Inducible monovalent antigen binding protein

11535668 · 2022-12-27

Assignee

Inventors

Cpc classification

International classification

Abstract

Disclosed herein are inducible monovalent target-binding proteins which are activated upon protease cleavage. Pharmaceutical compositions comprising the binding proteins disclosed herein and methods of using such formulations are further provided.

Claims

1. An inducible monovalent target-binding protein, wherein the protein comprises a first polypeptide chain and a second polypeptide chain, the first polypeptide chain comprising: a VH target-binding domain (VH), an inactive VL domain (iVL) that binds to the VH domain, a linker (L1), and a first monomeric Fc domain (Fcl) comprising a CH3 and a CH2 domain; the second polypeptide chain comprising: a VL target-binding domain (VL), an inactive VH domain (iVH) that binds to the VL domain, a linker (L6), a second monomeric Fc domain (Fc2) comprising a CH3 and a CH2 domain; wherein the iVL and the iVH each comprise at least one protease cleavage site, wherein upon activation by protease cleavage of the at least one protease cleavage site of both the iVL and the iVH, the VH and the VL associate to form an active target-binding domain, and wherein the CH3 domains of the Fcl and Fc2 form a heterodimer.

2. The inducible monovalent target-binding protein of claim 1, wherein the iVL comprises a CDRL1, CDRL2, and CDRL3, and the at least one protease cleavage site of the iVL is located within the CDRL1, CDRL2, or CDRL3.

3. The inducible monovalent target-binding protein of claim 1, wherein the iVH comprises a CDRH1, CDRH2, and CDRH3, and the at least one protease cleavage site of the iVH is located within the CDRH1, CDRH2, or CDRH3.

4. The inducible monovalent target-binding protein of claim 1, wherein the first polypeptide chain comprises a further protease cleavage site, and wherein the second polypeptide comprises a further protease cleavage site.

5. The inducible monovalent target-binding protein of claim 4, wherein the further protease cleavage site of the first polypeptide chain is located within L1, and the further protease cleavage site of the second polypeptide chain is located within L6.

6. The inducible monovalent target-binding protein of claim 1, wherein the Fcl and the Fc2 each independently comprise one or more amino acid substitutions favoring formation of a heterodimeric Fc region.

7. The inducible monovalent target-binding protein of claim 1, wherein the iVH and the iVL each are derived from an anti-respiratory syncytial virus (RSV) F-protein antibody.

8. The inducible monovalent target-binding protein of claim 1, wherein the VH, the iVL, and the L1 of the first polypeptide form a scFv.

9. The inducible monovalent target-binding protein of claim 1, wherein the VL, the iVH, and the L6 of the second polypeptide form a scFv.

10. The inducible monovalent target-binding protein of claim 1, wherein the active target-binding domain binds to a target expressed on a tumor cell.

11. The inducible monovalent target-binding protein of claim 1, wherein the active target-binding domain binds to a tumor antigen.

12. The inducible monovalent target-binding protein of claim 1, wherein the active target-binding domain binds to an immune checkpoint protein.

13. The inducible monovalent target-binding protein of claim 1, wherein the active target-binding domain binds to CD27, CD40, OX40, GITR, CD137, B7, CD28, ICOS, A2AR, B7-H3, B7-H4, BTLA, CTLA-4, IDO, KIR, LAG3, PD-1, PD-L1, TIM-3, VISTA.

14. The inducible monovalent target-binding protein of claim 1, wherein the at least one protease cleavage site of the first polypeptide and the at least one protease cleavage site is independently recognized by at least one of a serine protease, a cysteine protease, an aspartate protease, a threonine protease, a glutamic acid protease, a metalloproteinase, a gelatinase, and a asparagine peptide lyase.

15. An inducible monovalent target-binding protein, wherein the protein comprises a first polypeptide chain and a second polypeptide chain, the first polypeptide chain comprising: a VH target-binding domain (VH), an inactive VL domain (iVL) that binds to the VH domain, a linker (L1), and a first monomeric Fc domain (Fcl) comprising a CH3 and a CH2 domain; the second polypeptide chain comprising: a VL target-binding domain (VL), an inactive VH domain (iVH) that binds to the VL domain, a linker (L6), a second monomeric Fc domain (Fc2) comprising a CH3 and a CH2 domain; wherein the L1 and L6 each comprise at least one protease cleavage site, wherein upon activation by protease cleavage of the at least one protease cleavage site of both L1 and L6, the VH and the VL associate to form an active target-binding domain, and wherein the CH3 domains of the Fcl and Fc2 form a heterodimer.

16. The inducible monovalent target-binding protein of claim 15, wherein the iVH and the iVL each are derived from an anti-respiratory syncytial virus (RSV) F-protein antibody.

17. The inducible monovalent target-binding protein of claim 15, wherein the VH, the iVL, and the L1 of the first polypeptide form a scFv.

18. The inducible monovalent target-binding protein of claim 15, wherein the VL, the iVH, and the L6 of the second polypeptide form a scFv.

19. The inducible monovalent target-binding protein of claim 1, wherein the VH comprises a sequence selected from the group consisting of SEQ ID Nos. 43, 45, 47, and 49.

20. The inducible monovalent target-binding protein of claim 1, wherein the VL comprises a sequence selected from the group consisting of SEQ ID Nos. 44, 46, 48, and 50.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) The novel features of the invention are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which.

(2) FIG. 1 shows an embodiment of the inducible monovalent target-binding protein of the present disclosure illustrating activation of the target-binding protein upon proteolytic cleavage of at least one protease cleavage site in the inactive VL domain and at least one protease cleavage site in the inactive VH domain.

(3) FIG. 2 shows an inducible monovalent antibody according to the present disclosure illustrating activation of the antibody, from its prodrug from to the active drug form, upon proteolytic cleavage of at least one protease cleavage site in the linker between the VL and the inactive VH domain of one polypeptide chain and the linker between the VH and inactive VL domain of another polypeptide chain.

(4) FIG. 3 shows proteolytic activation of four exemplary inducible monovalent antibodies of this disclosure, Lanes 1 and 2 correspond to Dace-ProMonoMab, Lanes 3 and 4 correspond to Seli-ProMonoMab, Lanes 5 and 6 correspond to Ipi-ProMonoMab, and Lanes 7 and 8 correspond to Treme-ProMonoMab. The lanes marked as “−” correspond to unactivated ProMonoMab and the lanes marked as “+” correspond to proteolytically activated ProMonoMab. The indicated antibodies denote parental antibodies from which the VH and VL sequences were derived. Dace, dacetuzumab; seli, selicrelumab; ipi, ipilimumab; treme, tremelimumab.

(5) FIG. 4 shows target binding of four exemplary inducible monovalent antibodies of this disclosure. Top left panel shows CD40 binding of Dace-ProMonoMab in prodrug (dotted line) and activated (solid line) forms; top right panel shows CD40 binding of Seli-ProMonoMab in prodrug (dotted line) and activated (solid line) forms; bottom left panel shows CTLA4 binding of Ipi-ProMonoMab in prodrug (dotted line) and activated (solid line) forms; and bottom right panel shows CTLA4 binding of Treme-ProMonoMab in prodrug (dotted line) and activated (solid line) forms.

(6) FIG. 5 shows CD40 binding of Seli-ProMonoMab upon protease activation. This assay uses HEK293 cells that are engineered to express CD40 and are also engineered to express and secrete alkaline phosphatase when CD40 is activated. The amount of secreted alkaline phosphatase is measure using a substrate that changes color proportionate to the amount of secreted alkaline phosphatase. Left panel shows CD40 activation in cells by Seli-ProMonoMab in prodrug (dotted line) and activated (solid line) forms. Right panel shows CD40 activation in cells by Seli-ProMonoMab in prodrug (dotted line) and activated (solid line) forms, crosslinked with anti-human IgG Fc polyclonal antibody.

DETAILED DESCRIPTION OF THE INVENTION

(7) While preferred embodiments of the present invention have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention. It is intended that the following claims define the scope of the invention and that methods and structures within the scope of these claims and their equivalents be covered thereby

Certain Definitions

(8) The terminology used herein is for the purpose of describing particular cases only and is not intended to be limiting. As used herein, the singular forms “a”, “an” and “the” are intended to include the plural forms as well, unless the context clearly indicates otherwise. Furthermore, to the extent that the terms “including”, “includes”, “having”, “has”, “with”, or variants thereof are used in either the detailed description and/or the claims, such terms are intended to be inclusive in a manner similar to the term “comprising.”

(9) The term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, the limitations of the measurement system. For example, “about” can mean within 1 or more than 1 standard deviation, per the practice in the given value. Where particular values are described in the application and claims, unless otherwise stated the term “about” should be assumed to mean an acceptable error range for the particular value.

(10) The terms “individual,” “patient,” or “subject” are used interchangeably. None of the terms require or are limited to situation characterized by the supervision (e.g. constant or intermittent) of a health care worker (a doctor, a registered nurse, a nurse practitioner, a physician's assistant, an orderly, or a hospice worker).

(11) The term “Framework” or “FR” residues (or regions) refer to variable domain residues other than the CDR or hypervariable region residues as herein defined. A “human consensus framework” is a framework which represents the most commonly occurring amino acid residue in a selection of human immunoglobulin VL or VH framework sequences.

(12) As used herein, “Variable region” or “variable domain” refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called complementarity-determining regions (CDRs) or hypervariable regions both in the light-chain and the heavy-chain variable domains. The more highly conserved portions of variable domains are called the framework (FR). The variable domains of native heavy and light chains each comprise four FR regions, largely adopting a β-sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the βsheet structure. The CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, Md. (1991)). The constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity. “Variable domain residue numbering as in Kabat” or “amino acid position numbering as in Kabat,” and variations thereof, refers to the numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991). Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or CDR of the variable domain. For example, a heavy chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (, residues 82a, 82b, and 82c, etc according to Kabat) after heavy chain FR residue 82. The Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence. It is not intended that CDRs of the present disclosure necessarily correspond to the Kabat numbering convention.

(13) A “single chain Fv” or “scFv”, as used herein, refers to a binding protein in which the variable domains of the heavy chain and of the light chain of a traditional two chain antibody are joined to form one chain. Typically, a linker peptide is inserted between the two chains to allow for proper folding and creation of an active binding site.

(14) A “cleavage site for a protease,” as meant herein, is an amino acid sequence that can be cleaved by a protease, such as, for example, a matrix metalloproteinase or a furin. Examples of such sites include Gly-Pro-Leu-Gly-Ile-Ala-Gly-Gln (SEQ ID NO: 52) or Ala-Val-Arg-Trp-Leu-Leu-Thr-Ala (SEQ ID NO: 53), which can be cleaved by metalloproteinases, and Arg-Arg-Arg-Arg-Arg-Arg (SEQ ID NO: 54), which is cleaved by a furin. In therapeutic applications, the protease cleavage site can be cleaved by a protease that is produced by target cells, for example cancer cells or infected cells, or pathogens.

(15) As used herein, “elimination half-time” is used in its ordinary sense, as is described in Goodman and Gillman's The Pharmaceutical Basis of Therapeutics 21-25 (Alfred Goodman Gilman, Louis S. Goodman, and Alfred Gilman, eds., 6th ed. 1980). Briefly, the term is meant to encompass a quantitative measure of the time course of drug elimination. The elimination of most drugs is exponential (i.e., follows first-order kinetics), since drug concentrations usually do not approach those required for saturation of the elimination process. The rate of an exponential process may be expressed by its rate constant, k, which expresses the fractional change per unit of time, or by its half-time, t.sub.1/2 the time required for 50% completion of the process. The units of these two constants are time.sup.−1 and time, respectively. A first-order rate constant and the half-time of the reaction are simply related (k×t.sub.1/2=0.693) and may be interchanged accordingly. Since first-order elimination kinetics dictates that a constant fraction of drug is lost per unit time, a plot of the log of drug concentration versus time is linear at all times following the initial distribution phase (i.e. after drug absorption and distribution are complete). The half-time for drug elimination can be accurately determined from such a graph.

(16) Described herein are inducible monovalent target-binding proteins, pharmaceutical compositions as well as nucleic acids, recombinant expression vectors, and host cells for making such inducible monovalent binding proteins. Also provided are methods of using the disclosed inducible monovalent binding proteins in the prevention, and/or treatment of diseases, conditions and disorders. The inducible monovalent target-binding proteins of this disclosure are heteromultimeric proteins having a binding inactive form and an active form. In the binding inactive form, the protein has an immunoglobulin like structure with two arms, whereas in the active form the two arms associate with each other to form a monovalent structure, as shown in FIGS. 1 and 2. The inducible monovalent target-binding proteins are activated by cleavage of protease sites located within at least two of the domains of the heteromultimeric structure. In some embodiments, the inducible monovalent binding proteins are capable of specifically binding to a tumor antigen. In some embodiments, the inducible monovalent target-binding proteins are half-life extended through an Fc domain, and accordingly has a prolonged elimination half-life. In some instance, the inducible monovalent target-binding proteins are heteromultimeric antibodies. In some cases when a normal or healthy tissue expresses the same antigens as a tumor cell, toxicities are possible due to off-tumor antigen binding. In some embodiments, the inducible monovalent target-binding proteins disclosed herein are advantageously activated in a tumor tissue specific manner, upon exposure to proteases prevalent in tumor microenvironment. The inhibitory domains obstruct the binding domains and accordingly prevent binding of the proteins to their targets until the inhibitory domains are cleaved by proteases.

(17) Inactive Domains

(18) In one aspect, the disclosure provides an inducible monovalent target-binding protein comprising at least two inactive domains. In some embodiments, the inactive domains comprise protease cleavage sites. The inactive domains are alternatively referred to as inhibitory domains or inert domains. Examples of inactive domains include but are not limited to a variable heavy domain (VH), a variable light domain (VL), an scFv comprising a VH and a VL domain, a single domain antibody, or a variable domain of camelid derived nanobody (VHH), a non-Ig binding domain, i.e., antibody mimetic, such as anticalins, affilins, affibody molecules, affimers, affitins, alphabodies, avimers, DARPins, fynomers, kunitz domain peptides, and monobodies, a ligand or peptide. In some embodiments, the inactive domain is an inactive variable heavy (iVH) or an inactive variable light (iVL) domain. The inducible protein is in a binding inactive configuration when the inhibitory or inactive domain is associated with at least one other domain of the protein, in either the first or the second polypeptide of the inducible monovalent target-binding protein, such that said binding domain is prevented from binding its target. In its binding inactive configuration neither the first polypeptide nor the second polypeptide is able to bind a target.

(19) The at least two inactive domains each comprises at least one protease cleavage site. The protease cleavage sites are a stretch of amino acid sequences that are recognized and cleaved by any known protease, such as matrix metalloprotease (, MMP9), or furin. In some cases, an inactive domain comprising a protease cleavage site recognized by MMP9 comprises the amino acid sequence PR(S/T)(L/I)(S/T) (SEQ ID NO. 3). In some cases, an inactive domain comprising a protease cleavage site recognized by MMP9 comprises the amino acid sequence LEATA (SEQ ID NO: 4). In some cases, the protease cleavage site is recognized in a sequence-specific manner by a MMP11. In some cases, the protease cleavage site recognized by a MMP11 comprises a polypeptide having an amino acid sequence GGAANLVRGG (SEQ IN NO: 5). In some cases, the protease cleavage site is recognized by a protease disclosed in Table 1. In some cases, the protease cleavage site recognized by a protease disclosed in Table 1 comprises a polypeptide having an amino acid sequence selected from a sequence disclosed in Table 1 (SEQ ID NOS: 1-42).

(20) Proteases are proteins that cleave proteins, in some cases, in a sequence-specific manner. Proteases include but are not limited to serine proteases, cysteine proteases, aspartate proteases, threonine proteases, glutamic acid proteases, metalloproteases, asparagine peptide lyases, serum proteases, cathepsins, Cathepsin B, Cathepsin C, Cathepsin D, Cathepsin E, Cathepsin K, Cathepsin L, kallikreins, hK1, hK10, hK15, plasmin, collagenase, Type IV collagenase, stromelysin, Factor Xa, chymotrypsin-like protease, trypsin-like protease, elastase-like protease, subtilisin-like protease, actinidain, bromelain, calpain, caspases, caspase-3, Mir1-CP, papain, HIV-1 protease, HSV protease, CMV protease, chymosin, renin, pepsin, matriptase, legumain, plasmepsin, nepenthesin, metalloexopeptidases, metalloendopeptidases, matrix metalloproteases (MMP), MMP1, MMP2, MMP3, MMP8, MMP9, MMPP13, MMP11, MMPP14, urokinase plasminogen activator (uPA), enterokinase, prostate-specific antigen (PSA, hK3), interleukin-1β converting enzyme, thrombin, FAP (FAP-α), dipeptidyl peptidase, and dipeptidyl peptidase IV (DPPIV/CD26).

(21) TABLE-US-00001 TABLE 1 Exemplary Proteases and Protease Recognition Sequences Cleavage Domain Protease Sequence SEQ ID NO: MMP7 KRALGLPG  1 MMP7 (DE).sub.8RPLALWRS(DR).sub.8  2 MMP9 PR(S/T)(L/I)(S/T)  3 MMP9 LEATA  4 MMP11 GGAANLVRGG  5 MMP14 SGRIGFLRTA  6 MMP PLGLAG  7 MMP PLGLAX  8 MMP PLGC(me)AG  9 MMP ESPAYYTA 10 MMP RLQLKL 11 MMP RLQLKAC 12 MMP2, MMP9, MMP14 EP(Cit)G(Hof)YL 13 Urokinase plasminogen activator (uPA) SGRSA 14 Urokinase plasminogen activator (uPA) DAFK 15 Urokinase plasminogen activator (uPA) GGGRR 16 Lysosomal Enzyme GFLG 17 Lysosomal Enzyme ALAL 18 Lysosomal Enzyme FK 19 Cathepsin B NLL 20 Cathepsin D PIC(Et)FF 21 Cathepsin K GGPRGLPG 22 Prostate Specific Antigen HSSKLQ 23 Prostate Specific Antigen HSSKLQL 24 Prostate Specific Antigen HSSKLQEDA 25 Herpes Simplex Virus Protease LVLASSSFGY 26 HIV Protease GVSQNYPIVG 27 CMV Protease GVVQASCRLA 28 Thrombin F(Pip)RS 29 Thrombin DPRSFL 30 Thrombin PPRSFL 31 Caspase-3 DEVD 32 Caspase-3 DEVDP 33 Caspase-3 KGSGDVEG 34 Interleukin 1β converting enzyme GWEHDG 35 Enterokinase EDDDDKA 36 FAP KQEQNPGST 37 Kallikrein 2 GKAFRR 38 Plasmin DAFK 39 Plasmin DVLK 40 Plasmin DAFK 41 TOP ALLLALL 42

(22) Proteases are known to be secreted by some diseased cells and tissues, for example tumor or cancer cells, creating a microenvironment that is rich in proteases or a protease-rich microenvironment. In some case, the blood of a subject is rich in proteases. In some cases, cells surrounding the tumor secrete proteases into the tumor microenvironment. Cells surrounding the tumor secreting proteases include but are not limited to the tumor stromal cells, myofibroblasts, blood cells, mast cells, B cells, NK cells, regulatory T cells, macrophages, cytotoxic T lymphocytes, dendritic cells, mesenchymal stem cells, polymorphonuclear cells, and other cells. In some cases, proteases are present in the blood of a subject, for example proteases that target amino acid sequences found in microbial peptides. This feature allows for targeted therapeutics such as antigen-binding proteins to have additional specificity because T cells will not be bound by the antigen binding protein except in the protease rich microenvironment of the targeted cells or tissue.

(23) Inducible Monovalent Target-Binding Proteins

(24) In some embodiments, the inducible monovalent target-binding proteins described herein comprise a first and a second polypeptide chain, each polypeptide comprising an inactive variable domain, a variable heavy domain (VH) or a variable light domain (VL), and an Fc region. The inactive domain is a variable light domain (iVL) or a variable heavy domain (iVH); and the Fc region comprises a CH3 domain with amino acid substitutions, and a CH2 domain. In some embodiments, the inactive domains iVL and iVH each comprise at least one protease cleavage site which is cleaved by a protease to result in activation of the inducible monovalent target-binding proteins described herein.

(25) In some embodiments, the first polypeptide comprises an iVL, a VH, and a first Fc domain (Fc1) comprising CH3-Fc1 and CH2-Fc1; the second polypeptide comprises an iVH, a VL, and a second Fc domain (Fc2) comprising CH3-Fc2 and CH2-Fc2, which VH and VL associate to form the target-binding domain of the inducible monovalent protein, and wherein CH3-Fc1 and CH3-Fc2 form a heterodimer, as shown in FIG. 1. In some embodiments, the first polypeptide comprises an iVH, a VL, and a first Fc domain (Fc1) comprising CH3-Fc1 and CH2-Fc1; the second polypeptide comprises an iVL, a VH, and a second Fc domain (Fc2) comprising CH3-Fc2 and CH2-Fc2, which VL and VH associate to form the target-binding domain of the inducible monovalent protein, and wherein CH3-Fc1 and CH3-Fc2 form a heterodimer.

(26) An Fc domain conjugated to an effector molecule is referred to as an Fc domain molecule or an Fc domain fusion protein. The fusion protein can include, for example, a VH, a engineered antibody domain, a diabody, an scFv, a cytokine, a toxin, an enzyme, and/or a ligand attached an Fc domain, wherein the Fc domain comprises a CH3 and a CH2 domain. CH2 and CH3 domain molecules are small in size, usually less than 15 kD. It is contemplated that in certain embodiments the CH2 and CH3 domain molecules are conjugated to an effector molecule or a label. In other embodiments, CDRs/hypervariable amino acid sequences are inserted into the CH3 and/or CH2 domain. In such embodiments, the CH2 or CH3 domain vary in size depending on the length of CDR/hypervariable amino acid sequence inserted in the loops regions, how many CDRs are inserted and whether another molecule (such as an effector molecule or label) is conjugated to the CH2 or CH3 domain. In some embodiments, the Fc domain does not comprise additional constant domains (i.e. CH1). In one embodiment, the CH3 and/or CH2 domain is from IgG, IgA or IgD. In another embodiment, the CH3 and/or CH2 domain is from IgE or IgM. CH2 and CH3 domain molecules can be glycosylated or unglycosylated. For example, a recombinant CH2 or CH3 domain can be expressed in an appropriate mammalian cell to allow glycosylation of the molecule.

(27) In some embodiments, the inducible monovalent target-binding protein disclosed herein is an Fc domain molecule or an Fc fusion protein. In some embodiments, the inducible monovalent target-binding domains described herein comprise a first and second monomeric Fc domains, Fc1 and Fc2, respectively, which monomeric Fc domains associate with each other to form a heterodimeric Fc domain, and wherein a first scFv (scFv1) is attached to the N-terminus of Fc1, and a second scFv (scFv2) is attached to the N-terminus of Fc2, and further wherein the scFv1 and scFv2 each comprise at least one protease cleavage site. The first monomeric Fc1 domain comprises two domains CH3-Fc1 and CH3-Fc2, and the second monomeric Fc2 domain comprises two domains CH3-Fc2 and CH2-Fc2. Each scFv1 and scFv2 comprises an inactive domain, and a variable light (VL) or variable heavy domain (VH). In some embodiments, the inactive domains are iVL and iVH, and each comprises at least one protease cleavage site which is cleaved by a protease to result in activation of the inducible monovalent target-binding proteins described in this embodiment. The protease cleavage sites of the inactive domains are, in some cases, within the complementarity determining regions of those domains; or within the linkers that connects the inactive domains iVL and iVH with the VH or VL domains, respectively.

(28) In some embodiments, scFv1 comprises an iVH domain and a VL domain. In some embodiments, scFv1 comprises an iVL domain and a VH domain. In some embodiments, scFv2 comprises an iVH domain and a VL domain. In some embodiments, scFv2 comprises an iVL domain and a VH domain. In some embodiments, scFv1 comprises an iVL domain and a VH domain; scFv2 comprises an iVH domain and a VL domain, wherein upon cleavage of the at least one protease cleavage site in iVH and iVL the VL and VH domains associate to form an active monovalent target-binding protein. In some embodiments, scFv1 comprises an iVH domain and a VL domain; scFv2 comprises an iVL domain and a VH domain, wherein upon cleavage of the at least one protease cleavage site in iVH and iVL, the VH and VL domains associate to form an active monovalent target-binding protein.

(29) The inactive variable domains iVL and iVH each comprises complementarity determining regions CDRL1, CDRL2, CDRL3, and CDRH1, CDRH2, CDRH3, respectively, and the at least one protease cleavage site is, in certain embodiments, located within said complementarity determining regions. It is contemplated that, in some embodiments, the CDRs of iVL and/or iVH further comprise one or more mutations that prohibit the binding of said domains to a target.

(30) The proteins described herein are binding inactive in the two-armed form, and only bind target protein when in the monovalent form. In some embodiments, the proteins described herein do not have target-domain binding capability until at least one protease cleavage site in iVL and at least one cleavage site in iVH are cleaved by a protease and the VH and VL domains associate with each other to form a monovalent active target-binding domain. In some embodiments, the proteins do not have target-domain binding capability until all the protease cleavage sites in iVH and iVL are cleaved and the VH and VL domains associate with each other to form a monovalent active target-binding domain.

(31) The VH and iVL domains, the VL and iVH domains, the VL and CH2 domain, the VH and CH2 domain, and the CH3 and CH2 domains are connected to each other by internal linkers. In embodiments where the first polypeptide comprises an iVL, a VH, and a first Fc domain (Fc1) comprising CH3-Fc1 and CH2-Fc1; the second polypeptide comprises an iVH, a VL, and a second Fc domain (Fc2) comprising CH3-Fc2 and CH2-Fc2, the linkers are as follows: L1 links iVL and VH of the first polypeptide; L2 links VH and CH2-Fc1; L3 links CH2-Fc1 and CH3-Fc1; L4 links CH3-Fc2 and CH2-Fc2; L5a links CH2-Fc2 and VL; and L6 links VL and iVH of the second polypeptide. In embodiments where the first polypeptide comprises an iVH, a VL, and a first Fc domain (Fc1) comprising CH3-Fc1 and CH2-Fc1; the second polypeptide comprises an iVL, a VH, and a second Fc domain (Fc2) comprising CH3-Fc2 and CH2-Fc2, the linkers are as follows: L1′ links iVH and VL of the first polypeptide; L2′ links VH and CH2-Fc1; L3′ links CH2-Fc1 and CH3-Fc1; L4′ links CH3-Fc2 and CH2-Fc2; L5′ links CH2-Fc2 and VL; and L6′ links VH and iVL of the second polypeptide. In some embodiments, the linkers L1, L1′, L6, and L6′, each independently comprises at least one protease cleavage site which is cleaved by a protease to result in activation of the inducible monovalent target-binding proteins described herein

(32) Linkers L1, L1′, L2, L2′, L3, L3′, L4, L4′, L5, L5′, L6, and L6′ have an optimized length and/or amino acid composition. In some embodiments, linkers L1, L1′, L2, L2′, L3, L3′, L4, L4′, L5, L5′, L6, and L6′ are 3-200 amino acids in length. In some embodiments, linkers L1, L1′, L2, L2′, L3, L3′, L4, L4′, L5, L5′, L6, and L6′ have the same length or amino acid composition. In other embodiments, linkers L1, L1′, L2, L2′, L3, L3′, L4, L4′, L5, L5′, L6, and L6′ have different amino acid compositions. In other embodiments, linkers L1, L1′, L2, L2′, L3, L3′, L4, L4′, L5, L5′, L6, and L6′ have different lengths. In certain embodiments, internal linkers L1, L2, L3, and/or L4 are “short”, i.e., consist of 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12 amino acid residues. Thus, in certain instances, the linkers consist of about 12 or less amino acid residues. In the case of 0 amino acid residues, the linker is a peptide bond. In certain embodiments, linkers L1, L1′, L2, L2′, L3, L3′, L4, L4′, L5, L5′, L6, and L6′ consist of 15, 20 or 25 amino acid residues. In some embodiments, the linkers consist of about 3 to about 15, for example 8, 9 or 10 contiguous amino acid residues. Regarding the amino acid composition of the linkers L1, L1′, L2, L2′, L3, L3′, L4, L4′, L5, L5′, L6, and L6′, peptides are selected with properties that confer flexibility to the antigen-binding proteins, do not interfere with the target-binding domain as well as resist cleavage from proteases, unless the protease cleavage sites are located within the linkers. Examples of internal linkers suitable for linking the domains in the antigen-binding proteins include but are not limited to (GS).sub.n (SEQ ID NO: 55), (GGS).sub.n (SEQ ID NO: 56), (GGGS).sub.n (SEQ ID NO: 57), (GGSG).sub.n (SEQ ID NO: 58), (GGSGG).sub.n (SEQ ID NO: 59), or (GGGGS).sub.n (SEQ ID NO: 60), wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In one embodiment, internal linker L1, L1′, L2, L2′, L3, L3′, L4, L4′, L5, L5′, L6, and/or L6′ is (GGGGS).sub.4 (SEQ ID NO: 61) or (GGGGS).sub.3 (SEQ ID NO: 62).

(33) In certain instances, one or more of the linkers L1, L1′, L2, L2′, L3, L3′, L4, L4′, L5, L5′, L6, and L6′ comprise protease cleavage sites. Such protease sensitive linkers are, in certain embodiments, sensitive to protease present in specific tissue or intracellular compartments (, MMPs, furin, cathepsin B). Example sequences for such protease sensitive cleavable linkers include but are not limited to (PLGLWA).sub.n (SEQ ID NO: 63), (RVLAEA).sub.n (SEQ ID NO: 64); (EDVVCCSMSY)n (SEQ ID NO: 65), (GGIEGRGS).sub.n (SEQ ID NO: 66), which are recognized by MMP-1, and (GFLG)n (SEQ ID NO: 67) which are recognized by furin. The linkers containing protease cleavage sites play a role in activation of the inducible monovalent target-domain binding protein. In some embodiments, the binding protein is activated upon cleavage of the protease sites in iVL, iVH, and one or more of linkers L1, L1′, L2, L2′, L3, L3′, L4, L4′, L5, L5′, L6, and L6′. In embodiments where one or more of the linkers comprise protease cleavage sites the inducible monovalent target-domain binding protein is not activated until at least one cleavage site in at least one of the linkers is cleaved.

(34) It is contemplated that in some embodiments the inducible monovalent target-binding protein is no more than 100 kD, no more than 75 kD, no more than 50 kD, no more than 25 kD, no more than 20 kD, no more than 15 kD, or no more than 10 kD, upon its activation by protease cleavage. Prior to cleavage and activation, the inducible protein is, in certain embodiments, no more than 100 kD, no more than 75 kD, no more than 50 kD, no more than 25 kD, no more than 20 kD, or no more than 15 kD.

(35) Fc-Domain Heterodimerization

(36) Although the wild-type Fc region is a homodimer of polypeptides, the Fc domains disclosed herein comprise amino acid substitutions such that they do not form homodimers. The monomeric Fc domains, Fc1 and Fc2, are in some embodiments IgG Fc. In some embodiments, the monomeric Fc domains, Fc1 and Fc2, are from other immunoglobulin subclasses including IgA, IgE, IgD, and IgM.

(37) The heterodimer Fc region of the inducible monovalent target-binding proteins described herein comprises a variant CH3 constant domain comprising amino acid mutations that promote the formation of said heterodimer with stability comparable to a native homodimeric Fc, and a CH2 constant domain. The wild-type Fc is homodimeric in nature and this feature is driven by both hydrophobic interactions at the center of the CH3 interface and symmetric electrostatic interactions around the rim of the hydrophobic core. In some embodiments, the Fc domain described herein comprises amino acid substitutions such that they do not form homodimers. In some embodiments, the Fc domain described herein comprises amino acid substitutions that favor formation of heterodimers over homodimers. In some embodiments, the variant Fc domain is created using (i) symmetric-to-asymmetric steric complementarity design (, KiH, HA-TF, and ZW1), (ii) charge-to-charge swap (, DD-KK), (iii) charge-to-steric complementarity swap plus additional long-range electrostatic interactions (, EW-RVT), and (iv) isotype strand swap [, strand-exchange engineered domain (SEED)]. Strand exchange mutations include, for example, IgA-derived 45 residues on IgG1 CH3-Fc1 and IgG1-derived 57 residues on IgA CH3-Fc2, or vice versa. Examples of symmetric-to-asymmetric sterically complementary mutations include HA-TF (S364H/F405A in Fc1-CH3 or CH3A and Y349T/T394F in Fc2-CH3 or CH3B), ZW1(T350V/L351Y/F405A/Y407V in Fc1-CH3 or CH3A and T350V/T366L/K392L/T394W in Fc2-CH3 or CH3B). In some embodiments, the Fc variant is generated using the “Knobs-into-holes (KiH)” approach where Fc1 comprises a T366W “knob” mutation, in Fc1-CH3 or CH3A, and Fc2 comprises T366S/L368A/Y407V “hole” mutations in Fc2-CH3 or CH3B domain. In some embodiments, the Fc variant is generated using the “Knobs-into-holes (KiH)” plus disulfide bond approach, KiH.sub.S-S, where Fc1 comprises a T366W/S354C “knob” mutation, in Fc1-CH3 or CH3A, and Fc2 comprises T366S/L368A/Y407V/Y349C “hole” mutations in Fc2-CH3 or CH3B domain. In such exemplary embodiments, the heterodimerization is favored through hydrophobic interactions at the core of the Fc1-CH3 or CH3A and Fc2-CH3 or CH3B interface. Examples of charge-charge swap mutations, where the Fc heterodimer favoring interaction is based on electrostatic complementarity include DD-KK (K409D/K392D in Fc1-CH3 or CH3A and D399K/E356K in Fc2-CH3 or CH3B, or vice versa). Examples of charge-to-steric complementarity swap plus additional long-range electrostatic interaction mutations include EW-RVT (K360E/K409W in Fc1-CH3 or CH3A and Q347R/D399V/F405T in Fc2-CH3 or CH3B, or vice versa); EW-RVT.sub.S-S (K360E/K409W/Y349C in Fc1-CH3 or CH3A and Q347R/D399V/F405T/S354C in Fc2-CH3 or CH3B, or vice versa), which comprises an inter-CH3 S—S bond. In some embodiments, the Fc variant is generated using hydrophobic or steric complementarity plus electrostatic complementarity, such as 7.8.60 (K360D/D399M/Y407A in Fc1-CH3 or CH3A and E345R/Q347R/T366V/K409V in Fc2-CH3 or CH3B, or vice versa).

(38) In certain embodiments, the heterodimer forming Fc variants described herein are generated through directed evolution combined with yeast surface display and high-throughput screening. For example, in some embodiments, a combinatorial heterodimeric Fc library display system is developed by mating two haploid yeast cell lines; one haploid cell line displaying an Fc chain library (CH3-Fc1 or CH3A) with mutations in one CH3 domain on the yeast cell surface, and the other cell line secreting an Fc chain library (CH3-Fc2 or CH3B) with mutations in the other CH3 domain. In the mated cells, secreted CH3-Fc2 or CH3B is displayed on the cell surface through heterodimerization with the displayed CH3-Fc1 or CH3A. Fluorescence-based detection of this interaction enables screening of the library for heterodimeric Fc variants by flow cytometry.

(39) The Y-shape of typical IgG antibodies often limits their utility against some targets, whereby bivalent target-binding dimerizes and agonizes, rather than antagonizes, the intended targets (See, Choi et al., Engineering of Immunoglobulin Fc heterodimers using yeast surface-displayed combinatorial Fc library screening, PLOS One, 10(12): e0145349, 2015. Therefore, in some embodiments, the inducible monovalent target-binding proteins described herein are advantageously used for antagonization of binding targets. In some embodiments, the heterodimerization of the Fc1 and Fc2 domains is expected to reduce high molecular weight tetrameric by-products during preparation of the inducible monovalent target-domain binding proteins disclosed herein.

(40) An antibody that includes a wild-type Fc domain has the ability to interact with neonatal Fc-receptor (FcRn) in a pH dependent manner; this interaction confers extended serum half-life. The residues important for the high-affinity interaction of Fc domain and FcγR are located within the CH2 domain. Accordingly, in some embodiments, CH2-Fc1 and CH2-Fc2 comprise wild type IgG sequence.

(41) Activated Monovalent Target-Binding Protein

(42) The inducible monovalent target-binding proteins described herein are activated by cleavage of the at least one protease cleavage site in the inactive VL domain, and the at least one protease cleavage site in the inactive VH domain. Upon protease cleavage the VH and VL target binding domains associate to form a monovalent active target-binding domain. It is contemplated that the target antigen is involved in and/or associated with a disease, disorder or condition. In particular, a target antigen associated with a proliferative disease, a tumorous disease, an inflammatory disease, an immunological disorder, an autoimmune disease, an infectious disease, a viral disease, an allergic reaction, a parasitic reaction, a graft-versus-host disease or a host-versus-graft disease. In some embodiments, a target antigens is a tumor antigen expressed on a tumor cell. In some embodiments, a target antigen is a on a tumor cell, virally infected cell, bacterially infected cell, damaged red blood cell, arterial plaque cell, or fibrotic tissue cell.

(43) In some embodiments, a target antigen is a cell surface molecule such as a protein, lipid or polysaccharide. In some embodiments, a target antigen is an immune checkpoint protein.

(44) Target antigens, in some cases, are expressed on the surface of a diseased cell or tissue, for example a tumor or a cancer cell. Examples of target antigens include but are not limited to CD19, CD20, CD33, CD30, CD64, CD123, EpCAM, EGFR, HER-2, HER-3, c-Met, LAG3, FoIR, EGFR, PSMA, VEGF, and CEA. In one aspect, a target antigen is an immune checkpoint protein. Examples of immune checkpoint proteins include but are not limited to CD27, CD40, OX40, GITR, CD137, B7, CD28, ICOS, A2AR, B7-H3, B7-H4, BTLA, CTLA-4, IDO, KIR, LAG3, PD-1, PD-L1, TIM-3, VISTA. Inhibitory immune checkpoint proteins to be inhibited in activating an immune response include but are not limited to A2AR, B7-H3, B7-H4, BTLA, CTLA-4, IDO, KIR, LAG3, PD-1, PD-L1, TIM-3, and VISTA. In some embodiments, binding of the inducible monovalent target-binding protein to an immune checkpoint target protein is dependent upon protease cleavage of the inhibitory domain which restricts binding of the protein to the immune checkpoint target protein only in the microenvironment of a diseased cell or tissue with elevated levels of proteases, for example in a tumor microenvironment.

(45) In some embodiments, the inducible monovalent target-binding proteins described herein specifically binds to A2AR. In some embodiments, the inducible monovalent target-binding proteins described herein specifically binds to B7-H3. In some embodiments, the inducible monovalent target-binding proteins described herein specifically binds to B7-H4. In some embodiments, the inducible monovalent target-binding proteins described herein specifically binds to BTLA. In some embodiments, the inducible monovalent target-binding proteins described herein specifically binds to CTLA-4. In some embodiments, the inducible monovalent target-binding proteins described herein specifically binds to IDO. In some embodiments, the inducible monovalent target-binding proteins described herein specifically binds to KIR. In some embodiments, the inducible monovalent target-binding proteins described herein specifically binds to LAG3. In some embodiments, the inducible monovalent target-binding proteins described herein specifically binds to PD-1. In some embodiments, the inducible monovalent target-binding proteins described herein specifically binds to PD-L1. In some embodiments, the inducible monovalent target-binding proteins described herein specifically binds to TIM-3. In some embodiments, the inducible monovalent target-binding proteins described herein specifically binds to VISTA.

(46) Binding Protein Variants

(47) As used herein, the term “binding protein variants” refers to variants and derivatives of an inducible monovalent antibody described herein. In certain embodiments, amino acid sequence variants of the inducible antibodies described herein are contemplated. For example, in certain embodiments amino acid sequence variants of the inducible antibodies described herein are contemplated to improve the binding affinity and/or other biological properties of the antibodies. Exemplary method for preparing amino acid variants include, but are not limited to, introducing appropriate modifications into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody.

(48) Any combination of deletion, insertion, and substitution can be made to the various domains to arrive at the final construct, provided that the final construct possesses the desired characteristics, antigen-binding. In certain embodiments, antibody variants having one or more amino acid substitutions are provided. Sites of interest for substitution mutagenesis include the CDRs and framework regions. Amino acid substitutions may be introduced into the variable domains of the target-binding protein of interest and the products screened for a desired activity, retained/improved antigen binding, decreased immunogenicity, or improved antibody-dependent cell mediated cytotoxicity (ADCC) or complement dependent cytotoxicity (CDC). Both conservative and non-conservative amino acid substitutions are contemplated for preparing the antibody variants.

(49) In another example of a substitution to create a variant inducible antibody, one or more hypervariable region residues of a parent antibody are substituted. In general, variants are then selected based on improvements in desired properties compared to a parent antibody, for example, increased affinity, reduced affinity, reduced immunogenicity, increased pH dependence of binding. For example, an affinity matured variant antibody can be generated, using phage display-based affinity maturation techniques such as those described herein and known in the field.

(50) Substitutions can be made in hypervariable regions (HVR) of a parent inducible antibody to generate variants and variants are then selected based on binding affinity, i.e., by affinity maturation. In some embodiments of affinity maturation, diversity is introduced into the variable genes chosen for maturation by any of a variety of methods (, error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis). A secondary library is then created. The library is then screened to identify any antibody variants with the desired affinity. Another method to introduce diversity involves HVR-directed approaches, in which several HVR residues (, 4-6 residues at a time) are randomized. HVR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling. Substitutions can be in one, two, three, four, or more sites within a parent antibody sequence.

(51) In some embodiments, an inducible monovalent target-binding protein, as described herein comprises a VL and a VH domain with amino acid sequences corresponding to the amino acid sequence of a naturally occurring VL or VH domain, respectively, but that has been “humanized”, i.e., by replacing one or more amino acid residues in the amino acid sequence of said naturally occurring VL or VH domains (and in particular in the framework sequences) by one or more of the amino acid residues that occur at the corresponding position(s) in a VL or VH domain from a conventional 4-chain antibody from a human being (, as indicated above). This can be performed in a manner known in the field, which will be clear to the skilled person, for example on the basis of the further description herein. Again, it should be noted that such humanized inducible monovalent target-binding antibodies of the disclosure are obtained in any suitable manner known per se and thus are not strictly limited to polypeptides that have been obtained using a polypeptide that comprises a naturally occurring VL and/or VH domain as a starting material. In some additional embodiments, an inducible monovalent target-binding antibody, as described herein, comprises a VL and a VH domain with amino acid sequences corresponding to the amino acid sequence of a naturally occurring VL or VH domain, respectively, but that has been “camelized”, i.e., by replacing one or more amino acid residues in the amino acid sequence of a naturally occurring VL or VH domain from a conventional 4-chain antibody by one or more of the amino acid residues that occur at the corresponding position(s) in a VL or a VH domain of a heavy chain antibody. Such “camelizing” substitutions are preferably inserted at amino acid positions that form and/or are present at the VH-VL interface, and/or at the so-called Camelidae hallmark residues (see for example WO 94/04678 and Davies and Riechmann (1994 and 1996)). Preferably, the VH sequence that is used as a starting material or starting point for generating or designing the camelized single domain is preferably a VH sequence from a mammal, more preferably the VH sequence of a human being, such as a VH3 sequence. However, it should be noted that such camelized inducible monovalent antibodies of the disclosure, in certain embodiments, are obtained in any suitable manner known in the field and thus are not strictly limited to polypeptides that have been obtained using a polypeptide that comprises a naturally occurring VL and/or VH domain as a starting material. For example, both “humanization” and “camelization” is performed by providing a nucleotide sequence that encodes a naturally occurring VL and/or VH domain, respectively, and then changing, one or more codons in said nucleotide sequence in such a way that the new nucleotide sequence encodes a “humanized” or “camelized” inducible antibody, respectively. This nucleic acid can then be expressed, so as to provide the desired target-antigen binding capability. Alternatively, in other embodiments, a “humanized” or “camelized” inducible antibody is synthesized de novo using known peptide synthesis technique from the amino acid sequence of a naturally occurring antibody comprising a VL and/or VH domain. In some embodiments, a “humanized” or “camelized” inducible antibody is synthesized de novo using known peptide synthesis technique from the amino acid sequence or nucleotide sequence of a naturally occurring antibody comprising a VL and/or VH domain, respectively, a nucleotide sequence encoding the desired humanized or camelized inducible domain antibody of the disclosure, respectively, is designed and then synthesized de novo using known techniques for nucleic acid synthesis, after which the nucleic acid thus obtained is expressed in using known expression techniques, so as to provide the desired inducible antibody of the disclosure.

(52) Other suitable methods and techniques for obtaining the inducible antibody of the disclosure and/or nucleic acids encoding the same, starting from naturally occurring sequences for VL or VH domains for example comprises combining one or more parts of one or more naturally occurring VL or VH sequences (such as one or more framework (FR) sequences and/or complementarity determining region (CDR) sequences), and/or one or more synthetic or semi-synthetic sequences, and/or a naturally occurring sequence for a CH2 domain, and a naturally occurring sequence for a CH3 domain comprising amino acid substitutions that favor formation of heterodimer over homodimer, in a suitable manner, so as to provide an inducible antibody of the disclosure or a nucleotide sequence or nucleic acid encoding the same.

(53) Affinity Maturation

(54) In designing binding proteins for therapeutic applications, it is desirable to create proteins that, for example, modulate a functional activity of a target, and/or improved binding proteins such as binding proteins with higher specificity and/or affinity and/or and binding proteins that are more bioavailable, or stable or soluble in particular cellular or tissue environments.

(55) The inducible monovalent target-binding proteins described in the present disclosure exhibit improved the binding affinities towards the target binding domain, for example a tumor antigen expressed on a cell surface. In some embodiments, the inducible monovalent target-binding protein of the present disclosure is affinity matured to increase its binding affinity to the target binding domain, using any known technique for affinity-maturation (, mutagenesis, chain shuffling, CDR amino acid substitution). Amino acid substitutions may be conservative or semi-conservative. For example, the amino acids glycine, alanine, valine, leucine and isoleucine can often be substituted for one another (amino acids having aliphatic side chains). Of these possible substitutions, typically glycine and alanine are used to substitute for one another since they have relatively short side chains and valine, leucine and isoleucine are used to substitute for one another since they have larger aliphatic side chains which are hydrophobic. Other amino acids which may often be substituted for one another include but are not limited to: phenylalanine, tyrosine and tryptophan (amino acids having aromatic side chains); lysine, arginine and histidine (amino acids having basic side chains); aspartate and glutamate (amino acids having acidic side chains); asparagine and glutamine (amino acids having amide side chains); and cysteine and methionine (amino acids having sulphur-containing side chains). In some embodiments, the inducible monovalent target-binding proteins are isolated by screening combinatorial libraries, for example, by generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics towards a target antigen, such as a tumor antigen expressed on a cell surface.

(56) Inducible Target-Binding Protein Modifications

(57) The binding proteins described herein encompass derivatives or analogs in which (i) an amino acid is substituted with an amino acid residue that is not one encoded by the genetic code, (ii) the mature polypeptide is fused with another compound such as polyethylene glycol, or (iii) additional amino acids are fused to the protein, such as a leader or secretory sequence or a sequence to block an immunogenic domain and/or for purification of the protein.

(58) Typical modifications include, but are not limited to, acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphatidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent crosslinks, formation of cystine, formation of pyroglutamate, formylation, gamma carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristylation, oxidation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquitination.

(59) Modifications are made anywhere in the inducible binding proteins described herein, including the peptide backbone, the amino acid side-chains, and the amino or carboxyl termini. Certain common peptide modifications that are useful for modification of the inducible binding proteins include glycosylation, lipid attachment, sulfation, gamma-carboxylation of glutamic acid residues, hydroxylation, blockage of the amino or carboxyl group in a polypeptide, or both, by a covalent modification, and ADP-ribosylation.

(60) In some embodiments, the inducible monovalent target-binding antibodies of the disclosure are conjugated with drugs to form antibody-drug conjugates (ADCs). In general, ADCs are used in oncology applications, where the use of antibody-drug conjugates for the local delivery of cytotoxic or cytostatic agents allows for the targeted delivery of the drug moiety to tumors, which can allow higher efficacy, lower toxicity, etc.

(61) Polynucleotides Encoding Inducible Monovalent Target-Binding Proteins

(62) Also provided, in some embodiments, are polynucleotide molecules encoding an inducible monovalent target-binding protein as described herein. In some embodiments, the polynucleotide molecules are provided as a DNA construct. In other embodiments, the polynucleotide molecules are provided as a messenger RNA transcript.

(63) The polynucleotide molecules are constructed by known methods such as by combining the genes encoding the various domains of the inducible monovalent target-binding protein, operably linked to a suitable promoter, and optionally a suitable transcription terminator, and expressing it in bacteria or other appropriate expression system such as, for example CHO cells.

(64) In some embodiments, the polynucleotide is inserted into a vector, preferably an expression vector, which represents a further embodiment. This recombinant vector can be constructed according to known methods. Vectors of particular interest include plasmids, phagemids, phage derivatives, virii (e.g., retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, lentiviruses, and the like), and cosmids.

(65) A variety of expression vector/host systems may be utilized to contain and express the polynucleotide encoding the polypeptide of the described inducible monovalent target-binding protein. Examples of expression vectors for expression in E. coli are pSKK (Le Gall et al., J Immunol Methods. (2004) 285(1): 111-27), pcDNA5 (Invitrogen) for expression in mammalian cells, PICHIAPINK™ Yeast Expression Systems (Invitrogen), BACUVANCE™ Baculovirus Expression System (GenScript).

(66) Thus, the inducible monovalent target binding proteins as described herein, in some embodiments, are produced by introducing a vector encoding the protein as described above into a host cell and culturing said host cell under conditions whereby the protein domains are expressed, may be isolated and, optionally, further purified.

(67) Production of Inducible Monovalent Target-Binding Proteins

(68) Disclosed herein, in some embodiments, is a process for the production of an inducible monovalent target binding protein of the present disclosure. In some embodiments, the process comprises culturing a host transformed or transfected with a vector comprising a nucleic acid sequence encoding an inducible monovalent target binding protein under conditions allowing the expression of the an inducible monovalent target binding protein and recovering and purifying the produced protein from the culture.

(69) In an additional embodiment is provided a process directed to improving one or more properties, affinity, stability, heat tolerance, cross-reactivity, etc., of the inducible monovalent target binding protein described herein, compared to a reference binding compound. In some embodiments, a plurality of single-substitution libraries is provided each corresponding to a different domain, or amino acid segment of the inducible monovalent target binding protein or reference binding compound such that each member of the single-substitution library encodes only a single amino acid change in its corresponding domain, or amino acid segment. Typically, this allows all of the potential substitutions in a large protein or protein binding site to be probed with a few small libraries. In some embodiments, the plurality of domains forms or covers a contiguous sequence of amino acids of the inducible monovalent target binding protein or a reference binding compound. Nucleotide sequences of different single-substitution libraries overlap with the nucleotide sequences of at least one other single-substitution library. In some embodiments, a plurality of single-substitution libraries are designed so that every member overlaps every member of each single-substitution library encoding an adjacent domain.

(70) Binding proteins expressed from such single-substitution libraries are separately selected to obtain a subset of variants in each library which has properties at least as good as those of the reference binding compound and whose resultant library is reduced in size. Generally, the number of nucleic acids encoding the selected set of binding compounds is smaller than the number of nucleic acids encoding members of the original single-substitution library. Such properties include, but are not limited to, affinity to a target compound, stability with respect to various conditions such as heat, high or low pH, enzymatic degradation, cross-reactivity to other proteins and the like. The selected compounds from each single-substitution library are referred to herein interchangeably as “pre-candidate compounds,” or “pre-candidate proteins.” Nucleic acid sequences encoding the pre-candidate compounds from the separate single-substitution libraries are then shuffled in a PCR to generate a shuffled library, using PCR-based gene shuffling techniques.

(71) An exemplary work flow of the screening process is described herein. Libraries of pre-candidate compounds are generated from single substitution libraries and selected for binding to the target protein(s), after which the pre-candidate libraries are shuffled to produce a library of nucleic acids encoding candidate compounds which, in turn, are cloned into a convenient expression vector, such as a phagemid expression system. Phage expressing candidate compounds then undergo one or more rounds of selection for improvements in desired properties, such as binding affinity to a target molecule. Target molecules may be adsorbed or otherwise attached to a surface of a well or other reaction container, or target molecules may be derivatized with a binding moiety, such as biotin, which after incubation with candidate binding compounds may be captured with a complementary moiety, such as streptavidin, bound to beads, such as magnetic beads, for washing. In exemplary selection regimens, the candidate binding compounds undergo a wash step so that only candidate compounds with very low dissociation rates from a target molecule are selected. Exemplary wash times for such embodiments are about 10 minutes, about 15 minutes, about 20 minutes, about 20 minutes, about 30 minutes, about 35 minutes, about 40 minutes, about 45 minutes, about 50 minutes, about 55 mins, about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours; or in other embodiments, about 24 hours; or in other embodiments, about 48 hours; or in other embodiments, about 72 hours. Isolated clones after selection are amplified and subjected to an additional cycle of selection or analyzed, for example by sequencing and by making comparative measurements of binding affinity towards their target, for example, by ELISA, surface plasmon resonance (SPR), bio-layer interferometry (, OCTET® system, Pall Life Sciences, ForteBio, Menlo Park, Calif.) or the like.

(72) Pharmaceutical Compositions

(73) Also provided, in some embodiments, are pharmaceutical compositions comprising an inducible monovalent target-binding protein described herein, a vector comprising the polynucleotide encoding the polypeptide of the inducible monovalent target binding protein or a host cell transformed by this vector and at least one pharmaceutically acceptable carrier. The term “pharmaceutically acceptable carrier” includes, but is not limited to, any carrier that does not interfere with the effectiveness of the biological activity of the ingredients and that is not toxic to the patient to whom it is administered. Examples of suitable pharmaceutical carriers are well known in the art and include phosphate buffered saline solutions, water, emulsions, such as oil/water emulsions, various types of wetting agents, sterile solutions etc. Such carriers can be formulated by conventional methods and can be administered to the subject at a suitable dose. Preferably, the compositions are sterile. These compositions may also contain adjuvants such as preservative, emulsifying agents and dispersing agents. Prevention of the action of microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents.

(74) In some embodiments of the pharmaceutical compositions, the inducible monovalent target binding protein is encapsulated in nanoparticles. In some embodiments, the nanoparticles are fullerenes, liquid crystals, liposome, quantum dots, superparamagnetic nanoparticles, dendrimers, or nanorods. In other embodiments of the pharmaceutical compositions, the inducible monovalent target binding protein is attached to liposomes. In some instances, the inducible monovalent target binding protein is conjugated to the surface of liposomes. In some instances, the inducible monovalent target binding protein is encapsulated within the shell of a liposome. In some instances, the liposome is a cationic liposome.

(75) The inducible monovalent target binding proteins described herein are contemplated for use as a medicament. Administration is effected by different ways, by intravenous, intraperitoneal, subcutaneous, intramuscular, topical or intradermal administration. In some embodiments, the route of administration depends on the kind of therapy and the kind of compound contained in the pharmaceutical composition. The dosage regimen will be determined by the attending physician and other clinical factors. Dosages for any one patient depends on many factors, including the patient's size, body surface area, age, sex, the particular compound to be administered, time and route of administration, the kind of therapy, general health and other drugs being administered concurrently. An “effective dose” refers to amounts of the active ingredient that are sufficient to affect the course and the severity of the disease, leading to the reduction or remission of such pathology and may be determined using known methods. In some embodiments, the inducible monovalent target-binding proteins described herein

(76) Methods of Treatment

(77) Also provided herein, in some embodiments, are methods and uses for stimulating the immune system of an individual in need thereof comprising administration of an inducible monovalent target binding protein herein. In some instances, the administration of the inducible monovalent target binding protein induces and/or sustains cytotoxicity towards a cell expressing a target antigen. In some instances, the cell expressing a target antigen is a cancer or tumor cell, a virally infected cell, a bacterially infected cell, an autoreactive T or B cell, damaged red blood cells, arterial plaques, or fibrotic tissue. In some embodiments, the target antigen is an immune checkpoint protein.

(78) Also provided herein are methods and uses for a treatment of a disease, disorder or condition associated with a target antigen comprising administering to an individual in need thereof an inducible monovalent target binding protein as described herein. Diseases, disorders or conditions associated with a target antigen include, but are not limited to, viral infection, bacterial infection, auto-immune disease, transplant rejection, atherosclerosis, or fibrosis. In other embodiments, the disease, disorder or condition associated with a target antigen is a proliferative disease, a tumorous disease, an inflammatory disease, an immunological disorder, an autoimmune disease, an infectious disease, a viral disease, an allergic reaction, a parasitic reaction, a graft-versus-host disease or a host-versus-graft disease. In one embodiment, the disease, disorder or condition associated with a target antigen is cancer. In one instance, the cancer is a hematological cancer. In another instance, the cancer is a melanoma. In a further instance, the cancer is non-small cell lung cancer. In yet further instance, the cancer is breast cancer. In some embodiments, the inducible monovalent target-binding protein binds to an immune checkpoint protein and is administered to treat a cancer characterized by upregulation of said immune checkpoint protein. For example, the immune checkpoint protein is, in some cases, CTLA-4 and the cancer is melanoma, non-small cell lung cancer, triple negative breast cancer, or ovarian cancer.

(79) As used herein, in some embodiments, “treatment” or “treating” or “treated” refers to therapeutic treatment wherein the object is to slow (lessen) an undesired physiological condition, disorder or disease, or to obtain beneficial or desired clinical results. For the purposes described herein, beneficial or desired clinical results include, but are not limited to, alleviation of symptoms; diminishment of the extent of the condition, disorder or disease; stabilization (i.e., not worsening) of the state of the condition, disorder or disease; delay in onset or slowing of the progression of the condition, disorder or disease; amelioration of the condition, disorder or disease state; and remission (whether partial or total), whether detectable or undetectable, or enhancement or improvement of the condition, disorder or disease. Treatment includes eliciting a clinically significant response without excessive levels of side effects. Treatment also includes prolonging survival as compared to expected survival if not receiving treatment. In other embodiments, “treatment” or “treating” or “treated” refers to prophylactic measures, wherein the object is to delay onset of or reduce severity of an undesired physiological condition, disorder or disease, such as, for example is a person who is predisposed to a disease (e.g., an individual who carries a genetic marker for a disease such as breast cancer).

(80) In some embodiments of the methods described herein, the inducible monovalent target binding protein described herein are administered in combination with an agent for treatment of the particular disease, disorder or condition. Agents include but are not limited to, therapies involving antibodies, small molecules (, chemotherapeutics), hormones (steroidal, peptide, and the like), radiotherapies (γ-rays, X-rays, and/or the directed delivery of radioisotopes, microwaves, UV radiation and the like), gene therapies (e.g., antisense, retroviral therapy and the like) and other immunotherapies. In some embodiments, the inducible monovalent target binding protein described herein are administered in combination with anti-diarrheal agents, anti-emetic agents, analgesics, opioids and/or non-steroidal anti-inflammatory agents. In some embodiments, the inducible monovalent target binding protein described herein are administered before, during, or after surgery.

(81) According to another embodiment of the invention, kits for detecting a cancer, and for diagnosis, prognosis or monitoring are provided. The kits include the foregoing inducible monovalent target binding protein (, labeled anti-immune checkpoint protein inducible monovalent target-binding protein or antigen binding fragments thereof), and one or more compounds for detecting the label. In some embodiments, the label is selected from the group consisting of a fluorescent label, an enzyme label, a radioactive label, a nuclear magnetic resonance active label, a luminescent label, and a chromophore label.

EXAMPLES

(82) The examples below further illustrate the described embodiments without limiting the scope of the invention.

Example 1: Treatment with Inducible Monovalent CTLA-4 Binding Antibody Attenuates Tumorigenesis and Enhances Survival

(83) C57BI/6 mice are obtained from The Jackson Laboratory. B16F10 murine melanoma cell line is grown in Iscove's modified Dulbeco's medium supplemented with 10% FBS, 2 mM L-glutamine, and antibiotics (50 U/ml penicillin and 50 μg/ml streptomycin). Mice of 8-14 weeks of age (n=5-10) are subcutaneously inoculated with 2×10.sup.5 B16F10 melanoma cells. Mice which do not receive the full injection, or whose injection does not result in a visible subcutaneous bleb without leakage, are not used in the experiment and sacrificed immediately.

(84) For the treatment of B16F10 melanoma, mice are given intraperitoneal injections (i.p.) of 50 μg of inducible monovalent anti-PD-L1 antibody, or PBS (vehicle control) every other day starting day 10 after B16F10 inoculation.

(85) Tumor measurements are taken every other day using digital calipers. Results indicate that treatment of tumor-bearing mice with the inducible monovalent CTLA-4 binding antibody results in an attenuation of tumorigenesis with a significant decrease in tumor area, and the mice show prolonged survival.

Example 2: Combination Therapies with an Inducible Monovalent CTLA-4 Binding Antibody and a Second Therapeutic Agent Show Increased Effects on Tumorigenesis Attenuation and Survival

(86) C57BI/6 mice are obtained from The Jackson Laboratory. B16F10 murine melanoma cell line is grown in Iscove's modified Dulbeco's medium supplemented with 10% FBS, 2 mM L-glutamine, and antibiotics (50 U/ml penicillin and 50 μg/ml streptomycin).

(87) Mice of 8-14 weeks of age (n=5-10) are subcutaneously inoculated with 2×10.sup.5 B16F10 melanoma cells. Mice which do not receive the full injection, or whose injection does not result in a visible subcutaneous bleb without leakage, are not used in the experiment and sacrificed immediately.

(88) Mice with tumor are injected intraperitoneally with the inducible monovalent CTLA-4 binding antibody alone, or in combination with a second therapeutic agent. Tumor measurements are taken every other day using digital calipers.

(89) Treatment of the mice with the combination of the inducible monovalent CTLA-4 binding antibody and the second therapeutic agent results in improved attenuation of tumorigenesis with a significant decrease in tumor area, and improved survival, compared to a monotherapy with the second therapeutic agent alone.

Example 3: Inducible Monovalent CTLA-4 Binding Antibody Exhibits Reduced Specificity Towards Cell Line which Overexpresses CTLA-4 but is Protease Deficient

(90) Cells overexpressing CTLA-4 and exhibiting low expression of a matrix metalloprotease are separately incubated with an exemplary inducible monovalent CTLA-4 antibody according to the present disclosure, or a control non-inducible CTLA-4 antibody. Cells expressing normal levels of CTLA-4 and proteases are also incubated with exemplary inducible monovalent CTLA-4 antibody according to the present disclosure, or a control non-inducible CTLA-4 antibody.

(91) Results indicate that in the absence of protease secretion, the inducible antibody of the present disclosure binds the protease expressing cells but does not bind the protease-deficient antigen expressing cells. In contrast, the control non-inducible antibody lacks the ability to selectively bind the protease expressing cells over the protease deficient ones. Thus, the exemplary inducible monovalent antibody of the present disclosure is advantageous, for example, in terms of reducing off-tumor toxicity.

Example 4: Characterization of Exemplary Inducible Monovalent Antibodies of this Disclosure

(92) Expression, Purification and Proteolytic Activation of Exemplary Inducible Monovalent Antibodies of this Disclosure

(93) Heavy and light chain sequences for four exemplary monovalent antibodies (disclosed as SEQ ID Nos. 43-50) according to this disclosure were cloned into mammalian expression vector pcDNA 3.4 (ThermoFisher) preceded by a leader sequence. Two of the four exemplary inducible monovalent antibodies were CTLA4 binding inducible monovalent antibodies, derived from parental antibodies targeting CTLA4 (ipilimumab, tremelimumab), and two were CD40 binding inducible monovalent antibodies derived from two parental antibodies targeting CD40 (dacetuzumab, selicrelumab). The CTLA4 binding inducible monovalent antibodies are referred to herein as Ipi-ProMonoMab and Treme-ProMonoMab, and the CD40 binding inducible monovalent antibodies are referred to herein as Dace-ProMonoMab and Seli-ProMonoMab. Sequences for the four exemplary inducible monovalent antibodies are provided in Table I. Each of these antibodies contained variable heavy and light domains connected by a linker comprising the sequence set forth as SEQ ID No. 51 (GSSGGSGGSGGSGLSGRSDNHGSSGT). The linker sequence is in bold font and underlined in Table I. In each of these antibody sequences, lysine residues in the Fc region of the heavy chains and aspartic acid residues in the Fc region of the light chains, are involved in forming heterodimeric Fc regions. The lysine residues (K) are underlined in bold font, Table I. The aspartic acid residues (D) are underlined in bold font, in Table I.

(94) Expi293F cells (ThermoFisher) were maintained in suspension between 0.2 to 8E6 cells/ml in Expi293 media. Purified plasmid DNA was transfected into Expi293 cells in accordance with Expi293 Expression System Kit (ThermoFisher) protocols, and maintained for 4-6 days post transfection. Conditioned media was partially purified by affinity and desalting chromatography, polished by ion exchange chromatography, and concentrated with Amicon Ultra centrifugal filtration units (EMD Millipore). Fractions pooling and final purity were assessed by SDS-PAGE. Purified exemplary monovalent antibodies were either proteolytically activated with 40 nM recombinant human matriptase (R&D Systems) in phosphate-buffered saline (PBS) or untreated control with PBS alone for overnight at room temperature. Assessment of proteolytic activation was confirmed using SDS-PAGE.

(95) Steady-State Affinity Measurements

(96) The affinities of the exemplary monovalent antibodies, in the prodrug and activated forms, were measured by an ELISA assay. Briefly, target antigens, CD40 or CTLA4 (both from Acro Biosystems), were coated at 1 μg/ml in a Nunc MaxiSorp plate (ThermoFisher) for 1 hour and blocked with SuperBlock (ThermoFisher). The exemplary monovalent antibodies, whether intact or matriptase-activated, were added at concentrations ranging from 0.001 to 1000 nM, as indicated in the x-axis of each plot shown in FIG. 4, and incubated for 1 hour at room temperature. Plates were washed 3 times using PBS supplemented with 0.05% Tween-20 (PBS-T). Goat anti-human IgG-Fc-peroxidase conjugate antibody (Sigma) was used at 1:10,000 dilution in PBS-T and incubated for an additional hour. Plates were washed 3 times using PBS-T, followed by development using TMB substrate (ThermoFisher), and neutralizing with 0.1 M sulfuric acid. The resulting colorimetric assay was measured at 450 nm using SpectraMax spectrophotometer (Molecular Devices).

(97) CD40 Signaling Assay

(98) The agonistic activity of the CD40 binding inducible monovalent antibodies was determined using a human CD40-dependent reporter cell line assay, HEK-Blue CD40L assay (InvivoGen®), as per manufacture's protocol. Briefly, 293-Blue cells at 8000 cells per well were mixed with baseline level of CD40L at 0.1 nM and the CD40 binding inducible monovalent antibodies at the indicated concentrations, with or without the addition of mouse anti-human Fc polyclonal antibody at 20 μg/ml for crosslinking. After incubating at 37° C. for 20 hours, the supernatants were removed and mixed with QUANTI-Blue (InvivoGen®) at 1:4 ratio for 3 additional hours at 37° C. The resulting colorimetric assay was measured at 640 nm using SpectraMax spectrophotometer (Molecular Devices).

(99) Results

(100) The Exemplary Inducible Monovalent Antibodies were Specifically Cleaved by a Tumor Associated Protease In Vitro

(101) The CTLA4 binding (Ipi-ProMonoMab and Treme-ProMonoMab) and CD40 binding (Dace-ProMonoMab and Seli-ProMonoMab) inducible monovalent antibodies were kept in the prodrug form by splitting the monovalent functional scFv as two separate non-binding scFvs (as shown in FIG. 2). The non-binding scFvs were kept inert by keeping the functional VH or VL domains preferentially paired with non-binding VL and VH domains, respectively, and tethered via a protease-cleavable linker. The anti-respiratory syncytial virus (RSV) F-protein antibody, palivizumab, was used as the non-binding VL and VH domains because RSV F-proteins are not normally found in healthy tissues. It was observed that all four inducible monovalent antibodies, targeting either CD40 or CTLA4, were proteolytically activated using the tumor-associated protease matriptase (as shown in FIG. 3). The SDS-PAGE confirmed that the expected molecular weights of the inducible monovalent antibodies in their prodrug forms (, 105.1 kDa for Dace-ProMonoMa, 105.9 kDa for Treme-ProMonoMab) dropped upon proteolytic cleavage when the antibodies were converted to their active forms (, in case of Dace-ProMonoMab the molecular weight dropped to about 77.7 kDa, in case of Treme-ProMonoMab the molecular weight dropped to about 78.6 kda).

(102) Proteolytic Activation of the Inducible Monovalent Antibodies Increases their Binding Affinity to Target Antigen

(103) Differential binding of the inducible monovalent antibodies in their prodrug and active forms was determined by comparing the apparent K.sub.D of the untreated (prodrug) or the protease-treated (active) forms of the inducible monovalent antibodies to their target antigens in an ELISA assay (results shown in FIG. 4). Differences in the apparent affinities of the inducible monovalent antibodies were 5.1× (for Dace-ProMonoMab), 2.0× (for Seli-ProMonoMab), 6.8× (for the Ipi-ProMonoMab), and 5.3× (for Treme-ProMonoMab) before and after matriptase treatment, with the matriptase-treated inducible monovalent antibody having the higher binding affinity in every instance.

(104) CD40 Binding Inducible Monovalent Antibodies Demonstrated Potent CD40 Signaling after Proteolytic Activation

(105) In this experiment it was demonstrated that the inducible monovalent antibodies retain potent activity after proteolytic activation in a cell-based functional assay. In particular, the experiment determined the activity of Seli-ProMonoMab in the untreated (prodrug) or the matriptase-treated (active) forms, in a CD40-sensitive reporter cell line (results shown in FIG. 5). The engineered HEK-Blue CD40L cell line used in this method secreted alkaline phosphatase into the media in response to CD40 signaling, which was subsequently measured using a colorimetric assay. Despite a relatively small 2.0× differential affinity on ELISAs, there was a distinct and clear differential activity between the prodrug and active forms of the Seli-ProMonoMab (FIG. 5, left panel). Because anti-CD40 agonistic antibodies often depend on FcγR-mediated clustering of antibodies on cell membranes to correspondingly cluster CD40 on the opposing cell membrane, an experiment was designed to stimulate such clustering effect by adding anti-human IgG polyclonal antibodies to crosslink the Seli-ProMonoMabs. The addition of crosslinking antibodies to simulate the clustering effect on cell membranes improved the sensitivity of the cell assay, and allowed determination of a >405× differential activity. As shown in FIG. 4, EC.sub.50 of the protease-activated form of the Seli-ProMonoMab was 0.37 nM whereas EC.sub.50 was not reached for the untreated Seli-ProMonoMab even at the highest tested concentration of 150 nM.

(106) TABLE-US-00002 TABLE I Sequences of exemplary inducible monovalent antibodies of this disclosure Dace-ProMonoMab DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPKLLIYDTSKLASGV VH (SEQ ID No. 43) PSRFSGSGSGTEFTLTISSLQPDDFATYYCFQGSGYPFTFGGGTKLEIKGSSGGSGG SGGSGLSGRSDNHGSSGTEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYYTHWVRQ APGKGLEWVARVIPNAGGTSYNQKFKGRFTLSVDNSKNTAYLQMNSLRAEDTAVYYC AREGIYWWGQGTLVTVSSGGGGGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMIS RTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRKEMTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLKSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPG* Dace-ProMonoMab QVTLRESGPALVKPTQTLTLTCTFSGFSLSTSGMSVGWIRQPPGKALEWLADIWWDD VL (SEQ ID No. 44) KKDYNPSLKSRLTISKDTSKNQVVLKVTNMDPADTATYYCARSMITNWYFDVWGAGT TVTVSS GSSGGSGGSGGSGLSGRSDNHGSSGTDIQMTQSPSSLSASVGDRVTITCRSSQSLVH SNGNTFLHWYQQKPGKAPKLLIYTVSNRFSGVPSRFSGSGSGTDFTLTISSLQPEDF ATYFCSQTTHVPWTFGQGTKVEIKGGGGGDKTHTCPPCPAPELLGGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYDTTPPVLDSDGSFFLYSDLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPG* Seli-ProMonoMab VH DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPKLLIYDTSKLASGV (SEQ ID No. 45) PSRFSGSGSGTEFTLTISSLQPDDFATYYCFQGSGYPFTFGGGTKLEIKGSSGGSGG SGGSGLSGRSDNHGSSGTQVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQ APGQGLEWMGWINPDSGGTNYAQKFQGRVTMTRDTSISTAYMELNRLRSDDTAVYYC ARDQPLGYCTNGVCSYFDYWGQGTLVTVSSGGGGGDKTHTCPPCPAPELLGGPSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRK EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLKSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG* Seli-ProMonoMab VL QVTLRESGPALVKPTQTLTLTCTFSGFSLSTSGMSVGWIRQPPGKALEWLADIWWDD (SEQ ID No. 46) KKDYNPSLKSRLTISKDTSKNQVVLKVTNMDPADTATYYCARSMITNWYFDVWGAGT TVTVSS GSSGGSGGSGGSGLSGRSDNHGSSGTDIQMTQSPSSVSASVGDRVTITCRASQGIYS WLAWYQQKPGKAPNLLIYTASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYC QQANIFPLTFGGGTKVEIKGGGGGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYDTTPPVLDSDGSFFLYSDLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG* Ipi-ProMonoMab VH DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPKLLIYDTSKLASGV (SEQ ID No. 47) PSRFSGSGSGTEFTLTISSLQPDDFATYYCFQGSGYPFTFGGGTKLEIKGSSGGSGG SGGSGLSGRSDNHGSSGTQVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQ APGKGLEWVTFISYDGNNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYC ARTGWLGPFDYWGQGTLVTVSSGGGGGDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRKEMTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLKSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPG* Ipi-ProMonoMab VL QVTLRESGPALVKPTQTLTLTCTFSGFSLSTSGMSVGWIRQPPGKALEWLADIWWDD (SEQ ID No. 48) KKDYNPSLKSRLTISKDTSKNQVVLKVTNMDPADTATYYCARSMITNWYFDVWGAGT TVTVSS GSSGGSGGSGGSGLSGRSDNHGSSGTEIVLTQSPGTLSLSPGERATLSCRASQSVGS SYLAWYQQKPGQAPRLLIYGAFSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYY CQQYGSSPWTFGQGTKVEIKGGGGGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYDTTPPVLDSDGSFFLYSDLTVDKSRWQQGNVF SCSVMHEALHNHYTQKSLSLSPG* Treme-ProMonoMab DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPKLLIYDTSKLASGV VH (SEQ ID No. 49) PSRFSGSGSGTEFTLTISSLQPDDFATYYCFQGSGYPFTFGGGTKLEIKGSSGGSGG SGGSGLSGRSDNHGSSGTQVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQ APGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYC ARDPRGATLYYYYYGMDVWGQGTTVTVSSGGGGGDKTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTY RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRKE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLKSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG* Treme-ProMonoMab QVTLRESGPALVKPTQTLTLTCTFSGFSLSTSGMSVGWIRQPPGKALEWLADIWWDD VL (SEQ ID No. 50) KKDYNPSLKSRLTISKDTSKNQVVLKVTNMDPADTATYYCARSMITNWYFDVWGAGT TVTVSS GSSGGSGGSGGSGLSGRSDNHGSSGTDIQMTQSPSSLSASVGDRVTITCRASQSINS YLDWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYC QQYYSTPFTFGPGTKVEIKGGGGGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYDTTPPVLDSDGSFFLYSDLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG*