAGATAGTAAGAACACTGTGCCTTTTTCTGACAC CAGCAGAGAGGAAGTGCTCCAGGCTGTGTGAAGCCGAATCGTCCTTTAAAT ACGAATCTGGACTCTTTGTACAAGGCTTGCTAAAGGATGCGACTGGCAGTT TTGTACTACCTTTCCGGCAAGTTATGTATGCCCCTTATCCCACCACACACAT CGATGTGGATGTCAACACTGTCAAGCAGATGCCACCGTGTCATGAACATAT TTATAATCAACGCAGATACATGAGGTCAGAGCTGACAGCCTTCTGGAGGGC AACTTCAGAAGAGGACATGGCTCAGGACACCATCATCTACACAGATGAGAG CTTCACTCCTGATTTGAATATTTTCCAAGATGTCTTACACAGAGACACTCTA GTGAAAGCCTTTCTGGATCAGGTCTTCCATTTGAAGCCTGGCCTGTCTCTC AGGAGTACTTTCCTTGCACAGTTCCTCCTCATTCTTCACAGAGCCTTGA CACTAATCAAGTACATAGAGGATGACACGCAGAAGGGGAAAAAGCCCTTTA AGTCTCTTCGGAACCTGAAGATAGATCTTGATTTAACAGCAGAGGGCGACC TTAACATAATAATGGCTCTAGCTGAGAAAATTAAGCCAGGCCTACACTCTTT CATCTTCGGGAGACCTTTCTACACTAGTGTCCAAGAACGTGATGTTCTAAT GACTTTTTAA)ACATGTGGTTTGCTCGTGTGTCTCATGACAGTCACACTTGCTG TTACAGTGTCTCAGCGCTTTGGACACATCCTTCCTCCAGGGTCCTGCCGCAGGAC ACGTTACACTACACTTGTCAGTAGAGGTCTGTACCAGATGTCAGGTACATCGTT GTAGTGAATGTCTCTTTTCCTAGACTAGATGTACCCTCGTAGGGACTTATGTTTA CAACCCTCCTAAGTACTAGTGCTGTCTTGTAAGGATACGAATGAAGGGATGTAA ACTTCACCACAACTGCTGGTTGGTTTTGTTGTTTTTGTTTTTTGAAACTTATAATT CATGGTTTACATGCATCACACTGAAACCCTAGTTAGCTTTTTACAGGTAAGCTGT GAGTTGACTGCCTGTCCCTGTGTTCTCTGGCCTGTACGATCTGTGGCGTGTAGGA TCACTTTTGCAACAACTAAAAACTAAAGCACTTTGTTTGCAGTTCTACAGAAAG CAACTTAGTCTGTCTGCAGATTCGTTTTTGAAAGAAGACATGAGAAAGCGGAGT TTTAGGTGAAGTCAGTTGTTGGATCTTCCTTTATAGACTTAGTCCTTTAGATGTG GTCTGTATAGACATGCCCAACCATCATGCATGGGCACTGAATATCGTGAACTGT GGTATGCTTTTTGTTGGTTTATTGTACTTCTGTCAAAGAAAGTGGCATTGGTTTTT ATAATTGTTGCCAAGTTTTAAGGTTAATTTTCATTATTTTTGAGCCAAATTAAAA TGTGCACCTCCTGTGCCTTTCCCAATCTTGGAAAATATAATTTCTTGGCAGAAGG TCAGATTTCAGGGCCCAGTCACTTTCGTCTGACTTCCCTTTGCACAGTCCGCCAT GGGCCTGGCTTAGAAGTTCTTGTAAACTATGCCAGAGAGTACATTCGCTGATAA AATCTTCTTTGCAGAGCAGGAGAGCTTCTTGCCTCTTTCCTTTCATTTCTGCCTGG ACTTTGGTGTTCTCCACGTTCCCTGCATCCTAAGGACAGCAGGAGAACTCTGAC CCCAGTGCTATTTCTCTAGGTGCTATTGTGGCAAACTCAAGCGGTCCGTCTCTGT CCCTGTAACGTTCGTACCTTGCTGGCTGTGAAGTACTGACTGGTAAAGCTCCGTG CTACAGCAGTGTAGGGTATACACAAACACAAGTAAGTGTTTTATTTAAAACTGT GGACTTAGCATAAAAAGGGAGACTATATTTATTTTTTACAAAAGGGATAAAAAT GGAACCCTTTCCTCACCCACCAGATTTAGTCAGAAAAAAACATTCTATTCTGAA AGGTCACAGTGGTTTTGACATGACACATCAGAACAACGCACACTCTTCCATGATG GCTTATGAACTCCAAGTCACTCCATCATGGTAAATGGGTAGATCCCTCCTTCTAG TGTGCCACACCATTGCTTCCCACAGTAGAATCTTATTTAAGTGCTAAGTGTTGTC TCTGCTGGTTTACTCTGTTGTTTTAGAGAATGTAAGTTGTATAGTGAATAAGTTA TTGAAGCATGTGTAAACACTGTTATACATCTTTTCTCCTACTATGGGGAATTTGGA ATAAAATACCTTTAAAATTCAAAAAAAAAAAAAAAAAAAAAAAA RattusnorvegicusC9orf72aminoacid(NP_001007703;SEQIDNO:4) MSTICPPPSPAVAKTEIALSGESPLLAATFAYWDNILGPRVRHIWAPKTDQVLLSDGE ITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILP QTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIVLEGTERMEDQGQSIIP MLTGEVIPVMELLASMRSHSVPEDLDIADTVLNDDDIGDSCHEGFLLNAISSHLQTC GCSVVVGSSAEKVNKIVRTLCLFLTPAERKCSRLCEAESSFKYESGLFVQGLLKDAT GSFVLPFRQVMYAPYPTTHIDVNTVKQMPPCHEHIYNQRRYMRSELTAFWRAT SEEDMAQDTIIYTDESFTPDLNIFQDVLHRDTLVKAFLDQVFHLKPGLSLRSTFLAQF LLILHRKALTLIKYIEDDTQKGKKPFKSLRNLKIDLDLTAEGDLNIIMALAEKIKPGL HSFIFGRPFYTSVQERDVLMTF
C9ORF72 Targeting Vectors and Production of Non-Human Animals Having a Disruption in a C9ORF72 Locus
[0131] Provided herein are targeting vectors or targeting constructs for the production of non-human animals having a disruption in a C9ORF72 locus as described herein.
[0132] DNA sequences can be used to prepare targeting vectors for knockout animals (e.g., an C9ORF72 KO). Typically, a polynucleotide molecule (e.g., an insert nucleic acid) encoding a reporter gene and/or a selectable marker is inserted into a vector, preferably a DNA vector, in order to replicate the polynucleotide molecule in a suitable host cell.
[0133] A polynucleotide molecule (or insert nucleic acid) comprises a, segment of DNA that one desires to integrate into a target locus. In some embodiments, an insert nucleic acid comprises one or more polynucleotides of interest. In some embodiments, an insert nucleic acid comprises one or more expression cassettes. In some certain embodiments, an expression cassette comprises a polynucleotide of interest, a polynucleotide encoding a selection marker and/or a reporter gene along with, in some certain embodiments, various regulatory components that influence expression. Virtually any polynucleotide of interest may be contained within an insert nucleic acid and thereby integrated at a target genomic locus. Methods disclosed herein, provide for at least 1, 2, 3, 4, 5, 6 or more polynucleotides of interest to be integrated into a targeted C9ORF72 genomic locus.
[0134] In some embodiments, a polynucleotide of interest contained in an insert nucleic acid encodes a reporter. In some embodiments, a polynucleotide of interest encodes a selectable marker.
[0135] In some embodiments, a polynucleotide of interest is flanked by or comprises site-specific recombination sites (e.g., loxP, Frt, etc.). In some certain embodiments, site-specific recombination sites flank a DNA segment that encodes a reporter and/or a DNA segment that encodes a selectable marker. Exemplary polynucleotides of interest, including selection markers and reporter genes that can be included within insert nucleic acids are described herein.
[0136] Various methods employed in preparation of plasmids, DNA constructs and/or targeting vectors and transformation of host organisms are known in the art. For other suitable expression systems for both prokaryotic and eukaryotic cells, as well as general recombinant procedures, see Molecular Cloning: A Laboratory Manual, 2nd Ed., ed. by Sambrook, J. et al., Cold Spring Harbor Laboratory Press: 1989.
[0137] As described above, exemplary non-human (e.g., rodent) C9ORF72 nucleic acid and amino acid sequences for use in constructing targeting vectors for knockout animals are provided in Table 1. Other non-human C9ORF72 sequences can also be found in the GenBank database. C9ORF72 targeting vectors, in some embodiments, comprise DNA sequences encoding a reporter gene and/or a selectable marker, flanked by sequences that are identical or substantially homologous to flanking sequences of a target region (also referred to as homology arms) for insertion into the genome of a transgenic non-human animal. To give but one example, a deletion start point may be set upstream (5) of a first exon, a first coding exon, or the first or second codon, to allow an insert nucleic acid to be operably linked to an endogenous regulatory sequence (e.g., a promoter).
[0138] As described herein, disruption of a C9orf72 locus can comprise a replacement of or an insertion/addition to the C9orf72 locus or a portion thereof with an insert nucleic acid. In some embodiments, an insert nucleic acid comprises a reporter gene. In some certain embodiments, a reporter gene is positioned in operable linkage with an endogenous C9orf72 promoter. Such a modification allows for the expression of a reporter gene driven by an endogenous C9orf72 promoter. Alternatively, a reporter gene is not placed in operable linkage with an endogenous C9orf72 promoter.
[0139] A variety of reporter genes (or detectable moieties) can be used in targeting vectors described herein. Exemplary reporter genes include, for example, 3-galactosidase (encoded lacZ gene), Green Fluorescent Protein (GFP), enhanced Green Fluorescent Protein (eGFP), MmGFP, blue fluorescent protein (BFP), enhanced blue fluorescent protein (eBFP), mPlum, mCherry, tdTomato, mStrawberry, J-Red, DsRed, mOrange, mnKO, mCitrine, Venus, YPet, yellow fluorescent protein (YFP), enhanced yellow fluorescent protein (eYFP), Emerald, CyPet, cyan fluorescent protein (CFP), Cerulean, T-Sapphire, luciferase, alkaline phosphatase, or a combination thereof. The methods described herein demonstrate the construction of targeting vectors that employ the use of a lacZ reporter gene that encodes -galactosidase, however, persons of skill upon reading this disclosure will understand that non-human animals described herein can be generated in the absence of a reporter gene or with any reporter gene known in the art.
[0140] Where appropriate, the coding region of the genetic material or polynucleotide sequence(s) encoding a reporter polypeptide, in whole or in part, may be modified to include codons that are optimized for expression in the non-human animal (e.g, see U.S. Pat. Nos. 5,670,356 and 5,874,304). Codon optimized sequences are synthetic sequences, and preferably encode the identical polypeptide (or a biologically active fragment of a full length polypeptide which has substantially the same activity as the full length polypeptide) encoded by the non-codon optimized parent polynucleotide. In some embodiments, the coding region of the genetic material encoding a reporter polypeptide (e.g. lacZ), in whole or in part, may include an altered sequence to optimize codon usage for a particular cell type (e.g., a rodent cell). For example, the codons of the reporter gene to be inserted into the genome of a non-human animal (e.g., a rodent) may be optimized for expression in a cell of the non-human animal. Such a sequence may be described as a codon-optimized sequence.
[0141] Compositions and methods for making non-human animals that comprises a disruption in a C9ORF72 locus as described herein are provided, including compositions and methods for making non-human animals that express a reporter gene from a C9ORF72 promoter and a C9ORF72 regulatory sequence. In some embodiments, compositions and methods for making non-human animals that express a reporter gene from an endogenous promoter and an endogenous regulatory sequence are also provided. Methods include inserting a targeting vector, as described herein, encoding a reporter gene (e.g., lacZ) into the genome of a non-human animal so that an entire coding sequence of a C9ORF72 locus is deleted, in whole or in part. In some embodiments, methods include inserting targeting vector into the genome of a non-human animal so that the entire coding sequence for all C9ORF72 isoforms at a, C9ORF72 locus is deleted.
[0142] Insertion of a reporter gene operably linked to a C9ORF72 promoter (e.g., an endogenous C9ORF72 promoter) employs a relatively minimal modification of the genome and results in expression of reporter polypeptide in a C9ORF72-specific manner in the non-human animal. In some embodiments, a non-human animal described herein comprises a C9ORF72 locus that comprises a targeting vector as described herein.
[0143] Targeting vectors described herein may be introduced into ES cells and screened for ES clones harboring a disruption in a C9orf72 locus as described in Frendewey, D., et al., 2010, Methods Enzymol. 476:295-307. A variety of host embryos can be employed in the methods and compositions disclosed herein. For example, the pluripotent and/or totipotent cells having the targeted genetic modification can be introduced into a pre-morula stage embryo (e.g., an 8-cell stage embryo) from a corresponding organism. See, e.g., U.S. Pat. Nos. 7,576,259, 7,659,442, 7,294,754, and US 2008/0078000 A1, all of which are incorporated by reference herein in their entireties. In other cases, the donor ES cells may be implanted into a host embryo at the 2-cell stage, 4-cell stage, 8-cell stage, 16-cell stage, 32-cell stage, or 64-cell stage. The host embryo can also be a blastocyst or can be a pre-blastocyst embryo, a pre-morula stage embryo, a morula stage embryo, an uncompacted morula stage embryo, or a compacted morula stage embryo.
[0144] In some embodiments, the VELOCIMOUSE method (Poueymirou, W. T. et al., 2007, Nat. Biotechnol. 25:91-99) may be applied to inject positive ES cells into an 8-cell embryo to generate fully ES cell-derived F0 generation heterozygous mice ready for lacZ expression profiling or breeding to homozygosity. Exemplary methods for generating non-human animals having a disruption in a C9orf72 locus are provided in Example 1.
[0145] Methods for generating transgenic non-human animals, including knockouts and knock-ins, are well known in the art (see, e.g., Gene Targeting: A Practical Approach, Joyner, ed., Oxford University Press, Inc. (2000)). For example, generation of transgenic rodents may optionally involve disruption of the genetic loci of an endogenous rodent gene and introduction of a reporter gene into the rodent genome, in some embodiments, at the same location as the endogenous rodent gene.
[0146] A schematic illustration (not to scale) of the genomic organization of a, mouse C9orf72 is provided in
TABLE-US-00004 TABLE2 Protpromoter(SEQIDNO:5) CCAGTAGCAGCACCCACGTCCACCTTCTGTCTAGTAATGTCCAACACCTCCCTCA GTCCAAACACTGCTCTGCATCCATGTGGCTCCCATTTATACCTGAAGCACTTGAT GGGGCCTCAATGTTTACTAGAGCCCACCCCCCTGCAACTCTGAGACCCTCTGG ATTTGTCTGTCAGTGCCTCACTGGGGCGTTGGATAATTTCTTAAAAGGTCAAGTT CCCTCAGCAGCATTCTTCTGAGCAGTCTGAAGATGTGTGCTTTTTCACAGTTCAAAT CCATGTGGCTGTTTCACCCACCTGCCTGGCCTTGGGTTATCTATCAGGACCTAGC CTAGAAGCAGGTGTGTGGCACTTAACACCTAAGCTGAGTGACTAACTGAACACT CAAGTGGATGCCATCTTTGTCACTTCTTGACTGTGACACAAGCAACTCCTGATGC CAAAGCCCTGCCCACCCCTCTCATGCCCATATTTGGACATGGTACAGGTCCTCAC TGGCCATGGTCTGTGAGGTCCTGGTCCTCTTTGACTTCATAATTCCTAGGGGCCA CTAGTATCTATAAGAGGAAGAGGGTGCTGGCTCCCAGGCCACAGCCCACAAAA TTCCACCTGCTCACAGGTTGGCTGGCTCGACCCAGGTGGTGTCCCCTGCTCTGAG CCAGCTCCCGGCCAAGCCAGCACC Blimp1promoter1kb(SEQIDNO:6) TGCCATCATCACAGGATGTCCTTCCTTCTCCAGAAGACAGACTGGGGCTGAAGG AAAAGCCGGCCAGGCTCAGAACGAGCCCCACTAATTACTGCCTCCAACAGCTTT CCACTCACTGCCCCCAGCCCAACATCCCCTTTTTAACTGGGAAGCATTCCTACTC TCCATTGTACGCACACGCTCGGAAGCCTGGCTGTGGGTTTGGGCATGAGAGGCA GGGACAACAAAACCAGTATATATGATTATAACTTTTTCCTGTTTCCCTATTTCCA AATGGTCGAAAGGAGGAAGTTAGGTCTACCTAAGCTGAATGTATTCAGTTAGCA GGAGAAATGAAATCCTTACGTTTAATACTAGAGGAGAACCGCCTTAGAATATT TATTTCATTGGCAATGACTCCAGGACTACACAGCGAAATTGTATTGCATGTGCT GCCAAAATACTTTAGCTCTTTCCTTCGAATACGTCGGATCCTGTAATTGAGACA CCGAGTTTAGGTGACTAGGGTTTTCTTTTGAGGAGGAGTCCCCCACCCCGCCCC GCTCTGCCGCGACAGGAAGCTAGCGATCCGGAGGACTTAGAATACAATCGTAGT GTGGGTAAACATGGAGGGCAAGCGCCTGCAAAGGGAAGTAAGAAGATTCCCAG TCCTTGTTGAAATCCATTTGCAAACAGAGGAAGCTGCCGCGGGTCGCAGTCGGT GGGGGGAAGCCCTGAACCCCACGCTGCACGGCTGGGCTGGCCAGGTGCGGCCA CGCCCCCATCGCGGCGGCTGGTAGGAGTGAATCAGACCGTCAGTATTGGTAAAG AAGTCTGCGGCAGGGCAGGGAGGGGGAAGAGTAGTCAGTCGCTCGCTCACTCG CTCGCTCGCACAGACACTGCTGCAGTGACACTCGGCCCTCCAGTGTCGCGGAGA CGCAAGAGCAGCGCGCAGCACCTGTCCGCCCGGAGCGAGCCCGGCCCGCGGCC GTAGAAAAGGAGGGACCGCCGAGGTGCGCGTCAGTACTGCTCAGCCCGGCAGG GACGCGGGAGGATGTGGACTGGGTGGAC Blimp1promoter2kb(SEQIDNO:7) GTGGTGCTGACTCAGCATCGGTTAATAAACCCTCTGCAGGAGGCTGGATTTCTTT TGTTTAATTATCACTTGGACCTTTCTGAGAACTCTTAAGAATTGTTCATTCGGGT TTTTTTGTTTTGTTTTGGTTTGGTTTTTTTGGGTTTTTTTTTTTTTTTTTTTTTTGGT TTTTGGAGACAGGGTTTCTCTGTATATAGCCCTGGCACAAGAGCAAGCTAACAG CCTGTTTCTTCTTGGTGCTAGCGCCCCCTCTGGCAGAAAATGAAATAACAGGTG GACCTACAACCCCCCCCCCCCCCCCCAGTGTATTCTACTCTTGTCCCCGGTATAA ATTTGATTGTTCCGAACTACATAAATTGTAGAAGGATTTTTTAGATGCACATATC ATTTTCTGTGATACCTTCCACACACCCCTCCCCCCCAAAAAAATTTTTCTGGGAA AGTTTCTTGAAAGGAAAACAGAAGAACAAGCCTGTCTTTATGATTGAGTTGGGC TTTTGTTTTGCTGTGTTTCATTTCTTCCTGTAAACAAATACTCAAATGTCCACTTC ATTGTATGACTAAGTTGGTATCATTAGGTTGGGTCTGGGTGTGTGAATGTGGGT GTGGATCTGGATGTGGGTGGGTGTGTATGCCCCGTGTGTTTAGAATACTAGAAA AGATACCACATCGTAAACTTTTGGGAGAGATGATTTTTAAAAATGGGGGTGGGG GTGAGGGGAACCTGCGATGAGGCAAGCAAGATAAGGGGAAGACTTGAGTTTCT GTGATCTAAAAAGTCGCTGTGATGGGATGCTGGCTATAAATGGGCCCTTAGCAG CATTGTTTCTGTGAATTGGAGGATCCCTGCTGAAGGCAAAAGACCATTGAAGGA AGTACCGCATCTGGTTTGTTTTGTAATGAGAAGCAGGAATGCAAGGTCCACGCT CTTAATAATAAACAAACAGGACTTGTATGCCATCATCACAGGATGTCCTTCCT TCTCCAGAAGACAGACTGGGGGCTGAAGGAAAAGCCGGCCAGGCTCAGAACGAG CCCCACTAATTACTGCCTCCAACAGCTTTCCACTCACTGCCCCCAGCCCAACATC CCCTTTTTAACTGGGAAGCATTCCTACTCTCCATTGTACGCACACGCTCGGAAGC CTGGCTGTGGGTTTGGGCATGAGAGGCAGGGACAACAAAACCAGTATATATGA TTATAACTTTTTCCTGTTTCCCTATTTCCAAATGGTCGAAAGGAGGAAGTTAGGT CTACCTAAGCTGAATGTATTCAGTTAGCAGGAGAAATGAAATCCTATACGTTTA ATACTAGAGGAGAACCGCCTTAGAATATTTATTTCATTGGCAATGACTCCAGGA CTACACAGCGAAATTGTATTGCATGTGCTGCCAAAATACTTTAGCTCTTTCCTTC GAAGTACGTCGGATCCTGTAATTGAGACACCGAGTTTAGGTGACTAGGGTTTTC TTTTGAGGAGGAGTCCCCCACCCCGCCCCGCTCTGCCGCGACAGGAAGCTAGCG ATCCGGAGGACTTAGAATACAATCGTAGTGTGGGTAAACATGGAGGGCAAGCG CCTGCAAAGGGAAGTAAGAAGATTCCCAGTCCTTGTTGAAATCCATTTGCAAAC AGAGGAAGCTGCCGCGGGTCGCAGTCGGTGGGGGGAAGCCCTGAACCCCACGC TGCACGGCTGGGCTGGCCAGGTGCGGCCACGCCCCCATCGCGGCGGCTGGTAGG AGTGAATCAGACCGTCAGTATTGGTAAAGAAGTCTGCGGCAGGGCAGGGAGGG GGAAGAGTAGTCAGTCGCTCGCTCACTCGCTCGCTCGCACAGACACTGCTGCAG TGACACTCGGCCCTCCAGTGTCGCGGAGACGCAAGAGCAGCGCGCAGCACCTGT CCGCCCGGAGCGAGCCCGGCCCGCGGCCGTAGAAAAGGAGGGACCGCCGAGGT GCGCGTCAGTACTGCTCAGCCCGGCAGGGACGCGGGAGGATGTGGACTGGGTG GAC
[0147] A transgenic founder non-human animal can be identified based upon the presence of a reporter gene (or absence of C9ORF72) in its genome and/or expression of a reporter in tissues or cells of the non-human animal (or lack of expression of C9ORF72). A transgenic founder non-human animal can then be used to breed additional non-human animals carrying the reporter gene thereby creating a series of non-human animals each carrying one or more copies of a C9ORF72 locus as described herein.
[0148] Transgenic non-human animals may also be produced to contain selected systems that allow for regulated or directed expression of the transgene. Exemplary systems include the Cre/loxP recombinase system of bacteriophage P1 (see, e.g., Lakso, M. et al., 1992, Proc. Natl. Acad. Sci, USA 89:6232-6236) and the FLP/Frt recombinase system of S. cerevisiae (O'Gorman, S. et al, 1991, Science 251:1351-1355). Such animals can be provided through the construction of double transgenic animals, e.g., by mating two transgenic animals, one containing a transgene encoding a selected polypeptide (e.g., a reporter gene) and the other containing a transgene encoding a recombinase (e.g., a Cre recombinase).
[0149] Although embodiments employing a disruption in a C9ORF72 locus in a mouse (i.e., a mouse with a deletion of an entire C9orf72-coding sequence) are extensively discussed herein, other non-human animals that comprise a disruption in a C9ORF72 locus are also provided. In some embodiments, such non-human animals comprise a disruption in a C9ORF72 locus characterized by insertion of a reporter operably linked to an endogenous C9ORF72 promoter. Such non-human animals include any of those which can be genetically modified to delete an entire coding sequence of a C9ORF72 locus as disclosed herein, including, e.g., mammals, e.g., mouse, rat, rabbit, pig, bovine (e.g., cow, bull, buffalo), deer, sheep, goat, chicken, cat, dog, ferret, primate (e.g., marmoset, rhesus monkey), etc. For example, for those non-human animals for which suitable genetically modifiable ES cells are not readily available, other methods are employed to make a non-human animal comprising the genetic modification. Such methods include, e.g., modifying a non-ES cell genome (e.g., a fibroblast or an induced pluripotent cell) and employing somatic cell nuclear transfer (SCNT) to transfer the genetically modified genome to a suitable cell, e.g., an enucleated oocyte, and gestating the modified cell (e.g., the modified oocyte) in a non-human animal under suitable conditions to form an embryo.
[0150] Briefly, methods for nuclear transfer include steps of: (1) enucleating an oocyte; (2) isolating a donor cell or nucleus to be combined with the enucleated oocyte; (3) inserting the cell or nucleus into the enucleated oocyte to form a reconstituted cell; (4) implanting the reconstituted cell into the womb of an animal to form an embryo; and (5) allowing the embryo to develop. In such methods oocytes are generally retrieved from deceased animals, although they may be isolated also from either oviducts and/or ovaries of live animals. Oocytes may be matured in a variety of medium known to persons of skill in the art prior to enucleation. Enucleation of the oocyte can be performed in a variety of ways known to persons of skill in the art. Insertion of a donor cell or nucleus into an enucleated oocyte to form a, reconstituted cell is typically achieved by microinjection of a donor cell under the zona pellucida prior to fusion. Fusion may be induced by application of a DC electrical pulse across the contact/fusion plane (electrofusion), by exposure of the cells to fusion-promoting chemicals, such as polyethylene glycol, or by way of an inactivated virus, such as the Sendai virus. A reconstituted cell is typically activated by electrical and/or non-electrical means before, during, and/or after fusion of the nuclear donor and recipient oocyte. Activation methods include electric pulses, chemically induced shock, penetration by sperm, increasing levels of divalent cations in the oocyte, and reducing phosphorylation of cellular proteins (as by way of kinase inhibitors) in the oocyte. The activated reconstituted cells, or embryos, are typically cultured in medium known to persons of skill in the art and then transferred to the womb of an animal. See, e.g., U.S. Patent Application Publication No. 2008-0092249 A1, WO 1999/005266 A2, U.S. Patent Application Publication No. 2004-0177390 A1, WO 2008/017234 A1, and U.S. Pat. No. 7,612,250, each of which is herein incorporated by reference.
[0151] Methods for modifying a non-human animal genome (e.g., a pig, cow, rodent, chicken, etc.) include, e.g., employing a zinc finger nuclease (ZFN) or a transcription activator-like effector nuclease (TALEN) to modify a genome to include a disruption in a C9ORF72 locus as described herein.
[0152] In some embodiments, a non-human animal described herein is a mammal. In some embodiments, a non-human animal described herein is a small mammal, e.g., of the superfamily Dipodoidea or Muroidea. In some embodiments, a genetically modified animal described herein is a rodent. In some embodiments, a rodent described herein is selected from a mouse, a rat, and a hamster. In some embodiments, a rodent described herein is selected from the superfamily Muroidea. In some embodiments, a genetically modified animal described herein is from a family selected from Calomyscidae (e.g., mouse-like hamsters), Cricetidae (e.g., hamster, New World rats and mice, voles), Muridae (true mice and rats, gerbils, spiny mice, crested rats), Nesomyidae (climbing mice, rock mice, with-tailed rats, Malagasy rats and mice), Platacanthomyidae (e.g., spiny dormice), and Spalacidae (e.g., mole rates, bamboo rats, and zokors). In some certain embodiments, a genetically modified rodent described herein is selected from a true mouse or rat (family Muridae), a gerbil, a spiny mouse, and a crested rat. In some certain embodiments, a genetically modified mouse described herein is from a member of the family Muridae. In some embodiment, a non-human animal described herein is a rodent. In some certain embodiments, a rodent described herein is selected from a mouse and a rat. In some embodiments, a non-human animal described herein is a mouse.
[0153] In some embodiments, a non-human animal described herein is a rodent that is a mouse of a C57BL strain selected from C57BL/A, C57BL/An, C57BL/GrFa, C57BL/KaLwN, C57BL/6, C57BL/6J, C57BL/6ByJ, C57BL/6NJ, C57BL/10, C57BL/10ScSn, C57BL/10Cr, and C57BL/O1a. In some certain embodiments, a mouse described herein is a 129 strain selected from the group consisting of a strain that is 129P1, 129P2, 129P3, 129X1, 129S1 (e.g., 129S1/SV, 129S1/SvIm), 129S2, 129S4, 129S5, 129S9/SvEvH, 129/SvJae, 129S6 (129/SvEvTac), 129S7, 129S8, 129T1, 129T2 (see, e.g., Festing et al., 1999, Mammalian Genome 10:836; Auerbach, W. et al., 2000, Biotechniques 29(5):1024-1028, 1030, 1032). In some certain embodiments, a genetically modified mouse described herein is a mix of an aforementioned 129 strain and an aforementioned C57BL/6 strain. In some certain embodiments, a mouse described herein is a mix of aforementioned 129 strains, or a mix of aforementioned BL/6 strains. In some certain embodiments, a 129 strain of the mix as described herein is a 129S6 (129/SvEvTac) strain. In some embodiments, a mouse described herein is a BALB strain, e.g., BALB/c strain. In some embodiments, a mouse described herein is a mix of a BALB strain and another aforementioned strain.
[0154] In some embodiments, a non-human animal described herein is a rat. In some certain embodiments, a rat described herein is selected from a Wistar rat, an LEA strain, a Sprague Dawley strain, a Fischer strain, F344, F6, and Dark Agouti. In some certain embodiments, a rat strain as described herein is a mix of two or more strains selected from the group consisting of Wistar, LEA, Sprague Dawley, Fischer, F344, F6, and Dark Agouti.
[0155] A rat pluripotent and/or totipotent cell can be from any rat strain, including, for example, an ACI rat strain, a Dark Agouti (DA) rat strain, a Wistar rat strain, a LEA rat strain, a Sprague Dawley (SD) rat strain, or a Fischer rat strain such as Fisher F344 or Fisher F6. Rat pluripotent and/or totipotent cells can also be obtained from a strain derived from a mix of two or more strains recited above. For example, the rat pluripotent and/or totipotent cell can be from a DA strain or an ACI strain. The ACI rat strain is characterized as having black agouti, with white belly and feet and an RT1.sup.av1 haplotype. Such strains are available from a variety of sources including Harlan Laboratories. An example of a rat ES cell line from an ACI rat is an ACLC.G1 rat ES cell. The Dark Agouti (DA) rat strain is characterized as having an agouti coat and an RT1.sup.av1 haplotype. Such rats are available from a variety of sources including Charles River and Harlan Laboratories. Examples of a rat ES cell line from a DA rat are the DA.2B rat ES cell line and the DA.2C rat ES cell line. In some cases, the rat pluripotent and/or totipotent cells are from an inbred rat strain. See, e.g., U.S. 2014/0235933 A1, filed on Feb. 20, 2014, and herein incorporated by reference in its entirety.
[0156] Non-human animals are provided that comprise a disruption in a C9ORF72 locus. In some embodiments, a disruption in a C9ORF72 locus results in a loss-of-function. In particular, loss-of-function mutations include mutations that result in a decrease or lack of expression of C9ORF72 and/or a decrease or lack of activity/function of C9ORF72. In some embodiments, loss-of-function mutations result in one or more phenotypes as described herein. Expression of C9ORF72 may be measured directly, e.g., by assaying the level of C9ORF72 in a cell or tissue of a non-human animal as described herein.
[0157] Typically, expression level and/or activity of C9ORF72 is decreased if the expression and/or activity level of C9ORF72 is statistically lower (p0.05) than the level of C9ORF72 in an appropriate control cell or non-human animal that does not comprises the same disruption (e.g., deletion). In some embodiments, concentration and/or activity of C9ORF72 is decreased by at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99% or more relative to a control cell or non-human animal which lacks the same disruption (e.g., deletion).
[0158] In other embodiments, cells or organisms having a disruption in a C9ORF72 locus that reduces the expression level and/or activity of C9ORF72 are selected using methods that include, but not limited to, Southern blot analysis, DNA sequencing, PCR analysis, or phenotypic analysis. Such cells or non-human animals are then employed in the various methods and compositions described herein.
[0159] In some embodiments, an endogenous C9ORF72 locus is not deleted (i.e., intact). In some embodiments, an endogenous C9ORF72 locus is altered, disrupted, deleted or replaced with a heterologous sequence (e.g., a reporter gene encoding sequence). In some embodiments, all or substantially all of an endogenous C9ORF72 locus is replaced with an insert nucleic acid; in some certain embodiments, replacement includes replacement of an entire coding sequence of an endogenous C9ORF72 locus with a, lacZ reporter gene so that the lacZ reporter gene is in operable linkage with a C9ORF72 promoter (e.g., an endogenous C9ORF72 promoter). In some embodiments, a portion of a reporter gene (e.g., a function fragment thereof) is inserted into an endogenous non-human C9ORF72 locus. In some embodiments, the reporter gene is a lacZ gene. In some embodiments, a reporter gene is inserted into one of the two copies of the endogenous C9ORF72 locus, giving rise to a, non-human animal that is heterozygous with respect to the reporter gene. In some embodiments, a non-human animal is provided that is homozygous for a reporter gene.
Methods Employing Non-Human Animals Having Disruption in a C9ORF72 Locus
[0160] Non-human animals as described herein provide improved animal models for neurodegenerative diseases, disorders and conditions. In particular, non-human animals as described herein provide improved animal models that translate to human diseases such as, for example, ALS and/or FTD, characterized by upper motor neuron symptoms and/or non-motor neuron loss.
[0161] For example, a disruption in a C9ORF72 locus as described herein may result in various symptoms (or phenotypes) in the non-human animals provided herein. In some embodiments, deletion of a C9ORF72 locus results in non-human animals that are grossly normal at birth, but that develop ALS-like symptoms upon aging, e.g., after about 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 13 weeks, 14 weeks, 15 weeks, 16 weeks, 17 weeks, 18 weeks, 19 weeks, 20 weeks, 21 weeks, 22 weeks, 23 weeks, 24 weeks, 25 weeks, 26 weeks, 27 weeks, 28 weeks, 29 weeks, 30 weeks, 31 weeks, 32 weeks, 33 weeks, 34 weeks, 35 weeks, 36 weeks, 37 weeks, 38 weeks, 39 weeks, 40 weeks, 41 weeks, 42 weeks, 43 weeks, 44 weeks, 45 weeks, 46 weeks, 47 weeks, 48 weeks, 49 weeks, 50 weeks, 51 weeks, 52 weeks, 53 weeks, 54 weeks, 55 weeks, 56 weeks, 57 weeks, 58 weeks, 59 weeks, 60 weeks, etc. In some embodiments, deletion of a C9ORF72 locus results in abnormal functions of one or more cell types, e.g., a neuron and/or a portion thereof. A neuron includes a sensory neuron or a motor neuron. Other phenotypes associated with ALS and/or FTD may be present in non-human animals described herein. For example, an ALS-like phenotype may involve impairment of one or more neurons, e.g., motor neurons and/or sensory neurons. Further, an ALS-like phenotype involving upper motor neurons may result in spasticity (e.g., spastic paralysis, rigidity), increased and/or abnormal reflexes (e.g., Babinski's sign), tremors and a combination thereof. An ALS-like phenotype involving impairment of lower motor neurons may result in muscle weakness and wasting, fasciculations, and a combination thereof, and/or impairment of the bulbar resulting in an inability to swallow and tongue fasciculations. An ALS-like symptom may also comprise one or more of the following phenotypes: a) kyphosis; b) abnormal hind limb clasping, dragging or toe curling; c) deficiency in motor coordination and motor learning ability, deficiency in rotarod, catwalk and/or open field test(s); d) motor neuron loss in the spinal cord; e) astrocytosis in the spinal cord; f) weight loss compared with a control rodent; g) accumulation of poly-ubiquitinated proteins and/or (h) increased neurological scoring using the ALS-TDI neurological scoring system (Table 3).
TABLE-US-00005 TABLE 3 ALS-TDI neurological scoring system Score of 0: Full extension of hind legs away from lateral midline when mouse is suspended by its tail, and mouse can hold this for two seconds, suspended two to three times. Score of 1: Collapse or partial collapse of leg extension towards lateral midline (weakness) or trembling of hind legs during tail suspension. Score of 2: Toes curl under at least twice during walking of 12 inches, or any part of foot is dragging along cage bottom/table. Score of 3: Rigid paralysis or minimal joint movement, foot not being used for generating forward motion. Score of 4: Mouse cannot right itself within 30 seconds after being placed on either side.
[0162] Thus, in at least some embodiments, non-hum animals described herein provide improved animal models for neurodegenerative diseases, disorders or conditions (e.g., ALS and/or FTD) and can be used for the development and/or identification of therapeutic agents for the treatment, prevention and/or inhibiting one or more phenotypes (or symptoms) of neurodegenerative diseases, disorders or conditions. In some embodiments, one or more symptoms (or phenotypes) in non-human animals described herein appear in Table 3.
[0163] Non-human animals as described herein also provide an in vivo system for identifying a therapeutic agent for treating, preventing and/or inhibiting one or more symptoms of neurodegenerative diseases, disorders or conditions (e.g., ALS and/or FTD). In some embodiments, an inhibitory effect of a therapeutic agent is determined in vivo, by administering said therapeutic agent to a non-human animal that has a C9ORF72 disruption as described herein, and develops neurodegenerative symptoms after 38 weeks of age.
[0164] Non-human animals as described herein also provide improved animal models for inflammatory or autoimmune diseases, disorders and conditions. In particular, non-human animals as described herein provide improved animal models that translate to human inflammatory disease characterized by infiltration of immune cells in various organs (e.g. kidney, liver, spleen, etc.). In addition, non-human animals as described herein provide improved animal models that translate to human autoimmune disease characterized by the increased presence of autoantibodies (e.g., IgG and IgM) in the serum.
[0165] For example, a disruption in a C9ORF72 locus as described herein may result in various conditions (or phenotypes) in the non-human animals provided herein. In some embodiments, deletion of a, C9ORF72 locus results in non-human animals that are grossly normal at birth, but that develop inflammatory and/or autoimmune conditions upon aging, e.g., after about 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 13 weeks, 14 weeks, 15 weeks, 16 weeks, 17 weeks, 18 weeks, 19 weeks, 20 weeks, 21 weeks, 22 weeks, 23 weeks, 24 weeks, 25 weeks, 26 weeks, 27 weeks, 28 weeks, 29 weeks, 30 weeks, 31 weeks, 32 weeks, 33 weeks, 34 weeks, 35 weeks, 36 weeks, 37 weeks, 38 weeks, 39 weeks, 40 weeks, 41 weeks, 42 weeks, 43 weeks, 44 weeks, 45 weeks, 46 weeks, 47 weeks, 48 weeks, 49 weeks, 50 weeks, 51 weeks, 52 weeks, 53 weeks, 54 weeks, 55 weeks, 56 weeks, 57 weeks, 58 weeks, 59 weeks, 60 weeks, etc. In some embodiments, deletion of a C9ORF72 locus results in an infiltration of one or more immune cell types, e.g., plasma cells, monocytes, granulocytes and/or macrophages. Other phenotypes associated with an inflammatory and/or autoimmune condition may be present in non-human animals described herein. For example, an inflammatory or autoimmune condition may involve enlargement of one or more of the spleen, lymph nodes, kidney, and/or liver. Further, an inflammatory or autoimmune condition involving the blood may result in an increase presence of autoantibodies. An inflammatory or autoimmune condition involving the liver may result in hepatitis.
[0166] Thus, in at least some embodiments, non-human animals as described herein provide improved animal models for inflammatory and/or autoimmune diseases, disorders or conditions and can be used for the development and/or identification of therapeutic agents for the treatment, prevention and/or inhibiting one or more phenotypes (or symptoms) of an inflammatory and/or autoimmune disease, disorder or condition. In some embodiments, an inflammatory and/or autoimmune disease, disorder or condition is present in one or more organs or tissues of a non-human animal described herein. In some certain embodiments, one or more organs or tissues includes spleen, liver, lymph nodes, kidney, bone marrow, and blood.
[0167] Non-human animals as described herein also provide an in vivo system for identifying a therapeutic agent for treating, preventing and/or inhibiting one or more symptoms of an inflammatory and/or autoimmune disease, disorder or condition. In some embodiments, an inhibitory effect of a therapeutic agent is determined in vivo, by administering said therapeutic agent to a non-human animal that has a C9ORF72 disruption as described herein, and develops an inflammatory and/or autoimmune disease, disorder or condition after 8 weeks of age. In various embodiments, an inflammatory and/or autoimmune disease, disorder or condition is or comprises glomerulonephritis or hepatitis.
[0168] Non-human animals may be administered a therapeutic agent to be tested by any convenient route, for example by systemic injection, pumps for long-term exposure, or direct intracerebral injection. Such animals may be included in a behavior study, so as to determine the effect of the therapeutic agent on the behavior, e.g., motor behavior, of the non-human animals compared to appropriate control non-human animals that did not receive the therapeutic agent. A biopsy or anatomical evaluation of animal spinal cord, muscle and/or brain tissue may also be performed, and/or a sample of blood or CSP may be collected.
[0169] Non-human animals as described herein provide an improved in vivo system and source of biological materials (e.g., cells) that lack expression of C9ORF72 that are useful for a variety of assays. In various embodiments, non-human animals described herein are used to develop therapeutics that treat, prevent and/or inhibit one or more symptoms associated with a lack of C90ORF72 expression and/or activity. In various embodiments, non-human animals described herein are used to identify, screen and/or develop candidate therapeutics (e.g., antibodies, siRNA, etc.) that bind C9ORF72. In various embodiments, non-human animals described herein are used to screen and develop candidate therapeutics (e.g., antibodies, siRNA, etc.) that block activity of C9ORF72. In various embodiments, non-human animals described herein are used to determine the binding profile of antagonists and/or agonists of a C9ORF72 poly-peptide (or transcript) of a non-human animal as described herein. In some embodiments, non-human animals described herein are used to determine the epitope or epitopes of one or more candidate therapeutic antibodies that bind C90ORF72.
[0170] In various embodiments, non-human animals described herein are used to determine the pharmacokinetic profiles of a drug targeting C9ORF72. In various embodiments, one or more non-human animals described herein and one or more control or reference non-human animals are each exposed to one or more candidate drugs targeting C90ORF72 at various doses (e.g., 0.1 mg/kg, 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, 0.5 mg/kg, 1 mg/kg, 2 mg/kg, 3 mg/kg, 4 mg/kg, 5 mg/mg, 7.5 mg/kg, 10 mg/kg, 15 mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 40 mg/kg, or 50 mg/kg or more). Candidate therapeutic antibodies may be dosed via any desired route of administration including parenteral and non-parenteral routes of administration. Parenteral routes include, e.g., intravenous, intraarterial, intraportal, intramuscular, subcutaneous, intraperitoneal, intraspinal, intrathecal, intracerebroventricular, intracranial, intrapleural or other routes of injection. Non-parenteral routes include, e.g., oral, nasal, transdermal, pulmonary, rectal, buccal, vaginal, ocular. Administration may also be by continuous infusion, local administration, sustained release from implants (gels, membranes or the like), and/or intravenous injection. Blood is isolated from non-human animals (humanized and control) at various time points (e.g., 0 hr, 6 hr, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, or up to 30 or more days). Various assays may be performed to determine the pharmacokinetic profiles of administered drugs targeting C9ORF72 using samples obtained from non-human animals as described herein including, but not limited to, total IgG, anti-therapeutic antibody response, agglutination, etc.
[0171] In various embodiments, non-human animals as described herein are used to measure the therapeutic effect of blocking, modulating, and/or inhibiting C9ORF72 activity (or C9ORF72 signaling, or C9ORF72-mediated interactions) and the effect on gene expression as a result of cellular changes. In various embodiments, a, non-human animal as described herein or cells isolated therefrom are exposed to a drug targeting C9ORF72 of the non-human animal and, after a subsequent period of time, analyzed for effects on C9ORF72-dependent processes (or interactions), for example, endosomal trafficking, immune homeostasis, or motor neuron and/or non-motor neuron function.
[0172] Cells from non-human animals as described herein can be isolated and used on an ad hoc basis, or can be maintained in culture for many generations. In various embodiments, cells from a non-human animal as described herein are immortalized (e.g., via use of a virus) and maintained in culture indefinitely (e.g., in serial cultures).
[0173] In various embodiments, cells and/or non-human animals as described herein are used in various immunization regimens to determine the C9ORF72-mediated functions in the immune response to an antigen (e.g., a B cell response). In some embodiments, candidate therapeutics that bind, or block one or more functions of, C9ORF72 are characterized in a non-human animal described herein. Suitable measurements include various cellular assays, proliferation assays, serum immunoglobulin analysis (e.g., antibody titer), cytotoxicity assays, characterization of ligand-receptor interactions (e.g., immunoprecipitation assays) and characterization of ligand-ligand interactions. In some embodiments, non-human animals described herein are used to characterize the C9ORF72-mediated functions regulating an immune response to an antigen. In some embodiments, the antigen is associated with an autoimmune disease, disorder or condition. In some embodiments, the antigen is associated with an inflammatory disease, disorder or condition. In some embodiments, that antigen is associated with a neurological disease, disorder or condition. In some embodiments, the antigen is associated with an infectious agent (e.g., a bacterium). In some embodiments, the antigen is a test antigen (e.g., ovalbumin or OVA). In some embodiments, the antigen is a target associated with a disease or condition suffered by one or more human patients in need of treatment.
[0174] In various embodiments, non-human animals as described herein are used for challenge with one or more antigens to determine the therapeutic potential of compounds or biological agents to modulate C9ORF72-dependent regulation of an immune response, including but not limited to, the specific B cell-dependent responses to a given antigen.
[0175] Non-human animals as described herein provide an in vivo system for the analysis and testing of a drug or vaccine. In various embodiments, a candidate drug or vaccine may be delivered to one or more non-human animals described herein, followed by monitoring of the non-human animals to determine one or more of the immune response to the drug or vaccine, the safety profile of the drug or vaccine, or the effect on a disease or condition and/or one or more symptoms of a disease or condition. Exemplary methods used to determine the safety profile include measurements of toxicity, optimal dose concentration, efficacy of the drug or vaccine, and possible risk factors. Such drugs or vaccines may be improved and/or developed in such non-human animals.
[0176] Vaccine efficacy may be determined in a number of ways. Briefly, non-human animals described herein are vaccinated using methods known in the art and then challenged with a vaccine or a vaccine is administered to already-infected non-human animals. The response of a non-human animal(s) to a vaccine may be measured by monitoring of, and/or performing one or more assays on, the non-human animal(s) (or cells isolated therefrom) to determine the efficacy of the vaccine. The response of a non-human animal(s) to the vaccine is then compared with control animals, using one or more measures known in the art and/or described herein.
[0177] Vaccine efficacy may further be determined by viral neutralization assays. Briefly, non-human animals as described herein are immunized and serum is collected on various days post-immunization. Serial dilutions of serum are pre-incubated with a virus during which time antibodies in the serum that are specific for the virus will bind to it. The virus/serum mixture is then added to permissive cells to determine infectivity by a plaque assay or microneutralization assay. If antibodies in the serum neutralize the virus, there are fewer plaques or lower relative luciferase units compared to a control group.
[0178] Non-human animals described herein provide an in vivo system for assessing the pharmacokinetic properties and/or efficacy of a drug (e.g., a drug targeting C9ORF72). In various embodiments, a drug may be delivered or administered to one or more non-human animals as described herein, followed by monitoring of, or performing one or more assays on, the non-human animals (or cells isolated therefrom) to determine the effect of the drug on the non-human animal. Pharmacokinetic properties include, but are not limited to, how an animal processes the drug into various metabolites (or detection of the presence or absence of one or more drug metabolites, including, but not limited to, toxic metabolites), drug half-life, circulating levels of drug after administration (e.g., serum concentration of drug), anti-drug response (e.g., anti-drug antibodies), drug absorption and distribution, route of administration, routes of excretion and/or clearance of the drug. In some embodiments, pharmacokinetic and pharmacodynamic properties of drugs (e.g., C9ORF72 modulators) are monitored in or through the use of non-human animals described herein.
[0179] In some embodiments, performing an assay includes determining the effect on the phenotype and/or genotype of the non-human animal to which the drug is administered. In some embodiments, performing an assay includes determining lot-to-lot variability for a drug (e.g., a C9ORF72 modulator such as, e.g., an antagonist or an agonist). In some embodiments, performing an assay includes determining the differences between the effects of a drug administered to a non-human animal described herein and a reference non-human animal. In various embodiments, reference non-human animals may have a modification as described herein, a modification that is different as described herein (e.g., one that has a altered, disrupted, deleted, inserted, modified, etc. or otherwise non-functional C9ORF72 locus) or no modification (i.e., a wild type non-human animal).
[0180] Exemplary parameters that may be measured in non-human animals (or in and/or using cells isolated therefrom) for assessing the pharmacokinetic properties of a drug include, but are not limited to, agglutination, autophagy, cell division, cell death, complement-mediated hemolysis, DNA integrity, drug-specific antibody titer, drug metabolism, gene expression arrays, metabolic activity, mitochondrial activity, oxidative stress, phagocytosis, protein biosynthesis, protein degradation, protein secretion, stress response, target tissue drug concentration, non-target tissue drug concentration, transcriptional activity, and the like. In various embodiments, non-human animals described herein are used to determine a pharmaceutically effective dose of a drug (e.g., a drug targeting C9ORF72).
EXAMPLES
[0181] The following examples are provided so as to describe to those of ordinary skill in the art how to make and use methods and compositions of the invention, and are not intended to limit the scope of what the inventors regard as their invention. Unless indicated otherwise, temperature is indicated in Celsius, and pressure is at or near atmospheric.
Example 1. Generation of a Disruption in a Non-Human C9ORF72 Locus
[0182] This example illustrates a targeted disruption in a, C9orf72 locus of a rodent. In particular, this example specifically describes the deletion of the entire coding sequence of a mouse C9orf72 locus using a lacZ reporter construct placed in operable linkage with a mouse C9orf72 promoter. The C9orf72-lacZ targeting vector for creating a disruption in an endogenous mouse C9orf72 locus was made as previously described (see, e.g., U.S. Pat. No. 6,586,251; Valenzuela et al., 2003, Nature Biotech. 21(6):652-659; and Adams, N.C. and N. W. Gale, in Mammalian and Avian Transgenesis-New Approaches, ed. Lois, S.P.a.C., Springer Verlag, Berlin Heidelberg, 2006). The resulting modified C9orf72 locus is depicted in
[0183] Briefly, a targeting vector was generated using bacterial artificial chromosome (BAC) clones from a mouse RP23 BAC library (Adams, D. J. et al., 2005, Genomics 86:753-758) and introduced into F1 hybrid (129S6SvEvTac/C57BL6NTac) embyronic stem (ES) cells followed by culturing in selection medium containing G418. Drug-resistant colonies were picked 10 days after electroporation and screened for correct targeting as previously described (Valenzuela et al., supra; Frendewey, D. et al., 2010, Methods Enzymol. 476:295-307). The VELOCIMOUSE method (DeChiara, T. M. et al., 2010, Methods Enzymol. 476:285-294; Dechiara, T. M., 2009, Methods Mol. Biol. 530:311-324; Poueymirou et al., 2007, Nat. Biotechnol. 25:91-99) was used, in which targeted ES cells were injected into uncompacted 8-cell stage Swiss Webster embryos, to produce healthy fully ES cell-derived F0 generation mice heterozygous for the C9orf72 deletion. F0 generation heterozygous male were crossed with C57Bl6/NTac females to generate F1 heterozygotes that were intercrossed to produce F2 generation C9orf72.sup./, C9orf72.sup.+/ and wild type mice for phenotypic analyses. A second cohort of N2F2 generation mice was generated via in vitro fertilization (IVF) using frozen F1 heterozygous sperm and oocytes from C57Bl6/NTac donor females. N2F1 heterozygous offspring were then intercrossed to generate N2F2 C9orf72.sup./, C9orf72.sup.+/ and wild type mice for phenotypic analysis.
[0184] Phenotypic studies of F2 and N2F2 mice began at six (6) weeks of age. Mice were observed from birth for various developmental milestones (runting, breathing, facial and limb abnormalities, skin color, posture, righting and eye opening) until 6 weeks of age, when they were housed 2-5 per cage in 12 hours of light per day at 20-23 C., and 40-60% humidity for study. Mice were housed in 95.6309.1133.4 mm cages (Thoren) with cob bedding (The Andersons Lab Bedding) and a cotton nestlet for enrichment (Ancare). In housing, the mice were monitored twice daily for health status and had access to normal chow (LabDiet) and water ad libitum. All animal procedures were carried out in strict accordance with the recommendations in the Guide for the Care and Use of Laboratory Animals of the National Institutes of Health. The protocol was approved by the Regeneron Pharmaceuticals Institutional Animal Care and Use Committee (IACUC), and all efforts were made to minimize suffering.
[0185] TAQMAN Expression Analysis:
[0186] Axillary, brachial and cervical lymph nodes, gonadal fat pad, frontal cortex, diaphragm, spinal cord, spleen and thymus tissues were dissected fresh into RNALater stabilization reagent (QIAgen) and stored at 20C. Tissues were homogenized in TRIZOL reagent and phase separated with chloroform. The aqueous phase, containing total RNA, was purified using miRNeasy Mini Kit (QIAgen) according to manufacturer's specifications. Genomic DNA was removed using MAGMAX TURBO DNase Buffer and TURBO DNase (Ambion). mRNA was reverse-transcribed into cDNA using SUPERSCRIPT VILO Master Mix (SuperScript III RT, RNaseOUT, recombinant ribonuclease inhibitor, proprietary helper protein, random primers, MgCl.sub.2, dNTPs; Invitrogen by Life Technologies). cDNA was amplified with the TAQMAN Gene Expression Master Mix (Applied Biosystems) using the ABI 79001HT Sequence Detection System (Applied Biosystems). Beta-Actin was used as an internal control gene to normalize cDNA input differences. Thymus from wild type mice was used as a reference sample to calculate fold difference of mRNA between samples (n=5 females per tissue per genotype). Exemplary results are set forth in
[0187] LacZ Expression Profiling:
[0188] Mice were deeply anesthetized via Ketamine/Xylazine (120/5 mg/kg) IP injection and fixed by cardiac perfusion using a 0.2% glutaraldehyde, 4% paraformaldehyde solution. Brain, ribcage, lymph nodes, salivary glands, thymus, heart, lung, liver, spleen, stomach, kidney, intestine, urogenital, muscle, and hind limb tissues were dissected, rinsed in PBS and post-fixed for 30 minutes in a 0.2% glutaraldehyde, 4% paraformaldehyde solution. Tissues were washed and incubated in X-gal (1 mg/mL) staining solution for 1-24 hours at 37 C. Alter staining, tissues were washed, post-fixed in 4% paraformaldehyde and cleared in a glycerol series of 50%, 70% and 100%. Photographs were taken with a Nikon SMZ1500 stereomicroscope and Nikon DS-Ril digital camera using NIS-Elements D Imaging Software (Nikon).
[0189] Expression profiling was recorded at embryonic day 12.5 (E12.5), 6 weeks, and 28 weeks. Representative data of the relative expression profile of -galactosidase (lacZ) in E12.5 embryos (Table 4) and 6- and 28-week old C9orf72.sup./ mice (Table 5) are provided below (=: no expression; +=low expression; ++=moderate expression; +++=high expression; wt=wild type C57BL/6N; nd=not determined).
[0190] As shown in
[0191] Consistent with data shown in
[0192] Taken together, this example demonstrates that murine C9orf72 is expressed in various tissues of the nervous and immune systems. Further, this example demonstrates that at least in some tissues, expression increases with age of the animal and directly correlates with neurological and immunological phenotypes described in the following examples (see below).
TABLE-US-00006 TABLE 4 Embyro genotype lacZ expression wt C9orf72.sup.+/ +++ C9orf72.sup./ +++
TABLE-US-00007 TABLE 5 C9orf72.sup./ Tissue wt 6-wk male 28-wk male Brain +++ +++ Spinal cord +++ +++ Heart + +++ Ribcage + +++ Hindlimb ++ +++ Liver ++ +++ Lung ++ +++ Thymus + ++ Spleen + +++
Example 2. Behavioral Analysis of Non-Human Animals Having a Disruption in a C9orf72 Locus
[0193] This example demonstrates, among other things, that non-human animals (e.g., rodents) described herein develop ALS-like symptoms such as, for example, decreased body weight and significant motor abnormalities resulting from a disruption in a, rodent (e.g., mouse) C9orf72 locus as described in Example 1.
[0194] Phenotypic studies of mice having a disruption in a C9orf72 as described above were performed at 8, 18, 37 (female) and 57-60 weeks (male). Body weight was measured on a bi-weekly basis, and body composition was analyzed by uCT scan (Dynamic 60). Standard 24 scan was used to visualize mass of the cervical region of the spine. All animal procedures were conducted in compliance with protocols approved by the Regeneron Pharmaceuticals Institutional Animal Care and Use Committee.
[0195] Assessment of overall motor function was performed using blinded subjective scoring assays. Analysis of motor impairment was conducted using rotarod, open field locomotor, and catwalk testing. Motor impairment score was measure using the system developed by the ALS Therapy Development Institute (ALSTDI, Gill A. et al., 2009, PLoS One 4:e6489). During catwalk testing, subjects walk across an illuminated glass platform while a video camera records from below. Gait related parameterssuch as stride pattern, individual paw swing speed, stance duration, and pressure are reported for each animal. This test is used to phenotype mice and evaluate novel chemical entities for their effect on motor performance. CatWalk XT is a system for quantitative assessment of footfalls and gait in rats and mice. It is used to evaluate the locomotor ability of rodents in almost any kind of experimental model of central nervous, peripheral nervous, muscular, or skeletal abnormality.
[0196] CatWalk Gait Analysis:
[0197] Animals are placed at the beginning of the runway of Noldus CatWalk XT 10, with the open end in front of them. Mice spontaneously run to the end of the runway to attempt to escape. The camera records and the software of the system measures the footprints. The footprints are analyzed for abnormalities in paw placement.
[0198] Open Field Test:
[0199] Mice are placed in the Kinder Scientific open field system and evaluated for 60 minutes. The apparatus uses infrared beams and computer software to calculate fine movements, X+Y ambulation, distance traveled, number of rearing events, time spent rearing, and immobility time.
[0200] Rotorod:
[0201] The rotorod test (IITC Life Science, Woodland Hills, Calif.) measures the latency for a mouse to fall from a rotating beam. The rotorod is set to the experimental regime that starts at 1 rpm and accelerates up to 15 rpm over 180 seconds. Then, the animals' latency to fall following the incremental regime is recorded. The average and maximum of the three longest durations of time that the animals stay on the beam without falling off are used to evaluate falling latency. Animals that manage to stay on the beam longer than 180 seconds are deemed to be asymptomatic.
[0202] Upper motor neuron impairment presents as spasticity (i.e., rigidity), increased reflexes, tremor, bradykinesia, and Babinski signs. Lower motor neuron impairment presents as muscle weakness, wasting, clasping, curling and dragging of feet, and fasciculations. Bulbar impairment presents as difficulty swallowing, slurring and tongue fasciculations. Table 6 sets forth the scoring methodology related to motor impairment, tremor and rigidity of animals during testing. Exemplary results are set forth in
[0203] As shown in
[0204] Rotarod and CatWalk gait analysis on C9orf72.sup./ mice demonstrated significantly decreased loco-motor behaviors and fewer rearing events, indicating hind limb impairment. CatWalk gait analyses revealed signs of impaired lower inter-limb coordination and reduced stride length, as well as bradykinesia and dragging of hind limbs. These data indicated significant gait abnormalities as compared to wild type. No difference between wild type and C9orf72.sup./ mice was observed in regard to maximum time on the rotarod. As early as 36 weeks of age, C9orf72.sup./ mice demonstrated significant and progressive motor deficits.
[0205] In another experiment, the lumbar portion of spinal cords from wild type and C9orf72.sup./ mice (n=5, 60 weeks old) were collected for histopathological analysis. No difference in total number of motor neurons in the spinal cords was observed (
[0206] In a similar experiment, motor abnormalities were assessed in wild type (C9orf72.sup.+/+, n=14; 11 female, 3 male) and C9orf72.sup./ (n=17; 12 female, 5 male) starting at 32 weeks up to 60 weeks of age as percent of living animals at a given week. Mice were weighed weekly and assessment of overall motor function was performed using blinded subjective scoring assays (as described above). Weekly or bi-monthly clinical neurological exams were performed on the two groups of mice looking at their motor impairment, tremor and rigidity of their hind limb muscles. For motor impairment, we followed a blinded neurological scoring scale (described above) from of zero (no symptoms) to four (mouse cannot right themselves within 30 seconds of being placed on their side). For tremor and rigidity, we created a scoring system with a scale from zero (no symptoms) to three (severe). All data reported as meanSEM. Representative results are set forth in
[0207] Locomotor behaviors were evaluated for 60 minutes every other week using the automated Open Field system (Kinder Scientific), rotarod test (Rota Rod, IITC Life Science, Woodland Hills, Calif.) and gait analysis (CatWalk XT 10, Noldus) as described above. All data reported as meanSEM. Representative results are set forth in
[0208] Using the scoring scales described above, the inventors observed that at around 40 weeks of age, the C9orf72.sup./ mice started showing significant weakness and collapsing of their hind legs towards lateral midline, as well as mild tremor and rigid hind limb muscles (P<0.0001), suggesting the onset of upper and lower motor neuron pathology. Further, all of the wild-type mice lived past 60 weeks of age, but only 53% C9orf72.sup./ mice (9 of 17; 5 female, 4 male) were alive at 60 weeks of age (
[0209] From the open field assay, the inventors observed that C9orf72.sup./ mice display significantly decreased locomotor behaviors compared to their wild-type counterparts (P=0.0008). These mice also displayed significantly less rearing behaviors (P=0.0009), which indicated impairment of their hind limbs. No significant change in the maximum time mice would stay on a rotating beam at any time during the study was observed between wild type and C9orf72.sup./ mice. From the CatWalk gait analysis, the inventors observed that C9orf72.sup./ mice have significantly impaired lower interlimb coordination (P=0.0005) and stride length (P=0.0013), as well as bradykinesia and dragging of hind limbs. These data indicated significant gait abnormalities in C9orf72.sup./ mice as compared to wild type. Thus, the example demonstrates that, starting at around 36 weeks of age, C9orf72.sup./ mice show significant and progressive motor deficits as compared to wild type.
[0210] In another experiment, heterozygous (C9orf72.sup.+/) and homozygous (C9orf72.sup./) mice were examined using a grip strength test. Briefly, the grip strength measures the neuromuscular function as maximal muscle strength of forelimbs, and is assessed by the grasping applied by a mouse on a grid that is connected to a sensor. Three trials were carried out in succession measuring forelimb-strength only. All grip strength values obtained were normalized against mouse body weight. The grip strength test was performed thirteen wild-type, seven C9orf72.sup.+/ and eighteen C9orf72.sup./ mice at 20 weeks of age (before the onset of motor symptoms) and on twelve wild-type, four C9orf72.sup.+/, and thirteen C9orf72.sup./ mice at 60 weeks of age. Representative data is set forth in
[0211] As shown in
[0212] Taken together, this example demonstrates that non-human animals described above demonstrate a measurable neurodegenerative phenotype and, therefore, provide useful models of amyotrophic lateral sclerosis (ALS) and/or frontotemporal dementia (FTD), which non-human animals have a genome comprising a deletion of the entire coding sequence (i.e., exons 2-10) of an endogenous C9orf72 locus resulting from insertion of a reporter gene (e.g., lacZ). Such animal models provide a useful in vivo system for the development and screening of therapeutic candidates for the treatment of ALS and/or FTD.
TABLE-US-00008 TABLE 6 0 1 2 3 Motor impairment no phenotype clasping clapsing & dragging paralysis Tremor none mild moderate severe Rigidity none mild moderate severe
Example 3. Immunophenotypic Analysis of Non-Human Animals Having a Disruption in a C9orf72 Locus
[0213] This example demonstrates that non-human animals made according to Example 1 demonstrate an immunological phenotype characterized by, in some embodiments, splenomegaly and lymphadenopathy resulting from infiltration of various immune cell populations. Further, this example specifically demonstrates such non-human animals develop glomerulonephritis characterized by infiltration of immune cell populations in the kidney. Without wishing to be bound by any particular theory, the present inventors propose that the C9ORF72 locus product plays a critical role in immune function and the loss of C9ORF72 polypeptide in non-human animals described herein is not the prominent mechanism of ALS and/or FTD disease. Various tissues were harvested from C9orf72.sup./ and wild type mice for analysis (n=4-6 animals per genotype at 8, 18, and 37 weeks for females, and 9-10, 18, and 57-60 weeks for males).
[0214] Cell Preparation and Flow Cytometry Analysis:
[0215] Maximum blood volume was collected into EDTA coated tubes by cardiac puncture immediately following CO.sub.2 euthanization and approximately 200 L was transferred into heparin-coated tubes for FACS preparation. Spleen, bone marrow, and cervical lymph nodes were harvested, dissociated into single cell suspensions in Dulbecco's 1PBS with 2% fetal bovine serum (Stem Cell Technologies) plus 2 mM EDTA (Ambion) and filtered using methods known in the art. Red blood cell (RBC) lysis was performed on blood, spleen, and bone marrow using RBC lysis buffer (eBioscience) or ACK Lysing Buffer (Life Technologies). Lymph node, spleen, and bone marrow cells were counted using a Cellometer Auto T4 Cell Viability Counter (Nexcelom Bioscience) and plated for approximately 10 million cells per well for spleen, and 1 million cells per well or maximum volume for lymph nodes and bone marrow. Blood was plated at maximum volume (approximately 250 L) per well. Cells were treated with LIVE/DEAD Fixable Aqua stain, (Life Technologies) at room temperature, spun down, and re-suspended in blocking solution (purified anti-mouse CD16/CD32 mAb, BD Pharmingen, 1:100 in FACS buffer) for 15 minutes on ice. Cells were stained with conjugated antibodies for 30 minutes on ice, washed, fixed (BD Cytofix/cytoperm kit) and washed again. Cells were finally resuspended in FACS buffer (Dulbecco's 1PBS with 2% fetal bovine serum, Stem Cell Technologies, plus 2 mM EDTA, Ambion) and analyzed on a BD FACSCanto Flow Cytometer II or LSRFortessa Flow Cytometer (BD Biosciences). Foxp3 staining (eBioscience) was performed according to manufacturer's specifications.
[0216] Plasma cell staining panel: CD11b (M1/70; Biolegend), CD11c (N418; Biolegend), CD3 (145-2C11; Biolegend), B220 (RA3-6B2; Biolegend), CD19 (1D3; BD Pharmingen), CD138 (281-2; BD Pharmingen), and CD45 (30-F11; BD Pharmingen). Myeloid cell staining panel: F4/80 (BM8; Biolegend), CD115 (AFS98; eBioscience), Ly6G (RB6-8C5; eBioscience), CD11b (M1/70; eBioscience), CD45 (30-F11; BD Biosciences), and Ly6C (AL-21; BD Biosciences). Antibodies to CD8, CD25, CD62L, CD69, CD127, PD1 (RPMI-30), NKp46 were obtained from BioLegend (San Diego, Calif.). Foxp3 antibody was obtained from eBioscience (San Diego, Calif.). CD49b antibody was obtained from BD Biosciences (San Jose, Calif.). Data, were analyzed using FlowJo Software (Tree Star). Counts for perent positive and total cell number were performed for spleen, cervical lymph nodes, bone marrow, and kidney of 30-35 week old females (wild type: n=4; C9orf72.sup./ n=4) on a Nexelcom Bioscience Cellometer Auto 2000 Cell Viability Counter with AO/PI Viability dye (acridine orange and propidium iodide). Cell counts were used to determine absolute number of cell populations observed by surface staining and graphed accordingly.
[0217] Histology:
[0218] Tissues were harvested into 4% paraformaldehyde (PFA, Electron Microscopy Sciences) or collected following transcardial perfusion with 50 mL saline solution, 50 mL 4% PFA in acetate buffer at pH6.5 and finally 50 mL 4% PFA solution in borate buffer at pH9.5. Spinal cords were collected into 15% followed by 30% sucrose solution in borate buffer until they dropped. All other tissues were post-fixed in 4% PFA and transferred to 70% ethanol after 24 or 48 hours. Paraffin embedding, sectioning, and hematoxylin and eosin (H&E) staining were performed by a commercial histology laboratory (Histoserv, Inc.; Germantown, Md.). Immunohistochemistry for IgM, IgG, complement factor C3, CD45R, CD3, CD138, and F4/80 was completed by a commercial laboratory (Histotox Labs; Boulder, Colo.). Motor neuron cell count and cell body area were quantified using Image J. Motor neuron count represents the average from three slides per animal, n=5 mice and cell body area represents the average from three slides per animal, 10 motor neurons per slide, n=5 mice. Complement Factor C3 IHC was quantified using Halo.
[0219] Hematology Assays:
[0220] Blood samples were collected via retro-orbital eye bleeds under isoflurane anesthesia or by cardiac puncture after euthanasia by CO.sub.2 inhalation in accordance with Regeneron IACUC protocol. Complete Blood Count (CBC) with differential was performed on 20 L of whole blood using Hemavet 950 (Drew Scientific Group) and clinical chemistry was run on serum samples using ADVIA 1800 Chemistry System (Siemans Medical Solutions USA). ELISAs were performed on plasma samples using the following: Mouse IgG Rheumatoid Factor ELISA Kit and Mouse IgM Rheumatoid Factor ELISA Kit (Shibayagi Co., Ltd.), Mouse Anti-dsDNA Total Ig ELISA kit, Mouse Anti-Nuclear Antibodies (ANA) Total Ig ELISA kit, Mouse Anti-Sm (Smith Antigen) Total Ig ELISA kit, Mouse Anti-Cardiolipin Total Ig ELISA kit (Alpha Diagnostic Intl.), and IgG and IgM mouse EISA kit (Abcam) according to manufacturer's specifications. Samples were read on a Spectramax M5 Microplate Reader at 450 nm (Molecular Devices). Samples were analyzed in duplicate and averaged for mean value. IFN-, IL-1, IL-2, IL-4, IL-6, IL-10, IL-12 total, IL-17, MCP-1, and TNF-x were measured in plasma samples using a Multi-Spot 10-plex electrochemiluminescence detection assay (Meso Scale Discovery) according to manufacturer's specifications and read on a Meso Sector S 600 plate reader at 620 nm (Meso Scale Discovery). Samples were analyzed in duplicate and averaged for mean value.
[0221] RNA Isolation, Sequencing and Analysis:
[0222] Spleen and cervical lymph nodes were dissected fresh into RNALater stabilization reagent (Qiagen) and stored at 20 C. Total RNA was isolated using MagMAX Nucleic Acid Isolation Kit (Ambion) per manufacturer's specifications. RNA was quantified using UV spectrophotometer and RNA integrity was evaluated by Qiaxcel (Qiagen). PolyA mRNA was purified from total RNA using Dynabeads mRNA kit (Invitrogen) and strand specific RNA-Seq libraries were prepared with the ScriptSeq RNA-seq Library Preparation kit (Illumina). RNA-Seq libraries were sequenced to a length of 33 bp using Hiseq 2000 NGS sequencer (Illumina). Gene expression levels were derived from raw sequencing reads using Nimbus2, an RNA-Seq software developed by Regeneron Pharmaceuticals, Inc.
[0223] Urinalysis Method; Urine samples were obtained via spot collection and urinary albumin concentration was determined with Albuwell M indirect competitive ELISA kit (Exocell, Philadelphia, Pa.). Urinary creatinine concentration was assayed using the Creatinine Companion kit (Exocell). Assays were performed according to manufacturer's instructions and data obtained were used to calculate the urine albumin-to-creatinine ratio (ACR).
[0224] Statistical Analysis:
[0225] Statistical and graphical analyses were performed using GraphPad Prism software (version 3.0). Data were analysed using Student's unpaired t-test and one-way analysis of variance (ANOVA). Results were considered statistically significant at p values <0.05 (error bars depict s.e.m.). Exemplary results are set forth in
[0226] As shown in
[0227] CBC data with differential of whole blood shows that C9orf72.sup./ mice develop a significant increase in circulating neutrophils, eosinophils and monocytes as compared to wild type, while demonstrating a significant decrease in circulating lymphocytes (
[0228] H&E staining revealed a mixed population of cells with multiple morphologies in the spleen and cervical lymph nodes of C9orf72.sup./ mice (
[0229] The observed enlargement of spleens and lymph nodes in C9orf72.sup./ mice indicated a neoplastic or immune dysregulation disease process, which has not been previously reported in ALS-FTD) patients. Histopathological analysis on C9orf72.sup./ lymphoid tissues (i.e., staining lymph node and spleen sections from 8-60 week old mice with hematoxylin and eosin (H&E)) confirmed that the basic cellular organization of enlarged lymph nodes was preserved. Further, IHC staining confirmed the presence of 13 cells (CD45R.sup.+) in the cortex and T cells (CD3.sup.+) between the follicles and in the paracortex zone. However, there was expansion of the cortical and medullary nodal architecture by a cell population consisting mostly of large round cells with variably distinct borders, and with a single round nucleus surrounded by eosinophilic and foamy cytoplasm. A similar cellular infiltrate was also present in the spleen, predominantly located within the red pulp, which expanded the splenic architecture and, as a result, splenic weights in C9orf72.sup./ mice. It was also noted that an abundance of plasmacytoid cells containing perinuclear halos, consistent with plasma cell morphology, along with occasional Mott cells were present. Similar mixed infiltrates were not observed in wild type and C9orf72.sup.+/ (heterozygous) mice.
[0230] The large, round cell population did not stain consistently with CD45R, CD3, or CD138, but was strongly positive for F4/80, a macrophage lineage marker. IHC signal was predominant on the cell membrane but scant in the cytoplasm due to the highly vacuolated cytoplasm. In contrast, WT and heterozygous control F4/80 staining was characteristic of cytoplasmic and membranous staining pattern expected for macrophages, with overall F4/80 signal more intense than that observed in C9orf72.sup./ mice (see below, e.g.,
[0231] H&E and IHC analyses of additional organs from mice aged 8-60 weeks revealed sporadic thymus medullary hyperplasia and bone marrow focal fibrosis and/or myeloid hyperplasia in certain C9orf72.sup./ mice. A more common observation was the presence of a prominent population of dendritic cells found in the liver and kidneys of null mice. These elongated to angular cells were F4/80.sup.+ and morphologically resembled typical dendritic cells (DC), though larger in size and more numerous. They were more pronounced in C9orf72.sup./ liver as early as 8 weeks compared with wild type, though there was no evidence of associated liver disease. We also observed an increase in F4/80.sup.+ cells in C9orf72.sup./ kidney at 8 weeks that became more prominent with age. DC were located primarily within the outer medulla, where they formed aggregates in the vicinity of the macula densa and adjacent tubules, along with prominent cuffs around glomeruli in association with lymphocytes. We noted increasing infiltrates of mixed leukocytes in the kidney as mice aged, accompanied by varying degrees of immune-mediated glomerular disease that was well-established by 35-60 weeks of age. No evidence of inflammation in brain or spinal cord tissue was observed in any animals examined. Thus, the spleen and lymph nodes were the major sites of immune pathology in C9orf72.sup./ mice with indications of secondary progressive glomerular disease in the kidney.
[0232] As shown in
[0233] The percentage of B cells (CD45.sup.+CD19.sup.+) was either unchanged or reduced in female C9orf72.sup./ mice as compared to wild type, depending on the organ examined (e.g., cervical lymph nodes). C9orf72.sup./ female mice demonstrate increasing percentages of B cells transitioning to plasma cells/plasma blasts (CD45.sup.+CD19.sup.intB220.sup.intCD138.sup.+) and mature plasma cells (CD45.sup.+CD19.sup.B220.sup.CD138.sup.+) in spleen, lymph node and bone marrow as compared to wild type (
[0234] As shown in
[0235] Histopathological analysis in the context of CD45R, CD3 and CD138 expression was also analyzed in the spleen and cervical lymph nodes of wild type and C9orf72.sup./ mice (
[0236] In the cervical lymph nodes, C9orf72.sup./ mice demonstrated islands of lymphoid tissues scattered amongst large aggregates of round cells with a, single nucleus and abundant eosinophilic cytoplasm (
[0237] Histopathological analysis in the context of F4/80 expression was also analyzed in the spleen and cervical lymph nodes of wild type and C9orf72.sup./ mice (
[0238] Total CD45.sup.+ (common leukocyte antigen) cell counts were increased in all tissues examined from C9orf72.sup./ mice, which was consistent with immune infiltration observed. However, CD45.sup.+ percentages compared to total cell populations assayed were either unchanged or reduced as compared to wild type (
[0239] Additional FACS analysis was done on 30-35 week old females, a time point of specific interest as the majority of null mice have developed renal pathology but remained viable. As shown in
[0240] As shown above, percentages of CD45.sup.+CD8.sup.+ and CD45.sup.+CD44.sup.+ cells were overall reduced in C9orf72.sup./ mice as compared to wild type mice, which was likely a consequence of the increase in proportion of myeloid cells consistent with gene signature data. In contrast, total cell counts for these T cell populations were increased in C9orf72.sup./ mice. This was reflective of the gross expansion of lymphoid tissue and overt immune infiltration observed. CD8.sup.+ and CD4.sup.+ T cell populations were further subdivided based on the expression of additional surface activation markers (
[0241] Data from cytokine panels (
[0242] As shown in
[0243] Further analysis of kidneys revealed large, F4/80.sup.+ mononuclear cells that had characteristics of dendritic cells present in high numbers oriented around the glomeruli of 35-41 week old C9orf72.sup./ mice (
[0244] To further measure the severity of kidney disease observed in null mice, H&E stained kidney sections were blindly scored for membranoproliferative glomerulonephritis, interstitial mononuclear inflammation, hyaline cast formation, glomerulosclerosis, and basophilic tubules; categories of renal disease associated with immune mediated glomerulonephropathy. As shown in
[0245] Also, C9orf72.sup./ mice demonstrated increased levels of total IgG and IgM autoantibodies by ELISA as compared to wild type mice, which indicated autoimmune disease (
[0246] Further, C9orf72.sup./ mice demonstrated a significant increase in circulating rheumatoid factor (RF) antibodies as early as 8 weeks of age (
[0247] Increased autoantibody titers in lupus patients are positively correlated with an increased frequency of circulating T follicular helper (Tfh) cells (Xu, H. et al. Cell Immunol 295, 46-51 (2015)). Interrogation of this specific cell population (CD4+CXCR5+CD44+ICOS+PD-1+Bcl-6+) in spleen, cervical LN, mesenteric LN, and blood by FACS analysis revealed significantly increased Tfh cell populations in C9orf72.sup./ tissues compared with controls (
[0248] Expansions in plasma cells and transitioning B cells/plasmablasts can be associated with specific neoplasms such as multiple myeloma and plasmacytoma, as well as autoimmune conditions. The spleen and lymph node of C9orf72.sup./ mice were enlarged and an immune infiltrate was notably obvious, however the infiltrating cells were negative for B cell markers (CD45R), and were F4/80.sup.+ with characteristics of foamy macrophages. While the population of these cells was large, they occupied regional areas of these tissues considered appropriate for the lineage, and did not obliterate the basic architecture of these tissues. In addition, the mitotic index was low, with only rare mitoses observed. Thus, neoplasm seemed unlikely. There was, however, a population of plasma cells and occasional Mott cells present in these tissues, and evidence of glomerulonephritis, which indicated autoimmunity in C9orf72.sup./ mice. As shown above, both IgG and IgM-type anti-RF titers were significantly elevated in C9orf72.sup./ mice as compared to wild type and C9orf72.sup.+/ (heterozygous) mice (
[0249] Autoantibodies to glomerular basement membrane, or deposition of soluble immune complexes within the glomerular capillaries, followed by complement fixation and inflammation has been reported to cause renal disease (immune-mediated glorrerulonephritis). To determine if the observed increase in total immunoglobulin and autoantibody levels were contributing to glomerulonephritis, IHC was performed on kidney sections from 8-63 week old C9orf72.sup./ and wild type mice for total IgG and IgM (
[0250] Complement factor C3 deposition is commonly associated with immunoglobulin deposits on basement membranes in the kidney. IHC for complement factor C3 revealed increased staining in glomerular tufts of C9orf72.sup./ mice as compared to wild type (
[0251] Gene signature data from molecular profiling in spleen and cervical lymph nodes (8-10 and 35 week wild type and C9orf72.sup./ mice) indicated infiltration of macrophage, monocyte, and granulocyte cell populations. Depletion of T & B cells was also observed, which may reflect the increase in proportion of myeloid cells present. Global hierarchical analyses primarily separated brain samples by gender and age, rather than genotype, indicating that profiling differences in this tissue were due to the basic biology of the samples and genotype. Only C9orf72 expression was consistently different in brain tissue across both ages and genders. In contrast, samples from spleen and lymph node clustered based on genotype, with age and sex only secondary, which indicated that transcriptome differences in these organs were the result of changes in C9orf72 expression. Further, over 100 loci associated with immune function demonstrated significant expression differences in C9orf72.sup./ mice as compared to wild type for both males and females at early and late time points. Spleen and lymph node gene signatures in C9orf72.sup./ mice indicated myeloid infiltration with a simultaneous decrease in the lymphocytic footprint, consistent with CBC data (see above) demonstrating comparable total leukocyte counts among strains due to a balance between elevated myeloid cells and decreased lymphocytes. In a comparison of biosets, the strongest profiling matches were to immune response signatures, mouse models of various inflammatory conditions, and human infectious diseases. As shown in this example, immunophenotyping data demonstrated that mice having a disruption in a C9orf72 locus (C9orf72.sup./) develop splenomegaly and lymphadenopathy as early as 8 weeks of age. In particular, CBC data showed an increase in circulating monocytes, neutrophils and eosinophils in C9orf72.sup./ mice as well as decreased lymphocytes in the blood beginning at 8 weeks. Also, cervical lymph nodes get progressively larger with age in male (58 weeks) and female (37 weeks) C9orf72.sup./ mice. This example also specifically demonstrates that C9orf72.sup./ mice develop glomerulonephritis (i.e., infiltration of F4/80.sup.+ macrophages in the kidney) and autoimmune disease (i.e., significant elevated levels IgM and IgG autoantibodies) as they age. Thus, this example specifically described that rodents having a disruption in a C9orf72 locus as described in Example 1 demonstrate detectable abnormalities in the periphery and circulation as early as about 8 weeks of age. Irn particular, C9orf72 ablation lead to a chronic systemic immune response resulting in elevated inflammatory cytokines and myeloid expansion in several compartments.
Example 4. Administration of Neurotoxins to Non-Human Animals Having a Disruption in a C9orf72 Locus
[0252] This experiment demonstrates that administration of various toxins to non-human animals described herein can exacerbate aspects of the observed ALS-like phenotype. In particular, this example specifically demonstrates that administration of various toxins to C9orf72.sup./ mice mildly exacerbates the ALS-like motor phenotype and increases oxidative stress on motor neurons, but does not affect the increased inactivity and gait abnormalities in these mice. This example also demonstrates that motor neurons of C9orf72.sup./ mice develop significant mitochondrial dysfunction.
[0253] Briefly, mouse embryonic stem cells are cultured and differentiated into motor neurons, during an eight-day period. The first day, previously frozen mouse embryonic stem cells are thawed and added to a 15 mL falcon tube with five mL of embryonic stem cell medium (ES medium: DMEM with 15% FBS, 1% pen/strep., 1% glutamine, 1% non-essential amino acids, 1% nucleosides, 0.1% -mercaptoethanol, 1% sodium-pyruvate, and LIF at 10000 unit/mL), The tube is then centrifuged for five minutes at 800 rpm. The supernatant is aspirated and the cells suspended in 10 mL of ES medium. The cells are then plated on a T75 flask that is coated with 10 mL of 0.1% gelatin and incubated for 30 minutes at 37 C. to facilitate attachment to the flask bottom. The cells are then incubated overnight. The following day the medium exchanged with fresh medium for survival.
[0254] The following day medium is aspirated from the flask. The flask is washed with 10 mL of PBS, and then 5 mL of trypsin is added to detach the cells from the bottom of the flask. The cells are incubated for five minutes at 37 C. Detachment is confirmed by checking the flask under a microscope. Differentiation medium (10 mL DFNK medium: 44% advanced DMEM/F12, 44% neurobasal, 1% pen./strept., 1% glutamine, 0.1% -mercaptoethanol, 10% knock-out serum replacement) is added to the flask in order to stop the trypsin reaction. The solution from the flask is collected into a falcon tube and centrifuged for five minutes at 800 rpm. The supernatant is aspirated and the cells suspended in 12 mL DFNK medium. The cells are then plated in cell culture dishes and put in an incubator overnight at 37 C. The following day, solution with the cells is transferred to a falcon tube and centrifuged for two minutes at 500 rpm. The supernatant is aspirated and the cells suspended in 12 mL DFNK medium. The cells are then plated in new cell culture dishes and put in an incubator overnight. The next day, medium from the dish is collected and transferred to a falcon tube. The tube is then centrifuged for two minutes at 500 rpm and then the supernatant aspirated. The cells are suspended in 36 mL DFNK medium, with retinoic acid at 1 M and smoothened antagonist at 0.25 M final concentration, for motor neuron differentiation. The medium is split to 12 mL per dish across three dishes.
[0255] After three days embryoid bodies (EB) that form are dissociated. First, EBs are collected and transferred to a falcon tube. The cells are then centrifuged for two minutes at 500 rpm and the supernatant is aspirated. The cells are then washed with 4 mL of PBS-glucose. Next, 4 mL trypsin is added to the cells for chemical dissociation and are incubated for five minutes. Then, 1 mL of horse serum is added to stop the trypsin reaction. The EBs settle for five minutes and the supernatant is aspirated. 2 mL of PBS-glucose-DNase is added and the cells are mechanically dissociated ten times. The cells settle for 5 min and dissociated cells are transferred to a separate tube. 2 mL of PBS-glucose-DNase is added to non-dissociated cells and the mechanical dissociation is repeated. The cells settle for five minutes and then dissociated cells are transferred to a separate tube. The dissociated cells are centrifuged for five minutes at 800 rpm and then the supernatant is aspirated. The dissociated cells are suspended in 5 mL of embryonic-stem cell motor neuron medium (ESMN medium: neurobasal, 2% B27, 2% horse serum, 1% pen./istrept., 0.25% glutamine, 0.01% -mercaptoethanol, 10 ng/mL BDNF, 10 ng/mL CNTF, 10 ng/mL GDNF). The cells are centrifuged for five minutes at 800 rpm. The supernatant is aspirated and the cells are suspended in ESMN medium. The cells are then counted using a Countess automatic cell counter (Life Technologies) and 0.5 to 1 million cells are plated with 2 mL ESMN medium per well in each six well plate. The cells remain in either ESMN (control) or ESMN with BMAA at 0.1-100 M concentrations. Cell counts were taken using the with 0.4% trypan blue using a mean cell diameter setting of >20 m (motor neurons). Exemplary results are set forth in
[0256] In another experiment, wild type mice were administered weekly i.p. injections of BMAA (500 mg/kg) or PBS (control) for six weeks starting at week 1 (
[0257] For wild type mice, the data demonstrated that BMAA kills cultured wild type motor neurons in a dose-dependent manner via AMPA/kainite receptor-mediated pathway. Further, weekly injections (i.p.) of BMAA did not induce an ALS-like phenotype in wild type mice (
[0258] In another experiment, aged (i.e., 32-week old) wild type and C9orf72.sup./ mice were administered weekly i.p. injections of BMAA (500 mg/kg) or PBS (control) for six weeks. Body weight measurements were recorded each week up to 38 weeks starting at day zero (i.e., 32 weeks). Analysis of motor impairment via rotarod, open field locomotor, and catwalk testing (as described above) were also recorded at the start of the experiment (week 0, 10-weeks old) and every other week up to 38 weeks. Table 6 sets forth the scoring methodology related to motor impairment, tremor and rigidity of animals during testing. Exemplary results are set forth in
[0259] In another experiment, motor neurons from C9orfF72.sup./ mice were cultured as described above (see also
[0260] In another experiment, mitochondrial function was determined in wild type and C9orf72.sup./ mice. Briefly, the ratio of mitochondrial to nuclear DNA of embryonic stem cell-derived motor neurons (described above) was measured by DNA isolation using DNAzol reagent (Invitrogen). Purity and quantity of DNA were assessed using Nanodrop 2000 spechtrophotometer (Thermo Scientific) and NovaQUANT mouse mitochondrial to nuclear ratio kit (Novagen) according to manufacturers specifications. Seahorse Bioscience XFe96 Analyzer was utilized to assess mitochondrial respiration of embryonic stem cell-derived motor neurons. Percent oxygen consumption rate to the first measurement of wild type mice was recorded for 12 measurements using the XFe96 Extracellular Flux Analyzer. The mean of first three measurements represented basal respiration, the next three after addition of oligomycin (1 M) represented proton leak, the difference between basal respiration and proton leak represented ATP production, the next three measurements after the addition of FCCP (1 M) represented maximal respiration, the difference between maximal and basal respiration represented spare respiratory capacity and the final three after the addition of rotenone/antimycin A (0.5 M) represented non-mitochondrial respiration. All data were collected from at least three independent experiments and are reported as meanSEM. Student's t-test was performed for statistical analysis comparing values of wild type mice to C9orf72.sup./ mice with * for P0.05, ** for P0.01, and *** for P0.001. Exemplary results are set forth in
[0261] Previous reports have demonstrated that ATP depletion results in intracellular accumulation of Na.sup.+, leading to pathological cellular hypertrophy (Liang D). et al., 2007, Neurosurg. Focus 22(5):E2). As shown in
[0262] The present example specifically demonstrates that C9orf72.sup./ mice show ALS-like motor deficits. Further, this example highlights that while BMAA kills motor neurons in an AMPA/kainate-mediated glutamate excitotoxicity pathway, exposure to BMAA is not enough to induce disease in vivo. Moreover, exposure to BMAA only mildly exacerbates the ALS-disease phenotype in C9orf72.sup./ mice. Therefore, the data presented herein suggest that, at least in some embodiments, the loss of C9orf72 protein in C9orf72.sup./ mice is not the prominent mechanism of ALS-FTD disease.
[0263] Taken together, the present disclosure specifically demonstrates that C9orf72.sup./ mice made according to Example 1 demonstrate complete ablation of the C9orf72 locus. Further, as described herein, C9orf72.sup./ mice develop several distinct phenotypes throughout development characterized by, for example, significant motor deficits and a disruption in immune system and mitochondrial function. For example, C9orf72.sup./ mice develop an autoimmune phenotype characterized by a significant increase in serum autoantibody concentration and infiltration of various immune cells into the spleen, lymph nodes, bone marrow, kidney and blood. Interestingly, immunophenotyping data described herein illustrate that C9orf72 gene product plays a critical role in immune system homeostasis and neuronal health. In particular, splenomegaly and lymphadenopathy in C9orf72.sup./ mice are a result of infiltration of a number of cell populations including plasma cells, monocytes, granulocytes, and most notably, F4/80.sup.+ macrophages as early as 8 weeks of age and progressive through 60 weeks of age. Cytokine panel and molecular profiling data strongly suggest an increased Th1/Macrophage activating pathway in C9orf72.sup./ mice. Thus, the present disclosure specifically demonstrates that haploinsufficiency is unlikely the main cause of ALS-FTD pathology in the context of C9orf72 and provides a novel role for C9orf72 in immune function and homeostasis in a comprehensive phenotypic analysis of a non-human animal with global C9orf72 ablation.
EQUIVALENTS
[0264] Having thus described several aspects of at least one embodiment of this invention, it is to be appreciated by those skilled in the art that various alterations, modifications, and improvements will readily occur to those skilled in the art. Such alterations, modifications, and improvements are intended to be part of this disclosure, and are intended to be within the spirit and scope of the invention. Accordingly, the foregoing description and drawing are by way of example only and the invention is described in detail by the claims that follow.
[0265] Use of ordinal terms such as first, second, third, etc., in the claims to modify a claim element does not by itself connote any priority, precedence, or order of one claim element over another or the temporal order in which acts of a method are performed, but are used merely as labels to distinguish one claim element having a certain name from another element having a same name (but for use of the ordinal term) to distinguish the claim elements.
[0266] The articles a and an in the specification and in the claims, unless clearly indicated to the contrary, should be understood to include the plural referents. Claims or descriptions that include or between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The invention also includes embodiments in which more than one, or the entire group members are present in, employed in, or otherwise relevant to a given product or process. Furthermore, it is to be understood that the invention encompasses all variations, combinations, and permutations in which one or more limitations, elements, clauses, descriptive terms, etc., from one or more of the listed claims is introduced into another claim dependent on the same base claim (or, as relevant, any other claim) unless otherwise indicated or unless it would be evident to one of ordinary skill in the art that a contradiction or inconsistency would arise. Where elements are presented as lists, (e.g., in Markush group or similar format) it is to be understood that each subgroup of the elements is also disclosed, and any element(s) can be removed from the group. It should be understood that, in general, where the invention, or aspects of the invention, is/are referred to as comprising particular elements, features, etc., certain embodiments of the invention or aspects of the invention consist, or consist essentially of, such elements, features, etc. For purposes of simplicity those embodiments have not in every case been specifically set forth in so many words herein. It should also be understood that any embodiment or aspect of the invention can be explicitly excluded from the claims, regardless of whether the specific exclusion is recited in the specification.
[0267] Those skilled in the art will appreciate typical standards of deviation or error attributable to values obtained in assays or other processes described herein.
[0268] The publications, websites and other reference materials referenced herein to describe the background of the invention and to provide additional detail regarding its practice are hereby incorporated by reference.