COMPOSITIONS AND METHODS FOR MEASURING NMU AND FOR TREATMENT USING ANTI-NMU AGENTS
20190218286 ยท 2019-07-18
Inventors
- Seung K. Kim (Stanford, CA)
- Sangbin Park (Stanford, CA)
- Ronald Alfa (Salt Lake City, UT)
- Cecile Jacovetti (San Francisco, CA)
Cpc classification
C07K2317/76
CHEMISTRY; METALLURGY
G01N33/74
PHYSICS
G01N33/564
PHYSICS
G01N2800/042
PHYSICS
C07K2317/51
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
C07K16/26
CHEMISTRY; METALLURGY
International classification
C07K16/26
CHEMISTRY; METALLURGY
G01N33/74
PHYSICS
Abstract
The inventors have produced two high specificity and high affinity monoclonal antibodies that bind to human neuromedin U (NMU). Methods and compositions are provided for treating an individual in need thereof (e.g., an individual who is obese and/or has diabetes) by administering an anti-NMU/NMUR agent (e.g., an anti-NMU antibody). For example, methods and compositions are provided for increasing circulating insulin in an individual. Methods and compositions are also provided for detecting neuromedin U (NMU) (e.g., in a biological sample such as serum). Methods and compositions are also provided for predicting whether an individual will develop diabetes and/or PDAC, and for identifying an individual who would benefit from administration of an anti-NMU/NMUR agent.
Claims
1-15. (canceled)
16. A protein that binds specifically to neuromedin U (NMU) and comprises an antigen binding region that comprises: (a) a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 18-20, respectively, or SEQ ID NOs: 2-4, respectively; and/or (b) a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 26-28, respectively, or SEQ ID NOs: 10-12, respectively.
17. The protein of claim 16, wherein the antigen binding region comprises: (a) a light chain comprising the amino acid sequence set forth in any one of SEQ ID NOs: 17, 38, 1, and 36; and/or (b) a heavy chain comprising the amino acid sequence set forth in any one of SEQ ID NOs: 25, 39, 9, and 37.
18. The protein of claim 16, wherein the antigen binding region comprises: (i) a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 18-20, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 26-28, respectively; or (ii) a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 2-4, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 10-12, respectively.
19. The protein of claim 16, wherein the antigen binding region comprises a light chain that comprises the amino acid sequence set forth in any one of SEQ ID NOs: 17 and 38, and a heavy chain that comprises the amino acid sequence set forth in any one of SEQ ID NOs: 25 and 39.
20. The protein of claim 16, wherein the protein is a single chain polypeptide.
21. The protein of claim 16, wherein the antigen binding region comprises a light chain that comprises the amino acid sequence set forth in any one of SEQ ID NOs: 1 and 36, and a heavy chain that comprises the amino acid sequence set forth in any one of SEQ ID NOs: 9 and 37.
22. The protein of claim 16, wherein the protein is an antibody.
23. The protein of claim 22, wherein the antibody is a mouse or human antibody.
24. The protein of claim 23, wherein the antibody is a humanized antibody.
25. A nucleic acid encoding the protein of claim 16.
26. The nucleic acid of claim 25, wherein the nucleic acid is an expression vector.
27. A cell comprising the nucleic acid of claim 25.
28. A kit for detecting neuromedin U (NMU), comprising a first anti-NMU antibody and a second anti-NMU antibody, wherein the first and second anti-NMU antibodies bind to non-overlapping amino acids of NMU, and wherein one of the first and second anti-NMU antibody antibodies comprises: (a) a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 18-20, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 26-28, respectively; or (b) a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 2-4, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 10-12, respectively.
29. The kit of claim 28, wherein: (i) one of the first and second anti-NMU antibodies comprises a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 18-20, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 26-28, respectively; and (ii) the other of the first and second anti-NMU antibodies comprises a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 2-4, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 10-12, respectively.
30. The kit of claim 28, wherein the first anti-NMU antibody is immobilized on a solid surface.
31. The kit of claim 30, wherein the solid surface is a bead or a surface of a well of a multi-well plate.
32. The kit of claim 28, wherein at least one of the first and second anti-NMU antibodies is detectably labeled.
33. The kit of claim 28, wherein at least one of the first and second anti-NMU antibodies is conjugated to a fluorophore, a fluorescent protein, or an enzyme that is indirectly detectable.
34-65. (canceled)
66. A protein that binds specifically to neuromedin U (NMU) and comprises an antigen binding region that comprises: (i) a first CDR comprising the amino acid sequence set forth in SEQ ID NO: 18, a second CDR comprising the amino acid sequence set forth in SEQ ID NO: 19, a third CDR comprising the amino acid sequence set forth in SEQ ID NO: 20, a fourth CDR comprising the amino acid sequence set forth in SEQ ID NO: 26, a fifth CDR comprising the amino acid sequence set forth in SEQ ID NO: 27, and a sixth CDR comprising the amino acid sequence set forth in SEQ ID NO: 28; or (ii) a first CDR comprising the amino acid sequence set forth in SEQ ID NO: 2, a second CDR comprising the amino acid sequence set forth in SEQ ID NO: 3, a third CDR comprising the amino acid sequence set forth in SEQ ID NO: 4, a fourth CDR comprising the amino acid sequence set forth in SEQ ID NO: 10, a fifth CDR comprising the amino acid sequence set forth in SEQ ID NO: 11, and a sixth CDR comprising the amino acid sequence set forth in SEQ ID NO: 12.
67. The protein of claim 66, wherein the protein is a humanized antibody.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0019] The invention is best understood from the following detailed description when read in conjunction with the accompanying drawings. The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee. It is emphasized that, according to common practice, the various features of the drawings are not to-scale. On the contrary, the dimensions of the various features are arbitrarily expanded or reduced for clarity. Included in the drawings are the following figures.
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
DETAILED DESCRIPTION
[0047] The inventors have shown that NMU is a hormone that regulates human insulin output by acting through its receptor, neuromedin U receptor (NMUR1), expressed on pancreatic beta-cells. The inventors have generated and characterized mice lacking the NMUR1 receptor, and have also produced two high specificity and high affinity monoclonal antibodies (C578 and 2A16) that bind to human neuromedin U (NMU). These antibodies are injectable, block the interaction between circulating NMU and NMUR1 expressed on cells, and in vivo studies show that injection of the antibodies is sufficient to suppress NMU levels, leading to enhanced insulin output and glucose handling. The inventors have also shown that the antibodies can also be used as part of a two-way enzyme linked immunosorption assay (ELISA) that is sensitive enough to detect NMU in serum from mice as well as humans.
[0048] Methods and compositions are provided for treating an individual in need thereof (e.g., an individual who is obese and/or has diabetes, e.g., type 2 diabetes) by administering an anti-NMU/NMUR agent (e.g., an anti-NMU antibody). For example, methods and compositions are provided for increasing circulating insulin in an individual. Methods and compositions are also provided for detecting neuromedin U (NMU) (e.g., in a biological sample such as serum). Methods and compositions are also provided for predicting whether an individual will develop diabetes, e.g., type 2 diabetes, and/or Pancreatic Ductal Adenocarcinoma (PDAC), and for identifying an individual who would benefit from administration of an anti-NMU/NMUR agent.
[0049] Before the present methods and compositions are described, it is to be understood that this invention is not limited to particular method or composition described, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.
[0050] Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limits of that range is also specifically disclosed. Each smaller range between any stated value or intervening value in a stated range and any other stated or intervening value in that stated range is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included or excluded in the range, and each range where either, neither or both limits are included in the smaller ranges is also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention.
[0051] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, some potential and preferred methods and materials are now described. All publications mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. It is understood that the present disclosure supersedes any disclosure of an incorporated publication to the extent there is a contradiction.
[0052] As will be apparent to those of skill in the art upon reading this disclosure, each of the individual embodiments described and illustrated herein has discrete components and features which may be readily separated from or combined with the features of any of the other several embodiments without departing from the scope or spirit of the present invention. Any recited method can be carried out in the order of events recited or in any other order which is logically possible.
[0053] It must be noted that as used herein and in the appended claims, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a cell includes a plurality of such cells and reference to the peptide includes reference to one or more peptides and equivalents thereof, e.g. polypeptides, known to those skilled in the art, and so forth.
[0054] The publications discussed herein are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that the present invention is not entitled to antedate such publication by virtue of prior invention. Further, the dates of publication provided may be different from the actual publication dates which may need to be independently confirmed.
Definitions
[0055] In the description that follows, a number of terms conventionally used in the field are utilized. In order to provide a clear and consistent understanding of the specification and claims, and the scope to be given to such terms, the following definitions are provided.
[0056] The terms polypeptide, peptide and protein are used interchangeably herein to refer to a polymer of amino acid residues. The terms also apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymer.
[0057] The term amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma-carboxyglutamate, and O-phosphoserine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an alpha carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
[0058] The terms recipient, individual, subject, host, and patient, are used interchangeably herein and refer to any mammalian subject for whom diagnosis, treatment, or therapy is desired (e.g., mice, non-human primates, humans, etc.). Mammal for purposes of treatment refers to any animal classified as a mammal, including humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, horses, cats, cows, sheep, goats, pigs, etc. In some cases, an individual of a subject method is a mammal. In some embodiments, the mammal is a rodent (e.g., a rat, a mouse), in some cases the mammal is a non-human primate, and in some cases the mammal is a human.
[0059] The term sample with respect to a patient encompasses blood and other liquid samples of biological origin, solid tissue samples such as a biopsy specimen or tissue cultures or cells derived therefrom and the progeny thereof. The definition also includes samples that have been manipulated in any way after their procurement, such as by treatment with reagents; washed; or enrichment for certain cell populations, such as cancer cells. The definition also includes sample that have been enriched for particular types of molecules, e.g., nucleic acids, polypeptides, etc.
[0060] The term biological sample encompasses a clinical sample such as blood, plasma, serum, aspirate, and also includes tissue obtained by surgical resection, tissue obtained by biopsy, cells in culture, cell supernatants, cell lysates, tissue samples, organs, bone marrow, and the like. A biological sample includes biological fluids derived therefrom (e.g., cancerous cell, infected cell, etc.), e.g., a sample comprising polynucleotides and/or polypeptides that is obtained from such cells (e.g., a cell lysate or other cell extract comprising polynucleotides and/or polypeptides). A biological sample comprising an inflicted cell (e.g., cancer cell, an infected cell, etc.) from a patient can also include non-inflicted cells. In some cases, a biological sample (e.g., one in which an amount/concentration of NMU is measured) is serum. In some such cases, NMU is measured in the serum and not from sub-fractions of the serum. For example, in some cases, NMU is measured in a serum sample that includes exosomes (e.g., a serum sample without or prior to any sub-fractioning to isolate exosomes). In some cases, NMU is measured in a serum sample that does not include exosomes (e.g., in some cases exosomes are removed from (separated from) the serum prior to measuring NMU in the serum).
[0061] The term diagnosis is used herein to refer to the identification of a molecular or pathological state, disease or condition, such as the identification of a molecular subtype of cancer, the determination that an individual is at risk for developing diabetes, e.g., type 2 diabetes, and the like.
[0062] The term prognosis is used herein to refer to the prediction of the likelihood of disease progression (e.g., progression to diabetes, progression to cancer, etc.), including recurrence, metastatic spread of cancer, and drug resistance.
[0063] The term prediction is used herein to refer to the act of foretelling or estimating, based on observation, experience, or scientific reasoning. In one example, a physician may predict whether a patient will become diabetic (e.g., whether an individual who is obese will become diabetic). As another example, one may predict the likelihood that an individual will progress to pancreatic cancer (e.g., predicting whether an individual with pancreatitis will progress to pancreatic cancer, whether the individual will develop PDAC, etc.)
[0064] The terms specific binding, specifically binds, and the like, refer to non-covalent or covalent preferential binding to a molecule relative to other molecules or moieties in a solution or reaction mixture (e.g., an antibody specifically binds to a particular polypeptide or epitope relative to other available polypeptides/epitopes). In some embodiments, the affinity of one molecule for another molecule to which it specifically binds is characterized by a K.sub.D (dissociation constant) of 10.sup.5 M or less (e.g., 10.sup.6 M or less, 10.sup.7 M or less, 10.sup.8 M or less, 10.sup.9 M or less, 10.sup.10 M or less, 10.sup.11 M or less, 10.sup.12 M or less, 10.sup.13 M or less, 10.sup.14 M or less, 10.sup.15 M or less, or 10.sup.16 M or less). Affinity refers to the strength of binding, increased binding affinity being correlated with a lower K.sub.D.
[0065] The term specific binding member as used herein refers to a member of a specific binding pair (i.e., two molecules, usually two different molecules, where one of the molecules, e.g., a first specific binding member, through non-covalent means specifically binds to the other molecule, e.g., a second specific binding member). Examples of specific binding members include, but are not limited to: agents that specifically bind NMU and/or NMUR1 (e.g., antibodies).
[0066] The term antibody is used in the broadest sense and specifically covers monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments (e.g., Fab fragments) so long as they exhibit the desired biological activity. Antibodies (Abs) and immunoglobulins (Igs) are glycoproteins having the same structural characteristics. While antibodies exhibit binding specificity to a specific antigen, immunoglobulins include both antibodies and other antibody-like molecules which lack antigen specificity. Polypeptides of the latter kind are, for example, produced at low levels by the lymph system and at increased levels by myelomas.
[0067] Native antibodies and immunoglobulins are usually heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies between the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges. Each heavy chain has at one end a variable domain (V.sub.H) followed by a number of constant domains. Each light chain has a variable domain at one end (V.sub.L) and a constant domain at its other end; the constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light chain variable domain is aligned with the variable domain of the heavy chain. Particular amino acid residues are believed to form an interface between the light- and heavy-chain variable domains (Clothia et al., J. Mol. Biol. 186:651 (1985); Novotny and Haber, Proc. Natl. Acad. Sci. U.S.A. 82:4592 (1985)).
[0068] The term variable refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called complementarity-determining regions (CDRs) or hypervariable regions both in the light-chain and the heavy-chain variable domains. The more highly conserved portions of variable domains are called the framework (FR). The variable domains of native heavy and light chains each comprise four FR regions, largely adopting a beta-sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the b-sheet structure. The CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, Md. (1991)). The constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity. The CDRs of the light chain are referred to as CDR-L1, CDR-L2, and CDR-L3, while the CDRs of the heavy chain are referred to as CDR-H1, CDR-H2, and CDR-H3.
[0069] Digestion of antibodies (e.g., with enzymes such as papain, Ficin, and the like) produces two identical antigen-binding fragments, called Fab fragments, each with a single antigen-binding site, and a residual Fc fragment, whose name reflects its ability to crystallize readily. Pepsin treatment yields an F(ab).sub.2 fragment that has two antigen-combining sites and is still capable of cross-linking antigen.
[0070] Fv is the minimum antibody fragment which contains a complete antigen-recognition and -binding site. In a two-chain Fv species, this region consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association. In a single-chain Fv species (scFv), one heavy- and one light-chain variable domain can be covalently linked by a flexible peptide linker such that the light and heavy chains can associate in a dimeric structure analogous to that in a two-chain Fv species. It is in this configuration that the three CDRs of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer. Collectively, the six CDRs confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site. For a review of scFv see Pluckthun, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994).
[0071] As would be readily understood by one of ordinary skill in the art, it is noted that designation of the terms light chain and heavy chain CDRs can be arbitrary, provided that the two halves of the binding site have matched sets of CDRs. As an example, in a scFv, CDR 1, 2, 3 can be on the heavy side or the light side, provided that it is matched with CDR 4, 5, 6 on the opposite chain. Thus, in cases where CDRs are stated to be heavy chain or light chain CDRs. Thus, when a subject anti-NMU antibody or antigen binding region thereof includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 18-20, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 26-28, respectively, it is also meant to encompass an anti-NMU antibody or antigen binding region thereof in which the heavy chain CDRs include the amino acid sequences set forth in SEQ ID NOs: 18-20 and the light chain CDRs include the amino acid sequences set forth in SEQ ID NOs: 26-28. Likewise, when a subject anti-NMU antibody or antigen binding region thereof comprises a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 2-4, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 10-12, respectively, it is also meant to encompass an anti-NMU antibody or antigen binding region thereof in which the heavy chain CDRs include the amino acid sequences set forth in SEQ ID NOs: 2-4 and the light chain CDRs include the amino acid sequences set forth in SEQ ID NOs: 10-12.
[0072] The Fab fragment also contains the constant domain of the light chain and the first constant domain (CH1) of the heavy chain. Fab fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CH1 domain including one or more cysteines from the antibody hinge region. Fab-SH is the designation herein for Fab in which the cysteine residue(s) of the constant domains bear a free thiol group. F(ab).sub.2 antibody fragments originally were produced as pairs of Fab fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
[0073] There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these can be further divided into subclasses (isotypes), e.g., IgG.sub.1, IgG.sub.2, IgG.sub.3, IgG.sub.4, IgA.sub.1, IgA.sub.2. The heavy-chain constant domains that correspond to the different classes of immunoglobulins are called a, d, e, g, and m, respectively. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known. Engineered variants of immunoglobulin subclasses, including those that increase or decrease immune effector functions, half-life, or serum-stability, are also encompassed by this terminology.
[0074] Antibody fragment, and all grammatical variants thereof, as used herein are defined as a portion of an intact antibody comprising the antigen binding site or variable region of the intact antibody, wherein the portion is free of the constant heavy chain domains (i.e. CH2, CH3, and CH4, depending on antibody isotype) of the Fc region of the intact antibody. Examples of antibody fragments include Fab, Fab, Fab-SH, F(ab).sub.2, and Fv fragments; diabodies; any antibody fragment that is a polypeptide having a primary structure consisting of one uninterrupted sequence of contiguous amino acid residues (referred to herein as a single-chain antibody fragment or single chain polypeptide), including without limitation (1) single-chain Fv (scFv) molecules (2) single chain polypeptides containing only one light chain variable domain, or a fragment thereof that contains the three CDRs of the light chain variable domain, without an associated heavy chain moiety (3) single chain polypeptides containing only one heavy chain variable region, or a fragment thereof containing the three CDRs of the heavy chain variable region, without an associated light chain moiety and (4) nanobodies comprising single Ig domains from non-human species or other specific single-domain binding modules; and multispecific or multivalent structures formed from antibody fragments. In an antibody fragment comprising one or more heavy chains, the heavy chain(s) can contain any constant domain sequence (e.g. CH1 in the IgG isotype) found in a non-Fc region of an intact antibody, and/or can contain any hinge region sequence found in an intact antibody, and/or can contain a leucine zipper sequence fused to or situated in the hinge region sequence or the constant domain sequence of the heavy chain(s).
[0075] Unless specifically indicated to the contrary, the term conjugate as described and claimed herein is defined as a heterogeneous molecule formed by the covalent attachment of one or more antibody fragment(s) to one or more polymer molecule(s), where the heterogeneous molecule is water soluble, i.e. soluble in physiological fluids such as blood, and wherein the heterogeneous molecule is free of any structured aggregate. A conjugate of interest is PEG. In the context of the foregoing definition, the term structured aggregate refers to (1) any aggregate of molecules in aqueous solution having a spheroid or spheroid shell structure, such that the heterogeneous molecule is not in a micelle or other emulsion structure, and is not anchored to a lipid bilayer, vesicle or liposome; and (2) any aggregate of molecules in solid or insolubilized form, such as a chromatography bead matrix, that does not release the heterogeneous molecule into solution upon contact with an aqueous phase. Accordingly, the term conjugate as defined herein encompasses the aforementioned heterogeneous molecule in a precipitate, sediment, bioerodible matrix or other solid capable of releasing the heterogeneous molecule into aqueous solution upon hydration of the solid.
[0076] As used in this disclosure, the term epitope means any antigenic determinant on an antigen to which the paratope of an antibody binds. Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics.
[0077] The word label when used herein refers to a detectable compound or composition which is conjugated directly or indirectly, e.g., to a subject anti-NMU/NMUR agent. The label may itself be detectable by itself (directly detectable label) (e.g., radioisotope labels or fluorescent labels), or the label can be indirectly detectable, e.g., in the case of an enzymatic label, the enzyme may catalyze a chemical alteration of a substrate compound or composition and the product of the reaction is detectable.
[0078] As used herein, the term correlates, or correlates with, and like terms, refers to a statistical association between instances of two events, where events include numbers, data sets, and the like. For example, when the events involve numbers, a positive correlation (also referred to herein as a direct correlation) means that as one increases, the other increases as well. A negative correlation (also referred to herein as an inverse correlation) means that as one increases, the other decreases.
Compositions
[0079] Provided are compositions and methods for treatment (e.g., for increasing circulating insulin in an individual, for treating an individual who is obese or who has or is at risk of developing diabetes, for treating an individual who has chronic pancreatitis, familial pancreatitis, idiopathic pancreatitis, type 3c diabetes mellitus, cystic fibrosis, late stage pancreatic cancer, and/or cancer cachexia), and for prediction (e.g., predicting whether an individual will develop diabetes, predicting whether an individual will develop PDAC, and/or predicting whether an individual would benefit from administration of an anti-NMU/NMUR agent). A subject method of treatment includes administration of an anti-NMU/NMUR agent (e.g., an anti-NMU antibody or antigen-binding fragment thereof) and a subject method of prediction includes measuring an expression level of neuromedin U (NMU) (e.g., measuring an amount of NMU protein present in a biological sample).
[0080] Provided are new anti-NMU antibodies, which are anti-NMU/NMUR agents (e.g., see the Examples below). Human NMU is a 25 amino acid hormone encoded by the gene NMU and produced from a processed pre-prohormone (Mitchell et al., Br J Pharmacol. 2009 September; 158(1):87-103). NMU is produced in the gastrointestinal tract of humans and other mammals like mice. NMU has no known covalent modifications other than C-terminal amidation (a common feature of circulating peptide hormones), and the newly generated antibodies (C578 and 2A16) were generated against a bioactive form of circulating NMU (FRVDEEFQSPFASQSRGYFLFRPRN-NH.sub.2) (SEQ ID NO: 33).
[0081] The following amino acid sequences are those of pre-processed human and mouse neuromedin U (NMU) as downloaded from NCB:
Human NMU (Isoform 1) (NP 006672.1)
[0082]
TABLE-US-00001 (SEQIDNO:40) MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQ QLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDN TKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQS PFASQSRGYFLFRPRNGRRSAGFI
* amino acids of the processed form are bold and underlined
Human NMU (Isoform 2) (NP 001278974.1)
[0083]
TABLE-US-00002 (SEQIDNO:41) MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQ QLQLWNEASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGK SNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRN GRRSAGFI
* amino acids of the processed form are bold and underlined
Mouse NMU (NP 062388.1)
[0084]
TABLE-US-00003 (SEQIDNO:42) MSRAAGHRPGLSAGQLAAATASPLLSLLLLLACCADACKGVPISPQRLQP EQELQLWNEIHEACASFLSIDSRPQASVALRELCRIVMEISQKPQEQSEK DNTKRFLFHYSKTQKLGNSNVVSSVVHPLLQLVPQLHERRMKRFKAEYQS PSVGQSKGYFLFRPRNGKRSTSFI
* amino acids recognized by the antibody C578 are bold and underlined
Anti-NMU/NMUR Agent.
[0085] NMU (e.g., circulating NMU in the serum) binds to its receptor (NMUR1) on the surface of cells that express NMUR1. An anti-NMU/NMUR agent binds to (specifically binds) NMU and/or NMUR1 and inhibits/blocks the interaction between (e.g., reduces the binding between) NMU and NMUR1. This binding leads to decreased NMU signaling.
[0086] In some case, an anti-NMU/NMUR agent is an anti-NMU antibody or binding fragment thereof. The inventors have produced two new monoclonal anti-NMU antibodies (referred to herein as C578 and 2A16), both of which specifically bind to human NMU (antibody C578 also specifically binds to mouse NMU, i.e., it cross-reacts). Sequence details, including the CDR sequences, and additional information related to the antibodies is presented in
[0087] As such, in some cases, a subject anti-NMU antibody (or antigen binding fragment thereof) includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 2-4, respectively. In some cases, a subject anti-NMU antibody (or antigen binding fragment thereof) includes a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 10-12, respectively. In some cases, a subject anti-NMU antibody (or antigen binding fragment thereof) includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 2-4, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 10-12, respectively. In some cases, a subject anti-NMU antibody (or antigen binding fragment thereof) includes the antigen binding region (e.g., the CDRs, and in some cases the framework region as well) of the C578 antibody. In some cases, a subject anti-NMU antibody is the C578 antibody. In some cases, a subject anti-NMU antibody is a humanized version of the C578 antibody (e.g., the antibody includes the CDRs of the C578 antibody but is humanized).
[0088] In some cases, a subject anti-NMU antibody (or antigen binding fragment thereof) includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 18-20, respectively. In some cases, a subject anti-NMU antibody (or antigen binding fragment thereof) includes a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 26-28, respectively. In some cases, a subject anti-NMU antibody (or antigen binding fragment thereof) includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 18-20, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 26-28, respectively. In some cases, a subject anti-NMU antibody (or antigen binding fragment thereof) includes the antigen binding region (e.g., the CDRs, and in some cases the framework region as well) of the 2A16 antibody. In some cases, a subject anti-NMU antibody is the 2A16 antibody. In some cases, a subject anti-NMU antibody is a humanized version of the 2A16 antibody (e.g., the antibody includes the CDRs of the 2A16 antibody but is humanized).
[0089] The term NMU-neutralizing antibody is used herein to mean an antibody (or antigen binding fragment thereof) that reduces that activity of NMU (e.g., an antibody that binds to NMU and blocks the interaction between NMU and its receptor (NMUR1)).
[0090] Suitable anti-NMU antibodies (or anti-NMUR1 antibodies) include fully human, humanized or chimeric versions of such antibodies. For example, humanized antibodies are useful for in vivo applications in humans due to their low antigenicity. Similarly caninized, felinized, etc. antibodies are useful for applications in dogs, cats, and other species respectively. Antibodies of interest include humanized antibodies, or caninized, felinized, equinized, bovinized, porcinized, etc., antibodies, and variants thereof. Also envisioned are single chain antibodies derived from camelids, single chain antibodies derived from shark, engineered fibronectin domain-containing proteins, knottin peptides, and DARPins; and fluorophore-conjugated versions of each of these reagents.
[0091] In some cases, an anti-NMU antibody (e.g., one that includes the light and heavy chain CDRs of C578 or 2A16) is a humanized antibody (e.g., can be an IgG4 isotype humanized antibody, e.g., an IgG4 isotype antibody having a mutation in the hinge region such as the S241P mutation that reduces heterogeneity sometimes found in chimeric mouse/human IgG4 antibodies)(e.g., see Angal et al., Mol Immunol. 1993 January; 30(1):105-8). In other words, in some cases, an anti-NMU antibody (e.g., one that includes a light chain with CDR-L1, CDR-L2, and CDR-L3 having the amino acid sequences set forth in SEQ ID NOs: 2-4, respectively, and a heavy chain with CDR-H1, CDR-H2, and CDR-H3 having the amino acid sequences set forth in SEQ ID NOs: 10-12, respectively; or one that includes a light chain with CDR-L1, CDR-L2, and CDR-L3 having the amino acid sequences set forth in SEQ ID NOs: 18-20, respectively, and a heavy chain with CDR-H1, CDR-H2, and CDR-H3 having the amino acid sequences set forth in SEQ ID NOs: 26-28, respectively) is a humanized antibody (e.g., can be an IgG4 isotype humanized antibody, e.g., an IgG4 isotype antibody having a mutation in the hinge region such as the S241P mutation that reduces heterogeneity sometimes found in chimeric mouse/human IgG4 antibodies).
[0092] In general, humanized antibodies are made by substituting amino acids in the framework regions of a parent non-human antibody to produce a modified antibody that is less immunogenic in a human than the parent non-human antibody. For example, in some cases, antibody humanization involves placing the complementarity determining regions (CDRs) into the framework of a human antibody, leading to production of a chimeric antibody compatible with human in vivo use.
[0093] Antibodies can be humanized using a variety of techniques known in the art including, for example, CDR-grafting (EP 239,400; PCT publication WO 91/09967; U.S. Pat. Nos. 5,225,539; 5,530,101; and 5,585,089), veneering or resurfacing (EP 592,106; EP 519,596; Padlan, Molecular Immunology 28(4/5):489-498 (1991); Studnicka et al., Protein Engineering 7(6):805-814 (1994); Roguska. et al., PNAS 91:969-973 (1994)), and chain shuffling (U.S. Pat. No. 5,565,332). In certain embodiments, framework substitutions are identified by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions (see, e.g., U.S. Pat. No. 5,585,089; Riechmann et al., Nature 332:323 (1988)). Additional methods for humanizing antibodies contemplated herein are described in U.S. Pat. Nos. 5,750,078; 5,502,167; 5,705,154; 5,770,403; 5,698,417; 5,693,493; 5,558,864; 4,935,496; and 4,816,567, and PCT publications WO 98/45331 and WO 98/45332.
[0094] In some embodiments, therefore, the disclosure provides humanized versions of the above described monoclonal antibodies (e.g., those antibodies that recognize human NMU). For any of the described anti-NMU antibodies, the antibody can be a humanized antibody, a binding fragment thereof (e.g., a Fab fragment), or any permutation having the antigen binding domain (or, e.g., the CDRs of the antigen binding domain). (e.g., see definition of antibody above).
[0095] In some case, an anti-NMU/NMUR agent is an RNAi agent (e.g., an anti-NMUR1 RNAi agent or an anti-NMU RNAi agent). For example, genetic studies presented in the examples below demonstrate results in mice harboring genetic ablation of NMUR1. Such ablation can be temporarily or permanently mimicked using RNAi agents, e.g., an RNAi agent that targets (e.g., is specific for) NMUR1, or an RNAi agent that targets (e.g., is specific for) NMU.
[0096] The term RNAi agent is used herein to mean any agent that can be used to induce a gene specific RNA interference (RNAi) response in a cell. Suitable examples of RNAi agents include, but are not limited to short interfering RNAs (siRNAs) and short hairpin RNAs (shRNAs), and micro RNAs (miRNA). An RNAi agent (e.g., shRNA, siRNA, miRNA) specific for NMU is an agent that targets the mRNA encoding the NMU protein. An RNAi agent (e.g., shRNA, siRNA, miRNA) specific for NMUR1 is an agent that targets the mRNA encoding the NMUR1 protein. RNAi agents can readily be designed to specifically target any desired mRNA (e.g., one encoding NMU or NMUR1) by choosing an appropriate nucleotide sequence.
[0097] Various RNAi agent designs (RNAi agents with various features) are known in the art and any convenient RNAi agent (e.g., one that targets NMU or one that targets NMUR1) can be used. For example, various designs of RNAi agents (as well as methods of their delivery) can be found in numerous patents, including, but not limited to U.S. Pat. Nos. 7,022,828; 7,176,304; 7,592,324; 7,667,028; 7,718,625; 7,732,593; 7,772,203; 7,781,414; 7,807,650; 7,879,813; 7,892,793; 7,910,722; 7,947,658; 7,973,019; 7,973,155; 7,981,446; 7,993,925; 8,008,271; 8,008,468; 8,017,759; 8,034,922; 8,399,653; 8,415,319; 8,426,675; 8,466,274; 8,524,679; 8,524,679; 8,569,065; 8,569,256; 8,569,258; 9,233,102; 9,233,170; and 9,233,174; all of which are incorporated herein by reference.
Two-Way ELISA Assay (Sandwich ELISA)
[0098] Provided are compositions (e.g., kits) and methods for measuring NMU in a sample (e.g., in a blood sample, in a serum sample, in a plasma sample, and the like). In some cases, a subject method of detection is a two-way enzyme-linked immunosorbent assay (two-way ELISA). In some cases, in a subject two-way ELISA, a first antibody is immobilized on a solid surface (e.g., a bead, the surface of a well in a multi-well plate, etc.). The first antibody binds to an antigen (in this case NMU), and then a second antibody is used that also binds to the antigen, but binds to a different region of the antigen than the region to which the first antibody binds. In other words, the first and second antibodies bind to non-overlapping amino acids of NMU.
[0099] In some cases, a subject method is a method of detecting NMU, and includes a step of measuring an amount of NMU present in a biological sample using a subject two-way ELISA (e.g., as described here and in the kits below). Such methods include contacting a biological sample (e.g., contacting NMU in the biological sample) with the first and second anti-NMU antibodies, and measuring an amount of the second anti-NMU antibody. For example, in some cases, the method includes (a) contacting a biological sample (e.g., serum sample) with a first anti-NMU antibody, wherein the first anti-NMU antibody is immobilized on a solid surface and NMU of the biological sample binds to the first anti-NMU antibody; (b) contacting the NMU that is bound to the first anti-NMU antibody, with the second anti-NMU antibody; and (c) measuring an amount of the second anti-NMU antibody. In some cases, the method includes a first wash step between steps (a) and (b), and/or performing a second wash step between steps (b) and (c). In some cases the biological sample is a blood sample. In some cases the biological sample is a serum sample. In some cases the biological sample is an aspirate. In some cases the biological sample is a biopsy (e.g., from a biopsy).
[0100] In some cases, the second antibody is detectably labeled (e.g., conjugated to an indirectly or directly detectable label). In some cases, the second antibody is not conjugated to a label but is nonetheless detectable (e.g., using secondary antibodies, e.g., if the second antibody is a mouse or a goat antibody, it can be detected using an anti-mouse or anti-goat secondary antibody, respectively).
[0101] For the antibody regions discussed below (e.g., CDRs, framework regions, and the like), please refer to
[0102] In some cases, the first antibody of a subject two-way ELISA includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 2-4, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 10-12, respectively. In some cases, the first antibody includes the antigen binding region (e.g., the CDRs, and in some cases the framework region as well) of the C578 antibody. In some cases, the first antibody is the C578 antibody. In some cases, the first antibody is a humanized version of the C578 antibody (e.g., the antibody includes the CDRs of the C578 antibody but is humanized).
[0103] In some cases, the first antibody includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 18-20, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 26-28, respectively. In some cases, the first antibody includes the antigen binding region (e.g., the CDRs, and in some cases the framework region as well) of the 2A16 antibody. In some cases, the first antibody is the 2A16 antibody. In some cases, the first antibody is a humanized version of the 2A16 antibody (e.g., the antibody includes the CDRs of the 2A16 antibody but is humanized).
[0104] In some cases, the second antibody includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 2-4, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 10-12, respectively. In some cases, the second antibody includes the antigen binding region (e.g., the CDRs, and in some cases the framework region as well) of the C578 antibody. In some cases, the second antibody is the C578 antibody. In some cases, the second antibody is a humanized version of the C578 antibody (e.g., the antibody includes the CDRs of the C578 antibody but is humanized).
[0105] In some cases, the second antibody includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 18-20, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 26-28, respectively. In some cases, the second antibody includes the antigen binding region (e.g., the CDRs, and in some cases the framework region as well) of the 2A16 antibody. In some cases, the second antibody is the 2A16 antibody. In some cases, the second antibody is a humanized version of the 2A16 antibody (e.g., the antibody includes the CDRs of the 2A16 antibody but is humanized).
[0106] In some cases, the first antibody includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 2-4, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 10-12, respectively; and the second antibody includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 18-20, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 26-28, respectively. In some cases, the first antibody includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 18-20, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 26-28, respectively; and the second antibody includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 2-4, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 10-12, respectively. In some cases, the first antibody includes the antigen binding region (e.g., the CDRs, and in some cases the framework region as well) of the C578 antibody; and the second antibody includes the antigen binding region (e.g., the CDRs, and in some cases the framework region as well) of the 2A16 antibody; or visa versa. In some cases, the first antibody is the C578 antibody; and the second antibody is the 2A16 antibody; or visa versa. In some cases, the first antibody is a humanized version of the C578 antibody (e.g., the antibody includes the CDRs of the C578 antibody but is humanized), and the second antibody is a humanized version of the 2A16 antibody (e.g., the antibody includes the CDRs of the 2A16 antibody but is humanized); or visa versa.
[0107] As such, in some cases, one of the first and second antibodies includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 2-4, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 10-12, respectively; and the other of the first and second antibodies includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 18-20, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 26-28, respectively. In some cases, one of the first and second antibodies includes the antigen binding region (e.g., the CDRs, and in some cases the framework region as well) of the C578 antibody; and the other of the first and second antibodies includes the antigen binding region (e.g., the CDRs, and in some cases the framework region as well) of the 2A16 antibody. In some cases, one of the first and second antibodies is the C578 antibody; and the other of the first and second antibodies is the 2A16 antibody. In some cases, one of the first and second antibodies is a humanized version of the C578 antibody (e.g., the antibody includes the CDRs of the C578 antibody but is humanized), and the other of the first and second antibodies is a humanized version of the 2A16 antibody (e.g., the antibody includes the CDRs of the 2A16 antibody but is humanized).
[0108] In some cases, a subject kit is a kit for measuring NMU in a sample (e.g., in a blood sample, in a serum sample, in a plasma sample, and the like). In some cases, a subject kit includes a first anti-NMU antibody and a second anti-NMU antibody, where one of the first and second anti-NMU antibodies includes (i) a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 2-4, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 10-12, respectively; or (ii) a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 18-20, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 26-28, respectively.
[0109] In some cases, a subject kit includes a first anti-NMU antibody and a second anti-NMU antibody, where one of the first and second anti-NMU antibodies includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 2-4, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 10-12, respectively; and the other of the first and second anti-NMU antibodies includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 18-20, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 26-28, respectively.
[0110] In some cases, a subject kit includes a first anti-NMU antibody and a second anti-NMU antibody, where one of the first and second anti-NMU antibodies includes (i) the antigen binding region (e.g., the CDRs, and in some cases the framework region as well) of the C578 antibody; or (ii) the antigen binding region (e.g., the CDRs, and in some cases the framework region as well) of the 2A16 antibody. In some cases, a subject kit includes a first anti-NMU antibody and a second anti-NMU antibody, where one of the first and second anti-NMU antibodies includes the antigen binding region (e.g., the CDRs, and in some cases the framework region as well) of the C578 antibody; and the other of the first and second anti-NMU antibodies includes the antigen binding region (e.g., the CDRs, and in some cases the framework region as well) of the 2A16 antibody.
[0111] In some cases, a subject kit includes a first anti-NMU antibody and a second anti-NMU antibody, where one of the first and second anti-NMU antibodies is (i) the C578 antibody; or (ii) the 2A16 antibody. In some cases, a subject kit includes a first anti-NMU antibody and a second anti-NMU antibody, where one of the first and second anti-NMU antibodies is the C578 antibody; and the other of the first and second anti-NMU antibodies is the 2A16 antibody.
[0112] In some cases, one or both of the first and second anti-NMU antibodies are humanized (e.g., a humanized version of the C578 antibody and/or a humanized version of the 2A16 antibody). In some cases, the first anti-NMU antibody is immobilized on a solid surface (e.g., on the surface of a well of a multi-well plate, on the surface of a bead, etc.). In some cases, the second anti-NMU antibody is labeled (e.g., indirectly labeled and/or directly labeled, e.g., conjugated to an indirectly detectable label such as an enzyme, conjugated to a directly detectable label such as a fluorophore or a fluorescent protein, and the like).
[0113] In some cases, a subject two-way ELISA assay can detect (e.g., is used to detect) NMU in a sample, where the NMU is present at a concentration in a range of from 0.02 to 50 ng/mL (e.g., 0.02 to 40 ng/ml, 0.02 to 30 ng/ml, 0.02 to 25 ng/ml, 0.02 to 20 ng/ml, 0.02 to 15 ng/ml, 0.05 to 50 ng/ml, 0.05 to 40 ng/ml, 0.05 to 30 ng/ml, 0.05 to 25 ng/ml, 0.05 to 20 ng/ml, 0.05 to 15 ng/ml, 0.1 to 50 ng/ml, 0.1 to 40 ng/ml, 0.1 to 30 ng/ml, 0.1 to 25 ng/ml, 0.1 to 20 ng/ml, 0.1 to 15 ng/ml, 0.2 to 50 ng/ml, 0.2 to 40 ng/ml, 0.2 to 30 ng/ml, 0.2 to 25 ng/ml, 0.2 to 20 ng/ml, or 0.2 to 15 ng/ml). In some cases, a subject two-way ELISA assay can detect (e.g., is used to detect) NMU in a sample, where the NMU is present at a concentration in a range of from 0.1 to 20 ng/ml.
Methods
Prediction Methods
[0114] Provided are prediction methods (e.g. predicting whether an individual will develop diabetes, predicting whether an individual will develop PDAC or pancreatitis, predicting whether an individual is in need of therapy using an anti-NMU/NMUR agent, i.e., identifying an individual who would benefit from administration of an anti-NMU/NMUR agent). Provided are diagnostic methods (e.g. predicting whether an individual has diabetes, predicting/determining whether an individual has PDAC or pancreatitis, predicting whether an individual has type 3c diabetes mellitus (T3cDM), predicting whether an individual is in need of therapy using an anti-NMU/NMUR agent, i.e., identifying an individual who would benefit from administration of an anti-NMU/NMUR agent).
[0115] In some embodiments, a subject method is a method of predicting (e.g., predicting that an individual will develop diabetes), and the method includes measuring NMU (e.g., using a two-way ELISA as described above). As such, in some embodiments, a subject method includes detecting (e.g., measuring an amount of) NMU in sample (e.g., a biological sample such as a blood sample, serum sample, tumor sample, etc.). In some cases, NMU is measured via two-way ELISA (e.g., as described above). In some cases, a measuring step (to measure NMU) is performed after a provocation step such as an overnight fast, a glucose challenge (e.g., an oral bolus of glucose), etc
[0116] Because the prediction and diagnostic methods are based on a measured expression level of NMU (protein and/or RNA) in a sample, the prediction methods include a step of measuring, e.g., measuring an expression level of an NMU expression product in a biological sample from an individual (e.g., measuring a protein expression level, i.e., the amount of NMU in a sample; measuring an mRNA expression level, i.e., the amount of mRNA encoding NMU in a sample). Thus, the present disclosure provides compositions for measuring neuromedin U (NMU) in a sample (e.g., a biological sample such as a blood sample, a serum sample, a biopsy, etc.).
[0117] A biomarker is a molecular entity (e.g., an expression product such as mRNA, protein, etc.) whose representation in a sample correlates (either positively or negatively) with a particular state. For example, an expression level of NMU (protein) in the serum correlates with whether an individual is likely to develop diabetes. As demonstrated in the examples of the present disclosure, the inventors have identified NMU as a biomarker positively associated with increased likelihood that a given individual will develop diabetes (e.g., type 2 Diabetes (T2DM)). For example, an increased level of NMU in the serum is predictive that an individual will develop diabetes. In some cases, the individual is suspected of having an increased risk of developing diabetes (e.g., the individual has a family history of diabetes, is overweight, and/or is obese) prior to the measuring step. In some cases, a subject method includes (a) measuring an expression level of NMU (e.g., mRNA, protein) in a biological sample from an individual (e.g., a blood sample, a biopsy, a serum sample), (b) determining that the measured expression level of NMU is greater than or equal to a reference value; and (c) predicting that the individual will develop diabetes. In some cases, the measuring step is performed using an anti-NMU antibody (or fragment thereof) disclosed herein. In some cases, the measuring step is performed using a two-way ELISA disclosed herein.
[0118] In some cases, NMU can be used as a biomarker positively associated with increased likelihood that a given individual will develop PDAC. In some cases, the individual is suspected of having an increased risk of developing PDAC (e.g., the individual may have a family history of PDAC, may have pancreatitis, may already have diabetes, etc.). As such in some cases, a subject method includes (a) measuring an expression level of NMU (e.g., mRNA, protein) in a biological sample from an individual (e.g., a blood sample, a biopsy), (b) determining that the measured expression level of NMU is greater than or equal to a reference value; and (c) predicting that the individual will develop PDAC. In some cases, the measuring step is performed using an anti-NMU antibody (or fragment thereof) disclosed herein. In some cases, the measuring step is performed using a two-way ELISA disclosed herein.
[0119] In some cases, NMU can be used as a biomarker positively associated with increased likelihood that a given individual will develop PDAC or pancreatitis (e.g., recurrent acute pancreatitis and/or chronic pancreatitis). In some cases, the individual is suspected of having an increased risk of developing PDAC or pancreatitis (e.g., recurrent acute pancreatitis and/or chronic pancreatitis) (e.g., the individual may have a family history of PDAC or pancreatitis). As such in some cases, a subject method includes (a) measuring an expression level of NMU (e.g., mRNA, protein) in a biological sample from an individual (e.g., a blood sample, a biopsy), (b) determining that the measured expression level of NMU is greater than or equal to a reference value; and (c) predicting that the individual will develop PDAC or pancreatitis (e.g., recurrent acute pancreatitis and/or chronic pancreatitis). In some cases, the measuring step is performed using an anti-NMU antibody (or fragment thereof) disclosed herein. In some cases, the measuring step is performed using a two-way ELISA disclosed herein.
[0120] In some cases, NMU can be used as a biomarker positively associated with increased likelihood that a given individual will be responsive to (e.g., is in need of) administration of a subject anti-NMU/NMUR agent (e.g., an anti-NMU antibody). In some cases, the individual is suspected of being an individual will be responsive to (e.g., is in need of) administration of a subject anti-NMU/NMUR agent (e.g., an anti-NMU antibody) (e.g., in some cases, the individual is overweight, obese, has diabetes, has type 2 diabetes, has type 3c diabetes, has PDAC, has recurring acute pancreatitis, has chronic pancreatitis, and/or has cancer cachexia. As such in some cases, a subject method includes (a) measuring an amount of NMU present in a blood sample from an individual (e.g., a serum sample), (b) determining that the amount of NMU present in the blood sample is greater than or equal to a reference value (e.g., see below); and (c) predicting that the individual would benefit from administration of an anti-NMU/NMUR agent. In some cases, the measuring step is performed using an anti-NMU antibody (or fragment thereof) disclosed herein. In some cases, the measuring step is performed using a two-way ELISA disclosed herein.
[0121] The terms assaying and measuring are used herein to include the physical steps of manipulating a biological sample (e.g., blood sample, serum sample, cell sample, biopsy, and the like) to generate data related to a sample (e.g., measuring an expression level in a biological sample). In practicing the subject methods, the expression level of a NMU expression product (e.g., mRNA, protein) can be measured (e.g., the expression level in a cell, in a population of cells, in a biological sample from an individual, and the like). The expression level(s) can be measured by any convenient method. For example, an RNA expression level can be measured by measuring the levels/amounts of one or more nucleic acid transcripts, e.g. mRNAs, of NMU. Protein expression levels of NMU can be detected by measuring the levels/amounts of the NMU protein (e.g., using a two-way ELISA disclosed herein). In some cases, measuring is performed using an anti-NMU antibody (or fragment thereof) disclosed herein. In some cases, the measuring step is performed using a two-way ELISA disclosed herein.
[0122] Measuring can be used to determine whether the measured expression level is less than, greater than, less than or equal to, or greater than or equal to a particular threshold, (the threshold can be pre-determined or can be determined by assaying a control sample), such as a reference value. Measuring can mean determining a quantitative value (using any convenient metric) that represents the level of expression (i.e., expression level, e.g., the amount of protein and/or RNA, e.g., mRNA) of a particular expression product (e.g., a NMU expression product). The level of expression can be expressed in arbitrary units associated with a particular assay (e.g., fluorescence units, e.g., mean fluorescence intensity (MFI), threshold cycle (C.sub.t), quantification cycle (C.sub.q), and the like), or can be expressed as an absolute value with defined units (e.g., number of mRNA transcripts, number of protein molecules, concentration of protein, etc.).
[0123] An expression level (i.e., level of expression) can be a raw measured value, or can be a normalized and/or weighted value derived from the raw measured value. The terms expression level and measured expression level are used herein to encompass raw measured values as well as values that have manipulated in some way (e.g., normalized and/or weighted). In some cases, a normalized expression level is a measured expression level of an expression product from a sample where the raw measured value for the expression product has been normalized. For example, the expression level of an expression product (e.g., an RNA encoding NMU, a NMU protein) can be compared to the expression level of one or more other expression products (e.g., the expression level of a housekeeping gene/protein, the averaged expression levels of multiple genes/proteins, etc.) to derive a normalized value that represents a normalized expression level. Methods of normalization will be known to one of ordinary skill in the art and any convenient normalization method can be used. The specific metric (or units) chosen is not crucial as long as the same units are used (or conversion to the same units is performed) when evaluating multiple markers and/or multiple biological samples (e.g., samples from multiple individuals or multiple samples from the same individual).
Measuring Protein
[0124] An expression level of an expression product (e.g., an expression product of NMU) may be measured by detecting (e.g., in a cell extract, in a fixed cell, in living cell, in a biological sample, in a blood sample, in a serum sample, etc.) the amount or level of one or more proteins (e.g., NMU) or a fragment thereof. For measuring a protein level, the amount or level of protein the sample (e.g., in a cell extract, in a fixed cell, in living cell, in a biological sample, in a blood sample, in a serum sample, etc.) is determined. In some instances, the concentration of one or more additional proteins may also be measured, and the measured expression level compared to the level of the one or more additional proteins to provide a normalized value for the measured expression level. In some embodiments, the measured expression level is a relative value calculated by comparing the level of one protein relative to another protein. In other embodiments the concentration is an absolute measurement (e.g., weight/volume or weight/weight).
[0125] The expression level of a protein (e.g., NMU) may be measured by detecting in a sample the amount or level of one or more proteins/polypeptides or fragments thereof. The terms polypeptide, peptide and protein are used interchangeably herein to refer to a polymer of amino acid residues. Polypeptide refers to a polymer of amino acids (amino acid sequence) and does not refer to a specific length of the molecule. Thus peptides and oligopeptides are included within the definition of polypeptide. In some cases, cells and/or exosomes are removed from a biological sample (e.g., via centrifugation, via adhering cells to a dish or to plastic, etc.) prior to measuring the expression level (e.g., measuring in a serum sample from which exosomes have been removed).
[0126] When protein levels are to be detected, any convenient protocol for measuring protein levels may be employed. Examples of methods for assaying protein levels include but are not limited to enzyme-linked immunosorbent assay (ELISA) (e.g., a two-way ELISA as disclosed herein), mass spectrometry, proteomic arrays, xMAP microsphere technology, flow cytometry, western blotting, immunohistochemistry, and the like. In some cases, an anti-NMU antibody described herein is used for measuring a level of NMU protein in a sample (e.g., a serum sample).
[0127] Some protein detection methods are antibody-based methods (e.g., a subject two-way ELISA). The term antibody is used in the broadest sense and specifically covers monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired biological activity.
Measuring RNA
[0128] An expression level of an expression product (e.g., an expression product of NMU) may be measured by detecting (e.g., in a cell extract, in a fixed cell, in a living cell, in a biological sample, in a biopsy sample, etc.) the amount or level of one or more RNA transcripts or a fragment thereof encoded by the gene of interest (NMU). For measuring RNA levels, the amount or level of an RNA in the sample is determined, e.g., the expression level of an mRNA. In some instances, the expression level of one or more additional RNAs may also be measured, and the level of biomarker expression compared to the level of the one or more additional RNAs to provide a normalized value for the biomarker expression level.
[0129] The expression level of nucleic acids in the sample may be detected using any convenient protocol. A number of exemplary methods for measuring RNA (e.g., mRNA) expression levels (e.g., expression level of a nucleic acid biomarker) in a sample are known by one of ordinary skill in the art, such as those methods employed in the field of differential gene expression analysis, and any convenient method can be used. Exemplary methods include, but are not limited to: hybridization-based methods (e.g., Northern blotting, array hybridization (e.g., microarray); in situ hybridization; in situ hybridization followed by FACS; and the like)(Parker & Barnes, Methods in Molecular Biology 106:247-283 (1999)); RNAse protection assays (Hod, Biotechniques 13:852-854 (1992)); PCR-based methods (e.g., reverse transcription PCR (RT-PCR), quantitative RT-PCR (qRT-PCR), real-time RT-PCR, etc.)(Weis et al., Trends in Genetics 8:263-264 (1992)); nucleic acid sequencing methods (e.g., Sanger sequencing, Next Generation sequencing (i.e., massive parallel high throughput sequencing, e.g., Illumina's reversible terminator method, Roche's pyrosequencing method (454), Life Technologies' sequencing by ligation (the SOLiD platform), Life Technologies' Ion Torrent platform, single molecule sequencing, etc.); nanopore based sequencing methods; and the like.
[0130] In some embodiments, the biological sample can be assayed directly. In some embodiments, nucleic acid of the biological sample is amplified (e.g., by PCR) prior to assaying. As such, techniques such as PCR (Polymerase Chain Reaction), RT-PCR (reverse transcriptase PCR), qRT-PCR (quantitative RT-PCR, real time RT-PCR), etc. can be used prior to the hybridization methods and/or the sequencing methods discussed above.
[0131] As noted above, gene expression in a sample can be detected using hybridization analysis, which is based on the specificity of nucleotide interactions. Oligonucleotides or cDNA can be used to selectively identify or capture DNA or RNA of specific sequence composition, and the amount of RNA or cDNA hybridized to a known capture sequence determined qualitatively or quantitatively, to provide information about the relative representation of a particular message within the pool of cellular messages in a sample. Hybridization analysis can be designed to allow for concurrent screening of the relative expression of hundreds to thousands of genes by using, for example, array-based technologies having high density formats, including filters, microscope slides, or microchips, or solution-based technologies that use spectroscopic analysis.
[0132] Hybridization to arrays may be performed, where the arrays can be produced according to any suitable methods known in the art. For example, methods of producing large arrays of oligonucleotides are described in U.S. Pat. Nos. 5,134,854, and 5,445,934 using light-directed synthesis techniques. Using a computer controlled system, a heterogeneous array of monomers is converted, through simultaneous coupling at a number of reaction sites, into a heterogeneous array of polymers. Alternatively, microarrays are generated by deposition of pre-synthesized oligonucleotides onto a solid substrate, for example as described in PCT published application no. WO 95/35505.
[0133] Methods for collection of data from hybridization of samples with an array are also well known in the art. For example, the polynucleotides of the cell samples can be generated using a detectable fluorescent label, and hybridization of the polynucleotides in the samples detected by scanning the microarrays for the presence of the detectable label. Methods and devices for detecting fluorescently marked targets on devices are known in the art. Generally, such detection devices include a microscope and light source for directing light at a substrate. A photon counter detects fluorescence from the substrate, while an x-y translation stage varies the location of the substrate. A confocal detection device that can be used in the subject methods is described in U.S. Pat. No. 5,631,734. A scanning laser microscope is described in Shalon et al., Genome Res. (1996) 6:639. A scan, using the appropriate excitation line, is performed for each fluorophore used. The digital images generated from the scan are then combined for subsequent analysis. For any particular array element, the ratio of the fluorescent signal from one sample is compared to the fluorescent signal from another sample, and the relative signal intensity determined.
[0134] Methods for analyzing the data collected from hybridization to arrays are well known in the art. For example, where detection of hybridization involves a fluorescent label, data analysis can include the steps of determining fluorescent intensity as a function of substrate position from the data collected, removing outliers, i.e. data deviating from a predetermined statistical distribution, and calculating the relative binding affinity of the targets from the remaining data. The resulting data can be displayed as an image with the intensity in each region varying according to the binding affinity between targets and probes.
[0135] One representative and convenient type of protocol for measuring mRNA levels is array-based gene expression profiling. Such protocols are hybridization assays in which a nucleic acid that displays probe nucleic acids for each of the genes to be assayed/profiled in the profile to be generated is employed. In these assays, a sample of target nucleic acids is first prepared from the initial nucleic acid sample being assayed, where preparation may include labeling of the target nucleic acids with a label, e.g., a member of signal producing system. Following target nucleic acid sample preparation, the sample is contacted with the array under hybridization conditions, whereby complexes are formed between target nucleic acids that are complementary to probe sequences attached to the array surface. The presence of hybridized complexes is then detected, either qualitatively or quantitatively.
[0136] Specific hybridization technology which may be practiced to generate the expression profiles employed in the subject methods includes the technology described in U.S. Pat. Nos. 5,143,854; 5,288,644; 5,324,633; 5,432,049; 5,470,710; 5,492,806; 5,503,980; 5,510,270; 5,525,464; 5,547,839; 5,580,732; 5,661,028; 5,800,992; the disclosures of which are herein incorporated by reference; as well as WO 95/21265; WO 96/31622; WO 97/10365; WO 97/27317; EP 373 203; and EP 785 280. In these methods, an array of probe nucleic acids that includes a probe for each of the phenotype determinative genes whose expression is being assayed is contacted with target nucleic acids as described above. Contact is carried out under hybridization conditions, e.g., stringent hybridization conditions, and unbound nucleic acid is then removed. The term stringent assay conditions as used herein refers to conditions that are compatible to produce binding pairs of nucleic acids, e.g., surface bound and solution phase nucleic acids, of sufficient complementarity to provide for the desired level of specificity in the assay while being less compatible to the formation of binding pairs between binding members of insufficient complementarity to provide for the desired specificity. Stringent assay conditions are the summation or combination (totality) of both hybridization and wash conditions.
[0137] The resultant pattern of hybridized nucleic acid provides information regarding expression for each of the genes that have been probed, where the expression information is in terms of whether or not the gene is expressed and, typically, at what level, where the expression data, i.e., expression profile (e.g., in the form of a transcriptosome), may be both qualitative and quantitative. Pattern analysis can be performed manually, or can be performed using a computer program. Methods for preparation of substrate matrices (e.g., arrays), design of oligonucleotides for use with such matrices, labeling of probes, hybridization conditions, scanning of hybridized matrices, and analysis of patterns generated, including comparison analysis, are described in, for example, U.S. Pat. No. 5,800,992.
[0138] Alternatively, non-array based methods for quantitating the level of one or more nucleic acids in a sample may be employed. These include those based on amplification protocols, e.g., Polymerase Chain Reaction (PCR)-based assays, including quantitative PCR, reverse-transcription PCR (RT-PCR), real-time PCR, quantitative RT-PCR (qRT-PCR), and the like, e.g. TaqMan RT-PCR, SYBR green; MassARRAY System, BeadArray technology, and Luminex technology; and those that rely upon hybridization of probes to filters, e.g. Northern blotting and in situ hybridization. Other non-amplified methods of analysis include digital bar-coding, e.g. NanoString nCounter Analysis System which is a digital color-coded barcode technology based on direct multiplexed measurement of gene expression. The technology uses molecular barcodes and single molecule imaging to detect and count hundreds of unique transcripts in a single reaction. Each color-coded barcode is attached to a single target-specific probe corresponding to a gene of interest. Mixed together with controls, they form a multiplexed CodeSet.
[0139] Examples of some of the nucleic acid sequencing methods listed above are described in the following references: Margulies et al (Nature 2005 437: 376-80); Ronaghi et al (Analytical Biochemistry 1996 242: 84-9); Shendure (Science 2005 309: 1728); Imelfort et al (Brief Bioinform. 2009 10:609-18); Fox et al (Methods Mol Biol. 2009; 553:79-108); Appleby et al (Methods Mol Biol. 2009; 513:19-39); Soni et al Clin Chem 53: 1996-2001 2007; and Morozova (Genomics. 2008 92:255-64), which are incorporated by reference for the general descriptions of the methods and the particular steps of the methods, including starting products, reagents, and final products for each of the steps.
[0140] For measuring mRNA levels, the starting material can be RNA or poly A+ RNA (e.g., isolated from a biological sample, from a suspension of cells, etc.). General methods for mRNA extraction are known in the art and are disclosed in standard textbooks of molecular biology, including Ausubel et al., Current Protocols of Molecular Biology, John Wiley and Sons (1997). RNA isolation (e.g., mRNA isolation) can be performed using any convenient protocol. For example, RNA isolation can be performed using a purification kit, buffer set and protease from commercial manufacturers, according to the manufacturer's instructions. For example, RNA from cell suspensions can be isolated using Qiagen RNeasy mini-columns, and RNA from cell suspensions or homogenized tissue samples can be isolated using the TRIzol reagent-based kits (Invitrogen), MasterPure Complete DNA and RNA Purification Kit (EPICENTRE, Madison, Wis.), Paraffin Block RNA Isolation Kit (Ambion, Inc.) or RNA Stat-60 kit (Tel-Test).
Reference Value
[0141] A measured NMU expression level (e.g., NMU protein, NMU encoding mRNA) can be determined in a number of different ways. For example, in some cases, a NMU expression level is measured in a sample (e.g., the concentration of NMU in sample such as serum sample is measured) and is compared to a reference value.
[0142] In some cases, the expression level (e.g., the number of transcripts, the concentration of NMU protein in a sample, and the like) of an NMU expression product (e.g., RNA, protein) in a biological sample from an individual who is predicted to develop diabetes, PDAC, and/or pancreatitis is greater than a reference value (e.g., an expression level of an NMU expression product in one or more biological samples from one or more control individuals who do not have diabetes, PDAC, and/or pancreatitis; a value, e.g., an average, derived from the expression level of an NMU expression product in a biological sample from multiple control individuals who do not have diabetes, PDAC, and/or pancreatitis; etc.).
[0143] For example, the expression level (e.g., the concentration of protein, the number of transcripts, the concentration of NMU protein in a sample, and the like) of an NMU expression product (e.g., RNA, protein) in a biological sample from an individual who is predicted to develop diabetes, PDAC, and/or pancreatitis can be 1.1-fold or more (e.g., 1.2-fold or more, 1.3-fold or more, 1.4-fold or more, 1.5-fold or more, 2-fold or more, 2.5-fold or more, 3-fold or more, 4-fold or more, 5-fold or more, 7.5-fold or more, or 10-fold or more) greater than a reference value (e.g., an expression level of an NMU expression product in one or more biological samples from one or more control individuals who do not have diabetes, PDAC, and/or pancreatitis; a value, e.g., an average, derived from the expression level of an NMU expression product in a biological sample from multiple control individuals who do not have diabetes, PDAC, and/or pancreatitis; etc.).
[0144] In some cases, the expression level (e.g., the number of transcripts, the concentration of NMU protein in a sample, and the like) of an NMU expression product (e.g., RNA, protein) in a biological sample from an individual who would benefit from administration of a subject anti-NMU/NMUR agent (e.g., an anti-NMU antibody) is greater than a reference value (e.g., an expression level of an NMU expression product in one or more biological samples from one or more control individuals who are not in need of (or who would not benefit from) administration of a subject anti-NMU/NMUR agent (e.g., an anti-NMU antibody), e.g., an average, derived from the expression level of an NMU expression product in a biological sample from multiple control individuals who are not in need of (or who would not benefit from) administration of a subject anti-NMU/NMUR agent (e.g., an anti-NMU antibody)).
[0145] For example, the expression level (e.g., the concentration of protein, the number of transcripts, the concentration of NMU protein in a sample, and the like) of an NMU expression product (e.g., RNA, protein) in a biological sample from an individual who would benefit from administration of a subject anti-NMU/NMUR agent (e.g., an anti-NMU antibody) can be 1.1-fold or more (e.g., 1.2-fold or more, 1.3-fold or more, 1.4-fold or more, 1.5-fold or more, 2-fold or more, 2.5-fold or more, 3-fold or more, 4-fold or more, 5-fold or more, 7.5-fold or more, or 10-fold or more) greater than a reference value (e.g., an expression level of an NMU expression product in one or more biological samples from one or more control individuals who are not in need of (or who would not benefit from) administration of a subject anti-NMU/NMUR agent (e.g., an anti-NMU antibody), e.g., an average, derived from the expression level of an NMU expression product in a biological sample from multiple control individuals who are not in need of (or who would not benefit from) administration of a subject anti-NMU/NMUR agent (e.g., an anti-NMU antibody)).
[0146] In some cases, the predicting and/or diagnosing is based on a measured expression level of NMU (e.g., protein, mRNA) in combination with one or more clinical measurements (e.g., a meal tolerance test (MTT), patient weight, an insulin measurement, a test of insulin sensitivity, a measure of glucose level, etc.).
Generating a Report
[0147] In some cases, a subject method (e.g., any of the screening methods described above) includes a step of generating a report (e.g., a report that the test agent is a candidate agent for treating obesity and/or diabetes).
[0148] A report, as described herein, is an electronic or tangible document which includes report elements that provide information of interest relating to the results and/or assessments of such results of a subject method (e.g., a prediction and/or diagnostic method). In some embodiments, a subject report includes a measured expression level as discussed in greater detail above (e.g., a raw value, a normalized value, a normalized and weighted value, etc.) (e.g., an expression level of a NMU expression product such as a NMU protein expression level and/or a NMU-encoding mRNA expression level). In some embodiments, a subject report includes a NMU expression level. In some cases, a subject report includes an assessment (e.g. a determination of whether an NMU expression product such as an NMU protein or NMU encoding mRNA is elevated in a sample, e.g., relative to a reference value).
[0149] A subject report can be completely or partially electronically generated. A subject report can include one or more of: 1) the assay used to measure the NMU expression level (e.g., a subject two-way ELISA); 2) raw data; 3) details of how an expression level was calculated from raw data; 4) a value associated with whether (and if so how much) a NMU expression level is elevated relative to a reference; 5) information about the biological sample tested; 6) information about the individual from whom the biological sample was collected; and the like. Thus, the subject methods may include a step of generating or outputting a report, which report can be provided in the form of an electronic medium (e.g., an electronic display on a computer monitor), or in the form of a tangible medium (e.g., a report printed on paper or other tangible medium). Any form of report may be provided.
[0150] It will also be readily appreciated that the reports can include additional elements or modified elements. For example, where electronic, the report can contain hyperlinks which point to internal or external databases which provide more detailed information about selected elements of the report. When in electronic format, the report is recorded on a suitable physical medium, such as a computer readable medium, e.g., in a computer memory, zip drive, CD, DVD, etc.
Treatment Methods
[0151] In some embodiments, a subject method is a treatment method (e.g., using an anti-NMU/NMUR agent, e.g., as described above). For example in some cases, a subject method is a method of treating an individual in need thereof (e.g., an individual with elevated NMU levels, e.g., serum NMU levels). In some cases, a subject method is a method of increasing circulating insulin in an individual. In some cases, the individual has diabetes, or is suspected of having an increased risk of developing diabetes (e.g., the individual is obese and/or has a family history that includes diabetics). In some cases, the individual has a disease selected from: cystic fibrosis, familial pancreatitis, idiopathic pancreatitis, chronic pancreatitis, PDAC, type 3c diabetes mellitus, type 2 diabetes, late stage pancreatic cancer, and cancer cachexia.
[0152] Treatment methods provided herein include a step of administering an anti-NMU/NMUR agent (e.g., an anti-NMU antibody, an RNAi agent that targets NMUR1) to an individual. Details related to suitable anti-NMU/NMUR agents can be found above.
[0153] For example, any of the above discussed anti-NMU antibodies can be used as an anti-NMU/NMUR agent. Thus, in some cases, a subject anti-NMU antibody (or antigen binding fragment thereof) includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 18-20, respectively. In some cases, a subject anti-NMU antibody (or antigen binding fragment thereof) includes a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 26-28, respectively. In some cases, a subject anti-NMU antibody (or antigen binding fragment thereof) includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 18-20, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 26-28, respectively. In some cases, a subject anti-NMU antibody (or antigen binding fragment thereof) includes the antigen binding region (e.g., the CDRs, and in some cases the framework region as well) of the 2A16 antibody. In some cases, a subject anti-NMU antibody is the 2A16 antibody. In some cases, a subject anti-NMU antibody is a humanized version of the 2A16 antibody (e.g., the antibody includes the CDRs of the 2A16 antibody but is humanized).
[0154] As such, in some cases, a subject humanized anti-NMU antibody (or antigen binding fragment thereof) includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 18-20, respectively. In some cases, a subject humanized anti-NMU antibody (or antigen binding fragment thereof) includes a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 26-28, respectively. In some cases, a subject humanized anti-NMU antibody (or antigen binding fragment thereof) includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 18-20, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 26-28, respectively. In some cases, a subject humanized anti-NMU antibody (or antigen binding fragment thereof) includes the antigen binding region (e.g., the CDRs, and in some cases the framework region as well) of the 2A16 antibody. In some cases, a subject humanized anti-NMU antibody is the 2A16 antibody. In some cases, a subject humanized anti-NMU antibody is a humanized version of the 2A16 antibody (e.g., the antibody includes the CDRs of the 2A16 antibody but is humanized).
[0155] In some cases, a subject anti-NMU antibody (or antigen binding fragment thereof) includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 2-4, respectively. In some cases, a subject anti-NMU antibody (or antigen binding fragment thereof) includes a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 10-12, respectively. In some cases, a subject anti-NMU antibody (or antigen binding fragment thereof) includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 2-4, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 10-12, respectively. In some cases, a subject anti-NMU antibody (or antigen binding fragment thereof) includes the antigen binding region (e.g., the CDRs, and in some cases the framework region as well) of the C578 antibody. In some cases, a subject anti-NMU antibody is the C578 antibody. In some cases, a subject anti-NMU antibody is a humanized version of the C578 antibody (e.g., the antibody includes the CDRs of the C578 antibody but is humanized).
[0156] As such, in some cases, a subject humanized anti-NMU antibody (or antigen binding fragment thereof) includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 2-4, respectively. In some cases, a subject humanized anti-NMU antibody (or antigen binding fragment thereof) includes a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 10-12, respectively. In some cases, a subject humanized anti-NMU antibody (or antigen binding fragment thereof) includes a light chain comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences set forth in SEQ ID NOs: 2-4, respectively, and a heavy chain comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequences set forth in SEQ ID NOs: 10-12, respectively. In some cases, a subject humanized anti-NMU antibody (or antigen binding fragment thereof) includes the antigen binding region (e.g., the CDRs, and in some cases the framework region as well) of the C578 antibody. In some cases, a subject humanized anti-NMU antibody is the C578 antibody. In some cases, a subject humanized anti-NMU antibody is a humanized version of the C578 antibody (e.g., the antibody includes the CDRs of the C578 antibody but is humanized).
Formulations
[0157] An anti-NMU/NMUR agent (e.g., an anti-NMU antibody) can be prepared as a dosage unit, with a pharmaceutically acceptable excipient, with pharmaceutically acceptable salts and esters, etc. Compositions can be provided as pharmaceutical compositions.
[0158] Pharmaceutical Compositions.
[0159] Suitable anti-NMU/NMUR agents (e.g., one or more anti-NMU antibodies) can be provided in pharmaceutical compositions suitable for therapeutic use, e.g. for human treatment. In some embodiments, pharmaceutical compositions of the present disclosure include one or more therapeutic entities of the present disclosure (e.g., one or more anti-NMU antibodies) and can include a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, a pharmaceutically acceptable excipient, and/or esters or solvates thereof. In some embodiments, the use of an anti-NMU/NMUR agent (e.g., anti-NMU antibody) includes use in combination with another therapeutic agent (e.g., another agent for preventing or treating diabetes, preventing, controlling, or treating obesity, preventing or treating a cancer such as PDAC, and the like). Therapeutic formulations comprising an anti-NMU/NMUR agent (e.g., an anti-NMU antibody) can be prepared by mixing the agent(s) having the desired degree of purity with a physiologically acceptable carrier, a pharmaceutically acceptable salt, an excipient, and/or a stabilizer (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)) (e.g., in the form of lyophilized formulations or aqueous solutions). A composition having an anti-NMU/NMUR agent (e.g., an anti-NMU antibody) can be formulated, dosed, and administered in a fashion consistent with good medical practice. Factors for consideration in this context include the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners.
[0160] Pharmaceutically acceptable excipient means an excipient that is useful in preparing a pharmaceutical composition that is generally safe, non-toxic, and desirable, and includes excipients that are acceptable for veterinary use as well as for human pharmaceutical use. Such excipients can be solid, liquid, semisolid, or, in the case of an aerosol composition, gaseous.
[0161] Pharmaceutically acceptable salts and esters means salts and esters that are pharmaceutically acceptable and have the desired pharmacological properties. Such salts include salts that can be formed where acidic protons present in the compounds are capable of reacting with inorganic or organic bases. Suitable inorganic salts include those formed with the alkali metals, e.g. sodium and potassium, magnesium, calcium, and aluminum. Suitable organic salts include those formed with organic bases such as the amine bases, e.g., ethanolamine, diethanolamine, triethanolamine, tromethamine, N-methylglucamine, and the like. Such salts also include acid addition salts formed with inorganic acids (e.g., hydrochloric and hydrobromic acids) and organic acids (e.g., acetic acid, citric acid, maleic acid, and the alkane- and arene-sulfonic acids such as methanesulfonic acid and benzenesulfonic acid). Pharmaceutically acceptable esters include esters formed from carboxy, sulfonyloxy, and phosphonoxy groups present in the compounds, e.g., C.sub.1-6 alkyl esters. When there are two acidic groups present, a pharmaceutically acceptable salt or ester can be a mono-acid-mono-salt or ester or a di-salt or ester; and similarly where there are more than two acidic groups present, some or all of such groups can be salified or esterified. Compounds named in this invention can be present in unsalified or unesterified form, or in salified and/or esterified form, and the naming of such compounds is intended to include both the original (unsalified and unesterified) compound and its pharmaceutically acceptable salts and esters.
[0162] The terms pharmaceutically acceptable, physiologically tolerable and grammatical variations thereof, as they refer to compositions, carriers, diluents and reagents, are used interchangeably and represent that the materials are capable of administration to or upon a human without the production of undesirable physiological effects to a degree that would prohibit administration of the composition.
[0163] Dosage unit refers to physically discrete units suited as unitary dosages for the particular individual to be treated. Each unit can contain a predetermined quantity of active compound(s) calculated to produce the desired therapeutic effect(s) in association with the required pharmaceutical carrier. The specification for the dosage unit forms can be dictated by (a) the unique characteristics of the active compound(s) and the particular therapeutic effect(s) to be achieved, and (b) the limitations inherent in the art of compounding such active compound(s).
[0164] The terms treatment, treating, treat and the like are used herein to generally refer to obtaining a desired pharmacologic and/or physiologic effect. The effect can be prophylactic in terms of completely or partially preventing a disease or symptom(s) thereof and/or may be therapeutic in terms of a partial or complete stabilization or cure for a disease and/or adverse effect attributable to the disease. The term treatment encompasses any treatment of a disease in a mammal, particularly a human, and includes: (a) preventing the disease and/or symptom(s) from occurring in a subject who may be predisposed to the disease or symptom but has not yet been diagnosed as having it; (b) inhibiting the disease and/or symptom(s), i.e., arresting their development; or (c) relieving the disease symptom(s), i.e., causing regression of the disease and/or symptom(s). Those in need of treatment include those already inflicted (e.g., those with obesity, diabetes, pancreatic cancer, PDAC, etc.) as well as those in which prevention is desired (e.g., those with increased susceptibility to diabetes and/or cancer such as PDAC, etc.).
[0165] A therapeutic treatment is one in which the subject is inflicted (e.g., has the disease) prior to administration and a prophylactic treatment is one in which the subject is not yet inflicted (does not yet have the disease) prior to administration. In some embodiments, the subject has an increased likelihood of becoming inflicted or is suspected of being inflicted prior to treatment. In some embodiments, the subject is suspected of having an increased likelihood of becoming inflicted. For example, in some cases, the individual is obese, has a family history of obesity and/or diabetes, has a family history of pancreatic cancer such as PDAC, etc.
[0166] A therapeutically effective dose or therapeutic dose is an amount sufficient to effect desired clinical results (i.e., achieve therapeutic efficacy), e.g., increased insulin output. A therapeutically effective dose can be administered in one or more administrations. For purposes of this disclosure, a therapeutically effective dose of an anti-NMU/NMUR agent (e.g., an anti-NMU antibody) is an amount that is sufficient to palliate, ameliorate, stabilize, reverse, prevent, slow or delay the progression of the disease state (e.g., diabetes, obesity, PDAC). Thus, in some cases, a therapeutically effective dose of an anti-NMU/NMUR agent (e.g., an anti-NMU antibody) reduces the binding of circulating NMU to its receptor on the surface of cells at an effective dose for increasing insulin output in an individual.
[0167] A single therapeutically effective dose or a series of therapeutically effective doses would be able to achieve a desired result in an individual (e.g., increase circulating level of insulin). A therapeutically effective dose of an anti-NMU/NMUR agent (e.g., an anti-NMU antibody) can depend on the specific agent used, and in some cases can be 0.5 mg/kg body weight or more (e.g., 1 mg/kg or more, 2 mg/kg or more, 3 mg/kg or more, 4 mg/kg or more, 5 mg/kg or more, 6 mg/kg or more, 7 mg/kg or more, 8 mg/kg or more, 9 mg/kg or more, 10 mg/kg or more, 15 mg/kg or more, 20 mg/kg or more, 25 mg/kg or more, 30 mg/kg or more, 35 mg/kg or more, or 40 mg/kg or more) for each agent.
[0168] In some cases, a therapeutically effective dose of an anti-NMU/NMUR agent (e.g., an anti-NMU antibody) can be in a range of from 0.5 mg/kg to 100 mg/kg (e.g., from 0.5 to 90 mg/kg, from 0.5 to 90 mg/kg, from 0.5 to 80 mg/kg, from 0.5 to 70 mg/kg, from 0.5 to 60 mg/kg, from 0.5 to 50 mg/kg, from 0.5 to 40 mg/kg, from 0.5 to 30 mg/kg, from 0.5 to 20 mg/kg, from 0.5 to 10 mg/kg, from 1 to 100 mg/kg, from 1 to 90 mg/kg, from 1 to 90 mg/kg, from 1 to 80 mg/kg, from 1 to 70 mg/kg, from 1 to 60 mg/kg, from 1 to 50 mg/kg, from 1 to 40 mg/kg, from 1 to 30 mg/kg, from 1 to 20 mg/kg, from 1 to 10 mg/kg, from 3 to 100 mg/kg, from 3 to 90 mg/kg, from 3 to 90 mg/kg, from 3 to 80 mg/kg, from 3 to 70 mg/kg, from 3 to 60 mg/kg, from 3 to 50 mg/kg, from 3 to 40 mg/kg, from 3 to 30 mg/kg, from 3 to 20 mg/kg, from 3 to 10 mg/kg, from 5 to 100 mg/kg, from 5 to 90 mg/kg, from 5 to 90 mg/kg, from 5 to 80 mg/kg, from 5 to 70 mg/kg, from 5 to 60 mg/kg, from 5 to 50 mg/kg, from 5 to 40 mg/kg, from 5 to 30 mg/kg, from 5 to 20 mg/kg, from 5 to 10 mg/kg, from 10 to 100 mg/kg, from 10 to 90 mg/kg, from 10 to 90 mg/kg, from 10 to 80 mg/kg, from 10 to 70 mg/kg, from 10 to 60 mg/kg, from 10 to 50 mg/kg, from 10 to 40 mg/kg, from 10 to 30 mg/kg, from 10 to 20 mg/kg, from 20 to 100 mg/kg, from 20 to 90 mg/kg, from 20 to 90 mg/kg, from 20 to 80 mg/kg, from 20 to 70 mg/kg, from 20 to 60 mg/kg, from 20 to 50 mg/kg, from 20 to 40 mg/kg, or from 20 to 30 mg/kg) for each agent.
[0169] In some cases, a therapeutically effective dose of an anti-NMU/NMUR agent (e.g., an anti-NMU antibody) can be in a range of from 5 mg/kg to 50 mg/kg (e.g., from 5 to 40 mg/kg, from 5 to 30 mg/kg, from 5 to 20 mg/kg, from 10 to 50 mg/kg, from 10 to 40 mg/kg, from 10 to 30 mg/kg, or from 10 to 20 mg/kg) for each agent. In some cases, a therapeutically effective dose of an anti-NMU/NMUR agent (e.g., an anti-NMU antibody) can be in a range of from 10 mg/kg to 40 mg/kg (e.g., from 10 to 35 mg/kg, or from 10 to 30 mg/kg) for each agent.
[0170] The dose required to achieve a desired result can be proportional to the amount of time between doses and inversely proportional to the number of doses administered. Thus, as the frequency of dosing increases, the required dose decreases. The optimization of dosing strategies will be readily understood and practiced by one of ordinary skill in the art.
[0171] Dosage and frequency may vary depending on the half-life of the anti-NMU/NMUR agent (e.g., an anti-NMU antibody) in the patient. It will be understood by one of skill in the art that such guidelines will be adjusted for the molecular weight of the active agent, e.g. in the use of antibody fragments, in the use of antibody conjugates, in the use of RNAi agents, etc. The dosage may also be varied for localized administration, e.g. intranasal, inhalation, etc., or for systemic administration, e.g. i.m., i.p., i.v., and the like.
Co-Administration
[0172] Two of the above described anti-NMU antibodies can be co-administered, and antibody-based NMU inhibition could be readily combined with standard therapies for diseases like obesity and diabetes. As such, in some cases, a subject anti-NMU/NMUR agent (e.g., an anti-NMU antibody) is co-administered with another agent, e.g., a second anti-NMU/NMUR agent, or co-administered with another therapy for obesity and/or diabetes. The terms co-administration, co-administer, and in combination with include the administration of two or more therapeutic agents (e.g., two or more anti-NMU/NMUR agents such as two different anti-NMU antibodies, an anti-NMU antibody and an RNAi agent that targets NMUR1, an anti-NMU/NMUR agent and an agent for treating diabetes, etc.) either simultaneously, concurrently or sequentially within no specific time limits. In one embodiment, the agents are present in the cell or in the subject's body (in their blood stream) at the same time or exert their biological or therapeutic effect at the same time. In one embodiment, the therapeutic agents are in the same composition or unit dosage form. In other embodiments, the therapeutic agents are in separate compositions or unit dosage forms. In certain embodiments, a first agent can be administered prior to (e.g., minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks before), concomitantly with, or subsequent to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after) the administration of a second therapeutic agent.
[0173] In some cases, a subject an anti-NMU/NMUR agent (e.g., an anti-NMU antibody) (e.g., formulated as a pharmaceutical composition) is co-administered with a obesity and/or diabetes therapeutic drug, a therapeutic drug to treat a cancer such as PDAC, and the like. Such administration may involve concurrent (i.e. at the same time), prior, or subsequent administration of the drug/antibody with respect to the administration of an agent or agents of the disclosure. A person of ordinary skill in the art would have no difficulty determining the appropriate timing, sequence and dosages of administration for particular drugs and compositions of the present disclosure.
[0174] An anti-NMU/NMUR agent (e.g., an anti-NMU antibody) need not be, but is optionally formulated with one or more agents that potentiate activity, or that otherwise increase the therapeutic effect. These are generally used in the same dosages and with administration routes as used herein or from 1 to 99% of the employed dosages. In some embodiments, treatment is accomplished by administering a combination (co-administration) of a subject anti-NMU/NMUR agent and an agent that treats obesity. In some embodiments, treatment is accomplished by administering a combination (co-administration) of a subject anti-NMU/NMUR agent and an agent that treats diabetes. In some embodiments, treatment is accomplished by administering a combination (co-administration) of a subject anti-NMU/NMUR agent and an agent that treats a cancer such as PADC. Thus, also envisioned herein are compositions (and methods that use the compositions) that include: (a) an anti-NMU/NMUR agent (e.g., an anti-NMU antibody); and (b) at least one of: (i) an agent used for treatment of diabetes, (ii) an agent used for treatment of obesity, and (iii) an agent used for treatment of cancer, e.g., PDAC.
Delivery
[0175] An anti-NMU/NMUR agent (e.g., an anti-NMU antibody) can be administered by any suitable means (e.g., systemic or local), including topical, oral, parenteral, intravenous, intrapulmonary, and intranasal. Parenteral infusions include intramuscular, intravenous (bollus or slow drip), intraarterial, intraperitoneal, intrathecal or subcutaneous administration. An anti-NMU/NMUR agent (e.g., an anti-NMU antibody) can be administered in any manner which is medically acceptable. This may include injections (e.g., by parenteral routes such as intravenous, intravascular, intraarterial, subcutaneous, intramuscular, intratumor, intraperitoneal, intraventricular, or intraepidural), or others as well as oral, nasal, ophthalmic, rectal, or topical. Sustained release administration is also specifically included in the disclosure, by such means as depot injections or erodible implants.
[0176] As noted above, an anti-NMU/NMUR agent (e.g., an anti-NMU antibody) can be formulated with a pharmaceutically acceptable carrier (one or more organic or inorganic ingredients, natural or synthetic, with which a subject agent is combined to facilitate its application). A suitable carrier includes sterile saline although other aqueous and non-aqueous isotonic sterile solutions and sterile suspensions known to be pharmaceutically acceptable are known to those of ordinary skill in the art. An effective amount refers to that amount which is capable of ameliorating or delaying progression of the diseased, degenerative or damaged condition. In some cases, an effective amount is an amount that brings about a rise in circulating insulin levels in the individual. An effective amount can be determined on an individual basis and will be based, in part, on consideration of the symptoms to be treated and results sought. An effective amount can be determined by one of ordinary skill in the art employing such factors and using no more than routine experimentation.
[0177] An anti-NMU/NMUR agent (e.g., an anti-NMU antibody) is often administered as a pharmaceutical composition comprising an active therapeutic agent and another pharmaceutically acceptable excipient. The preferred form depends on the intended mode of administration and therapeutic application. The compositions can also include, depending on the formulation desired, pharmaceutically-acceptable, non-toxic carriers or diluents, which are defined as vehicles commonly used to formulate pharmaceutical compositions for animal or human administration. The diluent is selected so as not to affect the biological activity of the combination. Examples of such diluents are distilled water, physiological phosphate-buffered saline, Ringer's solutions, dextrose solution, and Hank's solution. In addition, the pharmaceutical composition or formulation may also include other carriers, adjuvants, or nontoxic, nontherapeutic, nonimmunogenic stabilizers and the like.
[0178] In some embodiments, pharmaceutical compositions can also include large, slowly metabolized macromolecules such as proteins, polysaccharides such as chitosan, polylactic acids, polyglycolic acids and copolymers (such as latex functionalized Sepharose, agarose, cellulose, and the like), polymeric amino acids, amino acid copolymers, and lipid aggregates (such as oil droplets or liposomes).
[0179] A carrier may bear the agents in a variety of ways, including covalent bonding either directly or via a linker group, and non-covalent associations. Suitable covalent-bond carriers include proteins such as albumins, peptides, and polysaccharides such as aminodextran, each of which have multiple sites for the attachment of moieties. A carrier may also bear an anti-NMU/NMUR agent (e.g., an anti-NMU antibody) by non-covalent associations, such as non-covalent bonding or by encapsulation. The nature of the carrier can be either soluble or insoluble for purposes of the disclosure. Those skilled in the art will know of other suitable carriers for binding anti-NMU/NMUR agents (e.g., one or more anti-NMU antibodies), or will be able to ascertain such, using routine experimentation.
[0180] Acceptable carriers, excipients, or stabilizers are non-toxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyidimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g., Zn-protein complexes); and/or non-ionic surfactants such as TWEEN, PLURONICS or polyethylene glycol (PEG). Formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes.
[0181] The active ingredients may also be entrapped in microcapsule prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsule and poly-(methylmethacylate) microcapsule, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions. Such techniques are disclosed in Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980).
[0182] Compositions can be prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection can also be prepared. The preparation also can be emulsified or encapsulated in liposomes or micro particles such as polylactide, polyglycolide, or copolymer for enhanced adjuvant effect, as discussed above. Langer, Science 249: 1527, 1990 and Hanes, Advanced Drug Delivery Reviews 28: 97-119, 1997. The agents of this invention can be administered in the form of a depot injection or implant preparation which can be formulated in such a manner as to permit a sustained or pulsatile release of the active ingredient. The pharmaceutical compositions are generally formulated as sterile, substantially isotonic and in full compliance with all Good Manufacturing Practice (GMP) regulations of the U.S. Food and Drug Administration.
[0183] Toxicity of the anti-NMU/NMUR agents (e.g., one or more anti-NMU antibodies) can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., by determining the LD.sub.50 (the dose lethal to 50% of the population) or the LD.sub.100 (the dose lethal to 100% of the population). The dose ratio between toxic and therapeutic effect is the therapeutic index. The data obtained from these cell culture assays and animal studies can be used in further optimizing and/or defining a therapeutic dosage range and/or a sub-therapeutic dosage range (e.g., for use in humans). The exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patients condition.
[0184] In some cases, a method treating an individual (e.g., one who is obese and/or has diabetes), includes, as described elsewhere herein, predicting whether an individual will benefit from such treatment (e.g., measuring an expression level of NMU, such as NMU protein in a biological sample such as serum from the individual, and determining whether the individual will benefit, where those with an increased NMU level, e.g., relative to a reference value, will benefit).
Evaluation Steps (Verify/Evaluate/Monitor Steps)
[0185] In addition to increasing insulin output, administration of a subject anti-NMU antibody can enhance output of crucial incretin hormones like glucagon-like peptide-1 (GLP-1) and gastric inhibitory peptide (GIP), further enhancing glucose regulation. Thus, in some cases, a subject method is a method of increasing GLP-1 and/or GIP; decreasing glucagon; and/or decreasing glucose level(s).
[0186] In some cases, a subject method (e.g. a treatment method) includes, after administration of an anti-NMU/NMUR agent to an individual (e.g., an anti-NMU antibody), a step of measuring one or more features of the individual (e.g., to verify that the agent produces a desired outcome). Suitable features that can be measured include, but are not limited to: insulin level (e.g., an amount of circulating insulin); blood glucose level; an expression level of GLP-1 (e.g., GLP-1 protein) and/or GIP (e.g., GIP protein); glucagon level; glucose tolerance; body fat mass; patient weight; a response to an overnight fast; a meal tolerance test (MTT); and the like. In some cases, such measurements can be made after a provocation (e.g., an overnight fast; a glucose challenge, a meal tolerance test (MTT), etc.).
[0187] In some cases, a subject method (e.g., a method of predicting, a treatment method, etc.) includes a step of measuring one or more of: insulin level (e.g., an amount of circulating insulin); blood glucose level; an expression level of GLP-1 (e.g., GLP-1 protein) and/or GIP (e.g., GIP protein); glucagon level; glucose tolerance; body fat mass; patient weight; a response to an overnight fast; a meal tolerance test (MTT); and the like. In some cases, such measuring can be used as an evaluation/monitoring step to test whether a treatment method (e.g., a method that includes administration of an anti-NMU/NMUR agent such as an anti-NMU antibody or fragment thereof) has produced the desired outcome. In some cases, such measurements can be made after a provocation (e.g., an overnight fast; a glucose challenge, a meal tolerance test (MTT), etc.).
[0188] In some cases, such measuring can be used as part of a prediction method (e.g., a method of predicting whether an individual will develop Diabetes, PDAC, and/or pancreatitis; a method of identifying an individual that would benefit from therapy with an anti-NMU/NMUR agent; etc.). For example, one can take into account an amount of measured NMU as well as an amount of measured insulin, glucagon, GLP-1, GIP, and/or glucose when formulating a prediction. In some cases, such measurements can be made after a provocation (e.g., an overnight fast; a glucose challenge, a meal tolerance test (MTT), etc.).
[0189] The invention now being fully described, it will be apparent to one of ordinary skill in the art that various changes and modifications can be made without departing from the spirit or scope of the invention.
Experimental
[0190] The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the present invention, and are not intended to limit the scope of what the inventors regard as their invention nor are they intended to represent that the experiments below are all or the only experiments performed. Efforts have been made to ensure accuracy with respect to numbers used (e.g. amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, molecular weight is weight average molecular weight, temperature is in degrees Centigrade, and pressure is at or near atmospheric.
[0191] All publications and patent applications cited in this specification are herein incorporated by reference as if each individual publication or patent application were specifically and individually indicated to be incorporated by reference.
[0192] The present invention has been described in terms of particular embodiments found or proposed by the present inventor to comprise preferred modes for the practice of the invention. It will be appreciated by those of skill in the art that, in light of the present disclosure, numerous modifications and changes can be made in the particular embodiments exemplified without departing from the intended scope of the invention. For example, due to codon redundancy, changes can be made in the underlying DNA sequence without affecting the protein sequence. Moreover, due to biological functional equivalency considerations, changes can be made in protein structure without affecting the biological action in kind or amount. All such modifications are intended to be included within the scope of the appended claims.
EXAMPLES
Example 1: Two-Way ELISA
[0193] A two-way enzyme-linked immunosorption assay (ELISA) was built to measure either human or mouse neuromedin U (NMU) using two newly made monoclonal antibodies (C578 and 2A16). Mouse hybridoma lines were generated that secrete monoclonal antibodies that bind human NMU. These antibodies were used to build the two-way ELISA, one for NMU capture and a separate one for detection. This assay permitted fast and sensitive detection directly from human serum or plasma.
[0194] Human NMU is a 25 amino acid hormone encoded by the gene NMU and produced from a processed pre-prohormone (Mitchell et al., Br J Pharmacol. 2009 September; 158(1):87-103). NMU is produced in the gastrointestinal tract of humans and other mammals like mice. NMU has no known covalent modifications other than C-terminal amidation (a common feature of circulating peptide hormones), and the newly generated antibodies (C578 and 2A16) were generated against a bioactive form of circulating NMU. Two mouse hybridoma lines (C578 and 2A16) producing monoclonal antibodies that bind NMU at picomolar affinity were generated, and CDR sequences were obtained from these cells (e.g., to produce humanized versions of the antibodies) (See
[0195] NMU potently suppresses pancreatic islet secretion of insulin and also suppresses gastrointestinal secretion of the incretin hormones GLP-1 and GIP. NMU also stimulates secretion of the islet hormone glucagon. Insulin, incretins and glucagon are each fundamental regulators of metabolism in humans. Thus, identifying NMU functions in metabolism and gastrointestinal physiology was focused on. This has led to the discovery that NMU levels are consistently elevated in metabolic disorders like obesity and diabetes (e.g., see data presented in the other examples below). The two way-ELISA assay for measuring human NMU disclosed herein has revealed increased circulating NMU levels in pathological states like obesity and pancreas cancer in humans (e.g., see examples below). This two-way ELISA provides several clear advantages over existing technology, which use a one-way competitive ELISA requiring NMU binding to a single capture antibody, competition with a prefabricated NMU standard linked to biotin, and subsequent detection of biotin with avidin-conjugated peroxidase. The one-way competitive ELISA takes a longer assay time (>5 hours) and requires sample concentration steps that introduce significant variability. Moreover, the currently available assay fails to measure NMU in serum samples. Thus, it has been (erroneously) reported previously that NMU does not circulate (Mitchell et al., Br J Pharmacol. 2009 September; 158(1):87-103).
Obesity and Type 2 Diabetes Mellitus
[0196] Consistent with NMU signaling suppressing insulin output in vivo, compensatory increases of insulin and GLP-1 were found in mice with diet-induced obesity (DIO) or genetic insulin resistance (mutant db/db mice), and were accompanied by reduced serum NMU levels. However, with advancing age, these mice develop a well-recognized but poorly-understood beta-cell failure, accompanied by reduced insulin secretion, reduced serum insulin levels and impaired glucose control. These changes were strikingly accompanied by increased serum NMU levels. Glucose intolerance was eliminated and insulin output enhanced in these older obese mice with NMU antibody injection, or by genetic NMU signaling blockade.
[0197] These findings identify obesity as a pathological state accompanied by NMU excess, are supported by the finding that serum NMU levels were increased in obese humans (
[0198] Other common but poorly understood human disease states may reflect NMU excess, including diabetes in lean subjects (as observed in Asians, the elderly, and chronic pancreatitis), or refractory hyperglycemia after bariatric surgery. Thus, prospective measures of NMU levels and regulation may permit a new kind of disease stratification, and identify patient subsets who may be responsive to targeted NMU signaling attenuation using agents like NMU-neutralizing antibodies.
[0199] Antibody-based reduction of NMU signaling has possible therapeutic applications in a potentially large group of subjects with excessive systemic NMU signaling or levels. Our studies show NMU elevation in (1) patients with pre-diabetes states like obesity or with established diabetes, (2) patients recognized to have lean diabetes, including subjects with advanced age (>60 y.o.), exocrine pancreas diseases like cystic fibrosis, familial or idiopathic pancreatitis, or the recently recognized type 3c diabetes mellitus, (3) patients with advanced cancer states, like late stage pancreatic cancer and a debilitating complication called cancer cachexia.
Chronic Pancreatitis, Type 3c Diabetes Mellitus and Cancer
[0200] Epidemiological studies show that chronic pancreatitis is linked to increased risk of diabetes mellitus and pancreas cancer. Using archived human samples, we have now discovered that NMU is mis-produced in areas of cell metaplasia in a subset of human pancreatitis (without detectable adenocarcinoma), and that serum levels of NMU are elevated in pancreatitis and significantly further elevated in PDAC (e.g., see examples below). Thus, NMU production can be used as a biological marker of cell metaplasia (pre-cancer) and diabetes risk in the pancreas. Because NMU both circulates and has biological activity (suppresses insulin and incretin secretion, promotes glucagon secretion), NMU excess in pancreatitis, or early stage pancreas cancer could promote a form of diabetes called type 3c. Thus, NMU may be a long-sought molecular link between diabetes and pancreas cancer.
Two-Way ELISA
[0201] Using the two-way ELISA disclosed herein, mouse Nmu and human NMU were detected in a range of from 0.1 to 20 ng/mL. Serum NMU levels were increased in humans with increasing BMI (
Example 2
[0202]
[0203] neuromedin U (NMU) is the mammalian ortholog of limostatin, a starvation-induced peptide hormone identified in the fruit fly Drosophila. NMU is an enteroendocrine hormone that regulates human insulin output by acting through its receptor, NMUR1, expressed on pancreatic beta-cells (Alfa et al., Cell Metab. 2015 Feb. 3; 21(2):323-33). Consistent with this view, while circulating glucose (
[0204]
[0205] Human serum insulin levels rise rapidly by 30 minutes after oral glucose challenge, then fall over the ensuing 150 minutes (
[0206]
[0207] After prolonged fasting, refeeding has been shown to lead to starvation diabetes as was observed in fasted humans (
[0208]
[0209] Obese and pre-diabetic human subjects often develop relative insulin deficiency and glucose intolerance. Given the data presented here from mice and humans that correlate NMU with reduced insulin excursion, it was hypothesized that NMU might be dysregulated in obesity and pre-diabetic states associated with glucose intolerance. Serum NMU levels were increased in obese humans (
[0210]
[0211] Null mutant mice lacking NMUR1 were more prone to gain weight when fed a high-fat diet compared to wild type mice (
[0212]
[0213] The increased circulating levels of NMU observed in mice during fasting were reproduced with a single intraperitoneal dose of NMU (
[0214]
[0215] In NmuR1 null mutant mice, NMU inhibition of glucose-induced GLP1 and GIP output was lost in vivo (
[0216]
[0217] Increased plasma NMU in mice lowered basal insulinemia (
[0218]
[0219] A single injection of NMU impaired insulin excursion in response to a meal challenge and led to hyperglycemia over 120 minutes. Co-injection with an anti-NMU monoclonal antibody that binds to a region common to mouse and human NMU (antibody C578, see
[0220]
[0221] CDR sequences were obtained from both light and heavy chains of newly generated anti-NMU antibodies (2A16, C578) that bind to human NMU (C578 binds to both human and mouse NMU).
Example 3 Neuromedin Signaling Basis of Diabetes in Chronic Pancreatitis and Pancreatic Ductal Adenocarcinoma
Investigating the Neuromedin Signaling Basis of Diabetes in Chronic Pancreatitis and Pancreatic Ductal Adenocarcinoma
[0222] Neuromedin U (NMU) is a peptide hormone produced by enteroendocrine cells and CNS neurons. In pre-clinical studies, NMU is a potent suppressor of insulin secretion by human islets. NMU also suppresses secretion of the incretin hormone GLP-1. The data and investigations provided herein demonstrate that NMU is mis-expressed in the pancreas in humans with chronic pancreatitis, and established pancreatic ductal adenocarcinoma, and that serum NMU levels are elevated in subsets of subjects with PDAC or pancreatitis. Thus, ectopic pancreatic NMU may promote pancreatogenic diabetes mellitus (T3cDM) and serum NMU levels can be a biomarker of chronic pancreatitis, pancreatic metaplasia or neoplasia.
Nmu is a Hormone that Suppresses Insulin Secretion by Pancreatic Islets
[0223] A secreted hormone, Limostatin (Lst), suppresses insulin secretion and production following starvation in Drosophila (Alfa et. al., Cell Metab. 2015 Feb. 3; 21(2):323-33). Lst is produced and secreted by fly corpora cardiaca cells, best known as cells that also secrete adipokinetic hormone (AKH), a functional orthologues of glucagon. Many neuropeptides signal through G protein-coupled receptors. All known orphan GPCRs were screened in Drosophila and Computed Gene #9918 (CG9918) was identified as a GPCR expressed in IPCs that negatively regulates insulin expression and secretion in the adult fly. Pharmacogenetic findings indicated that Lst regulates insulin secretion directly in IPCs, and support the view that CG9918 encodes a Lst receptor. The transmembrane domains encoded by the fly Lst receptor have highest sequence homology to the mammalian neuromedin U receptor 1 (NmuR1). Nmu encodes a pre-prohormone expressed in the brain (including hypothalamic nuclei) and in peripheral organs, including abundant expression in gastrointestinal organs. Thus, mouse NMU and human NMU production in gastrointestinal organs was assessed. In humans, NMU immunoreactivity was localized to scattered enteroendocrine cells that co-expressed Chromogranin B and were distributed in the gastrointestinal tract, prominently in stomach pyloric mucosa, duodenum and ileum (
[0224] In humans and other mammals, peripheral effects of Nmu are mediated by NmuR1, while NmuR2 is primarily expressed in the CNS. mRNA encoding NmuR1 but not NmuR2 was readily detected by qPCR and in situ hybridization in isolated human and mouse islet -cells. NmuR1 production was restricted to insulin.sup.+ cells (
Nmu Infusion In Vivo Regulates Insulin, GLP-1 and Glucagon Output, and Glucose Tolerance
[0225] The ability to measure serum NMU protein in mice (e.g., using the two-way ELISA disclosed in herein) permitted studies to investigate the impact of in vivo NMU infusion on crucial regulators of metabolism like insulin and glucagon. It was confirmed that a simple schedule of daily infusion by intraperitoneal injection led to a two-fold increase of mean serum NMU levels (
NMU Protein is Mis-Expressed in Human Chronic Pancreatitis and PDAC
[0226] NMU protein is not detectable in human pancreatic duct, acinar or islet cells of subjects without known pancreatic diseases, and using immunohistology no NMU was detected in islets, ducts or acinar cells of pancreas tissue from such donors (
[0227] NMU is not normally detected in human islets. Surprisingly, in a subset of islets adjacent to areas of obvious neoplasia in both PDAC cases, NMU immunostaining was observed in islet cells. Co-labelling with antibodies specific for NMU, Insulin and Glucagon demonstrated that Glucagon.sup.+ cells (but not Insulin.sup.+ cells) mis-expressed NMU (
Meta-Analysis of NMU mRNA Expression in PDAC
[0228] To assess whether NMU mRNA levels are elevated in PDAC existing genome-scale expression profiles from human PDAC were analyzed. Briefly, meta-analysis approaches were used to assess data sets from a total of 264 PDAC and 91 normal expression profiles normalized using gcRMA (Khatri et al, Ann Intern Med. 2013 Jan. 1; 158(1):35-46; Chen et al., Cancer Res. 2014 May 15; 74(10):2892-902). Hedges' adjusted g test was used for each gene to combined effect sizes (black squares) from each dataset into a pooled effect size (yellow diamond) to estimate the amount of change in expression across all datasets. A pooled effect size and standard error were obtained by combining effect sizes from each dataset using the random effects inverse-variance technique. P value was computed from the z-statistics, and adjusted using the Benjamini Hochberg method. This revealed a significant increase of mRNA encoding NMU in this sampling (P<10.sup.7), but not mRNA encoding neuromedin B (NMB:
NMU ELISAs Reveal Elevated NMU Levels in PDAC Associated with Reduced BMI and Cachexia
[0229] ELISAs for mouse and human NMU are sold commercially, but have significant limitations. In fact, prior reports claim that NMU was undetectable in rodent serum, leading to the incorrect conclusion that NMU chiefly functions as a paracrine signal (Mitchell et al., Br J Pharmacol. 2009 September; 158(1):87-103). In the competitive one-way assays, blood and other biological samples require purification and lyophilization of >1 milliliter of serum to reduce the impact of endogenous biotinylated macromolecules, and this concentration step introduces significant variation or irreproducibility. In another set of two-way ELISAs, the immunogen was pre-proNMU and these kits do not detect processed bioactive human NMU in serum. To overcome this, a new 2-way ELISA assay was built with novel monoclonal antibodies. This has significantly improved assay reproducibility, and permits use of 10 microliters of serum, without a concentration step. Mouse NMU protein and human NMU protein can now be detected at 0.1 to 20 ng/mL (
[0230] With this new human ELISA serum NMU was measured in control subjects without cancer or with advanced pancreatic ductal adenocarcinoma (PDAC). In controls without known pancreatic disease or T2DM (type 2 diabetes), NMU levels increased with BMI, an association that was statistically significant (
Evidence for Increased Serum NMU Levels in Subjects with Chronic Pancreatitis
[0231] The studies presented here related to gene expression and NMU protein production in pancreatitis suggested that serum levels of NMU might be detectably increased in this setting. To test this, feasibility studies of patients with acute and chronic pancreatitis were performed. Clear trends were observed indicating that the mean serum levels of NMU were increased in subjects with chronic pancreatitis (and pancreatic cancer), compared to those with acute pancreatitis or control subjects without exocrine pancreas disease (
[0232] An interesting link of these findings comes from the observation that production of cytokines like IL-6 in macrophages is regulated by NMU. Thus, a pro-inflammatory role for NMU is implicated via its ability to induce synthesis and release of Th2 cytokines. Studies in mice suggest that Th2 cytokines and IL-4R signaling activates pancreatic stellate cells, promoting the characteristic fibrogenesis observed in chronic pancreatitis progression. These results are substantiated by findings from human ex-vivo co-cultures of PSCs and macrophages. Thus ectopic expression of NMU in chronic pancreatitis and PDAC (
[0233] The investigations of NMU signaling presented herein suggest (1) that circulating NMU regulates a physiological signaling pathway that controls insulin and GLP-1 output in vivo (
Example 4
[0234] Mouse Nmu is produced in enteroendocrine cells in the stomach, duodenum, ileum and colon, while NmuR1 is expressed in islet -cells. Based on the findings presented in this disclosure, we suggest that enteroendocrine Nmu serves as a crucial nexus between nutrient status, the gastrointestinal tract, and islet hormones to control metabolism. We suggested that Nmu signaling from gut to pancreas islets constitutes a new, physiologically important inter-organ signaling axis regulating mammalian metabolism.
[0235] Nmu is produced both in the CNS and peripheral tissues, particularly in the gastrointestinal tract. Nmu inhibits pancreatic insulin secretion. Nmu receptor1 (NmuR1) is a G protein-coupled receptor expressed in mouse and human islet -cells. Factors that regulate -cell insulin secretion, including the hormones somatostatin and galanin, and pertussis toxin, require the inhibitory G-protein G.sub.o2 for proper secretory regulation. Mutations in human NMU are linked to hyperinsulinemia and obesity.
[0236] Starvation and feeding are potent selective forces, and hormonal responses to maintain metabolic balance in the face of nutrient restriction or abundance appear to be highly conserved in all animals. In mammals, powerful mechanisms potentiate insulin-secreting cell responses to the incoming glucose load before glucose levels rise. For example, incretin hormones such as glucagon-like peptide-1 (GLP-1) are secreted by enteroendocrine cells following a meal, and enhance glucose-stimulated insulin production and secretion from pancreatic cells.
[0237] Prior to the work described in this disclosure, an enteroendocrine hormone induced by fasting that decreases insulin output (a decretin) had not been identified. Loss of such a hormone has been postulated as one basis for the rapid resolution of diabetes phenotypes in obese patients following gastric bypass surgery (Rubino et al 2009), an increasingly common intervention.
Nmu is Functional and Inhibits Insulin Secretion by Pancreatic Islets
[0238] The transmembrane domains encoded by CG9918 have highest sequence homology to the mammalian Neuromedin U receptor 1 (NmuR1). Nmu encodes a pre-prohormone expressed in the brain (including hypothalamic nuclei) and in peripheral organs, including abundant expression in gastrointestinal organs. In mice, Nmu is a 23 amino acid peptide (Nmu-23); in human NMU is 25 amino acids (NMU-25). Mouse Nmu and human NMU production was assessed in gastrointestinal organs. In humans, NMU immunoreactivity was localized to scattered enteroendocrine cells that co-expressed Chromogranin B with a typical open type morphology, and were distributed in the gastrointestinal tract, prominently in stomach pyloric mucosa, duodenum and ileum (
[0239] In humans and other mammals, peripheral effects of Nmu are mediated by NmuR1, while NmuR2 is primarily expressed in the CNS. mRNA encoding NmuR1 but not NmuR2 is readily detected by RNA-Seq, qPCR and in situ hybridization in isolated human and mouse islet -cells, albeit at low levels (
[0240] Commercially-available ELISA assays have not previously achieved reliable measures of circulating NMU in mouse or human serum; hence it was not clear that NMU was a bona fide endocrine hormone. To address this deficit, new 2-way ELISAs with newly generated monoclonal antibodies were built to measure NMU in these species. This new setup allows the use only 1-2 microliters of serum, without a hydrophobic-resin column concentration step. The new ELISAs detect mouse and human NMU in a working range spanning 0.2 to 900 ng/mL (
[0241] To assess whether human serum NMU levels can be detected in more common physiological settings, serum NMU was measured in human subjects stratified by insulin suppression testing. Age- and BMI-matched lean, non-diabetic women were stratified into insulin-resistant (IR: n=14) and insulin-sensitive (IS: n=7) groups on the basis of their steady-state plasma glucose (SSPG) concentration following a 180-minute infusion of octreotide, exogenous insulin, and glucose. Significant elevation of average serum NMU was observed in the IR group (
Nmu Infusion In Vivo Regulates Insulin and Glucagon Output, and Glucose Tolerance
[0242] Identification of the normal range of serum NMU levels in mice guided studies to investigate the impact of physiologically-relevant increases of Nmu-23 after in vivo infusion (n=4). A doubling of NMU levels was detected within 10 minutes after IP infusion in 10 week-old B6J male mice fasted 12 hours (
Efficient Genetic Transduction and Functional Assessment of Primary Human Islet Cells
[0243] Transgenes were expressed in human primary islet cells, by dispersing islets to single cell suspensions, and then reaggregated into clusters. Islet cell clusters after re-aggregation (also called pseudoislets) remained responsive to glucose and other secretion signals like IBMX. After transplantation in mice, pseudoislets vascularized and achieved regulated insulin secretion (
[0244] This system was used to mis-express factors like SIX3, a homeodomain transcription factor related to the Drosophila factor sine oculis. Remarkably, SIX3 expression in 2-year-old human pseudoislets enhanced basal and glucose-stimulated insulin secretion (
NMU Suppression of Insulin Secretion is Eliminated by PTX
[0245] Mouse islets exposed to pertussis toxin (PTX) had robust increases of insulin secretion, both at basal and increased glucose concentrations (
Reconstituting Starvation Diabetes in Mice with Nmu Infusion
[0246] To identify effects of Nmu elevation on metabolism, glycemic and insulin regulation were studied in 10 week-old B6J mice with elevated serum Nmu after fasting. After intraperitoneal glucose tolerance testing (IPGTT) male or female mice fasted 72 hours (except for ad libitum water) had prolonged hyperglycemia compared to matched control mice with IPGTT after 24 hr. fasting (
[0247] Starvation provokes complex cellular and metabolic adaptations including multiple hormone responses. The doubling of circulating Nmu levels in starvation (