ONCOLYTIC RHABDOVIRUS EXPRESSING IL12
20190216868 ยท 2019-07-18
Inventors
Cpc classification
C12N2760/20232
CHEMISTRY; METALLURGY
C07K14/145
CHEMISTRY; METALLURGY
C12N5/10
CHEMISTRY; METALLURGY
A61K9/0019
HUMAN NECESSITIES
C12N2760/20041
CHEMISTRY; METALLURGY
A61K35/768
HUMAN NECESSITIES
C12N2760/20243
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
International classification
A61K9/00
HUMAN NECESSITIES
C12N5/10
CHEMISTRY; METALLURGY
C07K14/145
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
Abstract
Disclosed herein is an oncolytic recombinant Maraba virus whose genome comprises one or more nucleic acid sequences that, in combination, encode an interleukin-12 (IL12) protein or a functional portion thereof. A method for treating a cancer in a patient using the oncolytic recombinant Maraba virus is also disclosed. The present disclosure also provides a tumour cell infected with an oncolytic rhabdovirus whose genome comprises one or more nucleic acid sequences that, in combination, encode an interleukin-12 (IL12) protein or a functional portion thereof, for use as an infected cell vaccine (ICV) for the treatment of a cancer. A method for treating a cancer in a patient using the infected cell vaccine is also disclosed.
Claims
1-46. (canceled)
47. An oncolytic Maraba virus comprising one or more nucleic acid sequences that, alone or in combination, are capable of expressing an interleukin-12 (IL12) protein or a functional portion thereof.
48. The Maraba virus of claim 47, wherein the virus comprises a substitution at amino acid 242 of the wild type G protein.
49. The Maraba virus of claim 48, wherein the amino acid at position 242 is an arginine.
50. The Maraba virus of claim 47, wherein the virus comprises a substitution at amino acid 123 of the wild type M protein.
51. The Maraba virus of claim 50, wherein the amino acid at position 123 is a tryptophan.
52. The Maraba virus of claim 49, wherein the Maraba virus is the MG1 Maraba virus.
53. The Maraba virus of claim 47, wherein the IL12 protein comprises an amino acid sequence that is at least 80% identical to the wild type human IL12 sequence.
54. The Maraba virus of claim 53, wherein the IL12 protein comprises an amino acid sequence that is at least 90% identical to the wild type human IL12 sequence.
55. The Maraba virus of claim 54, wherein the IL12 protein comprises an amino acid sequence that is identical to the wild type human IL12 sequence.
56. The Maraba virus of claim 47, wherein the IL12 protein comprises the p40 and p35 subunits.
57. The Maraba virus of claim 56, wherein the p40 protein comprises the amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NO: 1 or 3.
58. The Maraba virus of claim 57, wherein the p40 protein comprises the amino acid sequence of SEQ ID NO: 1 or 3.
59. The Maraba virus of claim 56, wherein the p35 protein comprises the amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NO: 2 or 4.
60. The Maraba virus of claim 56, wherein the p35 protein comprises the amino acid sequence of SEQ ID NO: 2 or 4.
61. The Maraba virus of claim 47, wherein the functional portion of the IL12 protein is a portion that is capable of stimulating the growth of T cells or NK cells.
62. The Maraba virus of claim 47, wherein the functional portion of the IL12 protein is capable of stimulating the production of IFN-gamma.
63. A method for treating a cancer in a patient, the method comprising administering to the patient an oncolytic Maraba virus whose genome comprises one or more nucleic acid sequences that, alone or in combination, are capable of expressing an interleukin-12 (IL12) protein or a functional portion thereof.
64. The method of claim 63, wherein the virus comprises a substitution at amino acid 242 of the wild type G protein.
65. The method of claim 64, wherein the amino acid at position 242 is an arginine.
66. The method of claim 65, wherein the virus comprises a substitution at amino acid 123 of the wild type M protein.
67. The method of claim 66, wherein the amino acid at position 123 is a tryptophan.
68. The method of claim 67, wherein the Maraba virus is the MG1 Maraba virus.
69. The method of claim 68, wherein the IL12 protein comprises an amino acid sequence that is at least 80% identical to the wildtype human IL12 sequence.
70. The method of claim 69, wherein the IL12 protein comprises an amino acid sequence that is at least 90% identical to the wild type human IL12 sequence.
71. The method of claim 70, wherein the IL12 protein comprises an amino acid sequence that is identical to the wild type human IL12 sequence.
72. The method of claim 71, wherein the IL12 protein comprises the p40 and p35 subunits.
73. The method of claim 72, wherein the p40 protein comprises the amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NO: 1 or 3.
74. The method of claim 73, wherein the p40 protein comprises the amino acid sequence of SEQ ID NO: 1 or 3.
75. The method of claim 72, wherein the p35 protein comprises the amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NO: 2 or 4.
76. The method of claim 75, wherein the p35 protein comprises the amino acid sequence of SEQ ID NO: 2 or 4.
77. The method of claim 63, wherein the functional portion of the IL12 protein is a portion that is capable of stimulating the growth of T cells or NK cells.
78. The method of claim 63, wherein the functional portion of the IL12 protein is capable of stimulating the production of IFN-gamma.
79. The method of claim 63, wherein the virus is administered intravenously, intraperitonealy, intratumourily, intrathecally, intracranially, subcutaneously or intrathoracically.
80. The method of claim 79, wherein the virus is administered intravenously.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0022] Embodiments of the present disclosure will now be described, by way of example only, with reference to the attached Figures.
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
DETAILED DESCRIPTION
[0063] Generally, the present disclosure provides: a Maraba virus whose genome includes a transgene sequence that encodes the cytokine IL12; an infected cell vaccine (ICV) where autologous tumour cells from a patient are infected ex vivo with an oncolytic recombinant rhabdovirus expressing IL12; a method to treat a cancer through administration of the Maraba virus or the infected cell vaccine; and use of the Maraba virus or the infected cell vaccine for treating a cancer. Without wishing to be bound by theory, the authors of the present disclosure believe that expression of the IL12 may enhance the anti-tumour immune response of the administered oncolytic virus.
[0064] Peritoneal carcinomatosis (PC) is one of the most common and problematic sites of metastases for abdominal malignancies, including gastrointestinal and ovarian cancers (7). It is a common cancer metastases that is associated with a significantly reduced quality of life, median survival rate and poor prognosis that requires new treatment options. PC poses challenges to the use of traditional chemotherapy, which cannot be used for patients who develop complications such as bowel obstruction (8). Another challenge in treating PC is the difficulty in delivering a therapeutic agent. Another obstacle to effective therapy is the toxicity and short half-life of immunomodulating agents used systemically or delivered directly to the target site.
[0065] One aspect of the present disclosure may overcome one or more of these challenges by enhancing the anti tumour immune response of an oncolytic virus. By way of example, in one particular embodiment, the patients' tumour cells are infected ex vivo with an oncolytic rhabdovirus expressing the cytokine IL12. These infected cells are then re-administered to the patient as an Infected Cell Vaccine (ICV). Without wishing to be bound by theory, the authors of the present disclosure believe that the infected tumour cells provide an immunostimulatory environment that is supplemented by the production of IL12. Expression of IL12 in situ reduces the half-life and/or toxicity drawbacks associated with high dose administration of IL12. The authors of the present disclosure believe that expression of the IL12 acts to recruit and stimulate NK cells to the tumour site, and reduce the size of the tumour. The activation of NK cells, the adaptive arm of the immune response, may confer a long-term memory and thereby reduce the possibility that the tumour will return.
[0066] Material and Methods:
[0067] Cell Lines and Mice:
[0068] Murine CT26 colon carcinoma, murine B16F10 F10 melanoma, human SW620 colorectal adenocarcinoma, human HCT15 colorectal adenocarcinoma, human A549 lung carcinoma, murine YAC-1 lymphoma, human K562 leukemic cell lines (all from American Type Tissue Collection) were propagated in Dulbecco's modified Eagle's medium (Hyclone) for the adherent cell lines, or Roswell Park Memorial Institutes Media (Hyclone) for non-adherent cell lines supplemented with 10% fetal calf serum (Cansera, Etobicoke, Ontario, Canada). Rauscher murine leukemia virus-induced T-cell lymphoma (RMA) and RMA-S (MHC-deficient variant of RMA) were obtained from Dr. A. Veillette (Institut de Recherches Clinique, Montreal, Quebec, Canada). Female Balb/C and C57BL/6 mice 6- to 8 weeks old were purchased from Charles River Laboratories (Wilmington, Mass.). Animals were housed in pathogen-free conditions and all experiments were conducted with the approval of the University of Ottawa Animal Care and Veterinary Service.
[0069] MG1-IL12 construction:
[0070] Murine IL12 was PCR amplified from pORF-mIL-12 (IL-12elasti(p35::p40)) (InvivoGen, San Diego, Calif., USA) to add MluI (5) and (3) cloning sites to facilitate cloning into Maraba MG1 (9). The recombinant MG1-IL12 virus was rescued as described previously (10). Briefly, A549 were infected with vaccinia virus expressing T7 polymerase and subsequently transfected using Lipofectamine 2000 (Invitrogen, Burlington, ON, Canada) with 2 mg of MG1-IL-12 DNA plasmid together with pCI-Neo plasmids encoding for Maraba N, P and L (1, 1.25, 0.25 mg, respectively). The rescued virus was passaged on SNB19 cells, then plaque purified, amplified and titered on Vero cells.
[0071] Viability Assays:
[0072] B16lacZ, CT26lacZ, SW620 and HCT15 cell lines were seeded into 96-well plates (210.sup.4 cells/well). 24 hours later, cells were infected with MG1 or MG1-IL12 viruses at Multiplicity of Infection (MOI) of 0.001-10 pfu/cell. Alamar Blue (Sigma-Aldrich, St Louis, Mo.) was added following 48 hours of incubation to a final concentration of 20 g/ml. The absorbance was read at a wavelength of 570 nm after 6-hour incubation.
[0073] Antibodies and FACS Analysis:
[0074] For splenic and lung lymphocyte population analyses, organs were harvested from mice and red blood cells lysed using ammonium chloride-potassium lysis (ACK) buffer. The following monoclonal antibodies were used: anti-TCR-b (H57-597), anti-NK1.1 (PK136), both from eBiosciences. Spleen and lung NK cell IFN- and Granzyme B secretion were analysed following a 1 hour GolgiPlug (BD Biosciences) incubation using: anti-CD3 (17A2), anti-NK1.1 (PK136), anti-IFN- (XMG1.2) and anti-Granzyme B (16G6) all from BD Biosciences. The monoclonal antibodies were used for human NK cell migration and activation are; anti-CD56 (HCD56) from Biolegend, anti-CD3 (UCHT1) and anti-CD69 (FN50) both are from eBiosciences. Fluorescence-activated cell sorting (FACS) acquisitions were conducted on a CyAn-ADP using Summit software (Beckman Coulter, Mississauga, Canada) and data were analyzed with Kaluza software (Beckman Coulter).
[0075] Ex Vivo Splenocytes Cytotoxicity Assay
[0076] The .sup.51Cr-release assay was performed as previously described (11). Briefly, splenocytes were harvested from treated and control mice two days after treatment. ACK buffer treated splenocytes were resuspended and mixed with chromium labelled YAC-1 cells at specified effector-to-target (E:T) ratios.
[0077] In Vivo Tumour Rejection Assay
[0078] The in vivo rejection assay was performed as described previously (11). Briefly, RMA and RMA-S were labeled with 5 and 0.5 mmol/L CFSE, respectively. 110.sup.6 cells containing a 1:1 mixture of each cell type was injected i.p. into C57BL/6 mice 24 hrs following ICV treatment. Peritoneal cells were collected the following day (24 hr) by washing the peritoneum with 5 mL of PBS containing 2 mmol/L EDTA. Collected cells were analysed by flow cytometry for the presence of CFSE-labeling.
[0079] Virus Infection of B16F10 Cells and Co-Culture with Bone Marrow-Derived DCs for Chemotaxis and Chemokines Analysis
[0080] B16F10 cells infected with MG1 or MG1-IL12 (MOI=0.1 pfu/cell) were harvested 18 hrs after infection and cultured with bone marrow-derived dendritic cells (DCs) described elsewhere at a 3:1 ratio in DC medium (1% FBS) (complete RPMI supplemented with 1 of 2-Mercapoethanol (cat #21985-023, Gibco, life technologies) in 96-wells plates (12). Media was collected after 24 hours and stored at 80 C. until further analysis.
[0081] Cytokine and Chemokine Analyses
[0082] Murine IFN from DCs co-culture supernatant were detected by FlowCytomix (eBioscience) kits as per manufacturer's instructions. For lungs IL12 and IFN expression, lungs from C57Bl/6 mice treated with irrB16, MG1 ICV or MG1-IL12 ICV at 510.sup.5 cells/100 ul/mouse i.v., were resected and homogenized in 1 ml PBS 24-hours after treatment. Murine MCP-1, SDF-1 and IP-10 chemokines were assayed 18 hours post ICV treatment from the peritoneal fluids of C57Bl/6 mice (in vivo) or from tissue culture supernatant using ELISArray kits (SABiosciences) as per manufacturers instructions.
[0083] Murine Transwell Chemotaxis Assay
[0084] Tissue culture supernatants for assessment of chemokines or chemotaxis assay were generated in DC media. Chemotaxis of NK cells was assessed using a Transwell system as described previously (13). Briefly, 500 ul of conditioned media from DC cultures was added to the lower chamber of Transwell plates with 5-um pores (Costar, Corning). 310.sup.5 of DX5.sup.+ sorted NK cells were added to the upper chamber, and plates were incubated for 3 hours at 37 C. Cells in the lower chambers were harvested, stained with trypan blue and counted. A migration percentage was calculated as (total number NK cells in bottom chamber/total number NK cell input)100. To calculate NK cell index: (NK cell migration percentage/NK cell migration percentage from media alone group).
[0085] Human Transwell Chemotaxis Assay
[0086] Conditioned media were generated in DC media through direct ICV-PBMCs co-culture at 3:1 ratio for 18 hours. 110.sup.6 of PBMCs were added to the upper chamber, and plates were incubated for 3 hours at 37 C. Cells in the lower chambers were harvested, stained with anti-CD56 (HCD56) and anti-CD3 (UCHT1) and quantified by FACS. A migration percentage was calculated as (total number NK cells in bottom chamber/total number NK cell input)100. To calculate NK cell index: (NK cell migration percentage/NK cell migration percentage from media alone group).
[0087] DC-MG1-IL-12-ICV/Splenocytes Co-Cultures
[0088] DC-MG1-IL-12-ICV were isolated by MACS CD11c.sup.+ selection (Miltenyi Biotec) and co-cultured with nave splenocytes at 1:5 ratio in DC medium, at 210.sup.5 splenocytes/well in 96-well plate format. Twenty-four hours later, cell-free supernatant was stored at 80 C. for measurement of IFN. Intracellular IFN staining on splenocytes by intracellular FACS was also performed as described above.
[0089] Mouse Models:
[0090] Therapeutic Treatment Model.
[0091] CT26 and B16F10 Peritoneal carcinomatosis in BALB/c and C57Bl/6 mice, respectively were treated with 110.sup.4 ICV on day 3 after seeding 510.sup.5 tumour cells intraperitonealy. For the CT26 bulky tumour model, 510.sup.5 tumour cells were seeded within the peritoneum and the treatment regimen of six doses of ICV was initiated following Magnetic Resonance (MR) scan confirmation of a tumour with a size of >3 mm. Animals were sedated with isoflurane gas and MR scanning was performed with a 7 Tesla GE/Agilent MR 901 (GE Healthcare, Chicago, USA). For each mouse, three MR pulse sequences were used: one localizer and two fast spin echo (FSE) sequences in the coronal and axial planes. The parameters for the FSE sequences were: echo train length 8, bandwidth=16 kHz, echo time=42 ms, repetition time=1500 ms, field of view=35 mm, matrix 256256, slice thickness=1 mm. The total MR scan time per mouse was approximately 15 minutes. Follow-up MR scans were performed one week, six weeks and thirteen weeks post-treatment start using the same MR scan parameters.
[0092] Prophylactic Treatment Model.
[0093] C57Bl/6 mice were vaccinated with single dose of 110.sup.3 irrB16, MG1 ICV or MG1-IL-12-ICV ip The following day, mice were challenged with 310.sup.5 B16F10-LacZ cells IV, sacrificed at 4 days after tumour cells injection followed by staining and quantification of lung metastases with X-gal (Bioshop, Burlington, Canada) as described previously (14). The total number of lung surface metastases was determined on all lung lobes using a stereomicroscope (Leica Microsystems, Concord, Canada).
[0094] Statistical Analysis
[0095] All statistical analyses were determined using GraphPad Prism 6.0 software. Statistical significance was determined by the Student t test with a cut off P=0.05. Data are presented as SD.
[0096] Characterization of an MG1 Oncolytic Virus Encoding Murine IL12 (MG1-IL12)
[0097] A murine IL12 transgene (p70), which is composed of p35 and p40 subunits, was incorporated into the backbone of the oncolytic Maraba virus variant MG1 to create MG1-IL12 (
Examples
[0098] MG1-IL12 ICV Enhances NK Cell-Mediated Tumour Rejection.
[0099] The authors of the present disclosure have previously demonstrated that infecting autologous tumor cells ex vivo with oncolytic viruses can elicit a robust immune response against established, non-permissive, tumors in vivo (15). To determine whether MG1 and MG1-IL12 could similarly induce an immune response when used as an ICV, the authors intravenously (i.v.) injected 510.sup.5 -irradiated B16F10 cells either mock infected or infected with MG1 or MG1-IL12. The authors have previously shown that i.v. administration of ICVs is associated with a rapid and dose-dependent accumulation of injected cells which persist in the lung for up to 1 day in tumor free animals (16). Following ICV delivery, significantly higher levels of IL12 were detected in lung homogenates from mice receiving MG1-IL12 ICV in comparison to animals receiving cells alone or MG1 ICV (
[0100] MG1-IL12 ICV Enhances NK Cell Activation and Improves Survival in a Model of Peritoneal Carcinomatosis.
[0101] The initial findings suggest that the improved anti-tumor response elicited by MG1-IL12 ICV in comparison to MG1 ICV are in part due to potent chemotactic properties of IL12 which contribute to the enhanced recruitment of cytotoxic NK cells to the site of delivery (
[0102] NK Cell Activation and Migration in Response to MG1-IL12 ICV is Partly Dependent Upon the Secretion of IP10 from Dendritic Cells.
[0103] The data clearly establish for the ability of MG1-IL12 ICV to promote NK cell activation, migration and function, however, it was unclear whether dendritic cells (DCs), a key mediator of NK cell function in vivo were involved in this process. To understand the interaction between NK cells and DC in the presence of MG1-IL12, the authors quantified IFN production from splenocytes cultured in the presence of bone marrow derived DCs, which were either untreated or cultured with mock, MG1, or MG1-IL12 infected B16F10 cells. Notably, the authors found that splenocytes cultured with DCs previously exposed to MG1-IL12 ICV resulted in a significant increase in NK cell-specific IFN secretion suggesting DCs promote NK cell cytokine secretion (
[0104] MG1-IL12 ICV is Effective in Treating Established Peritoneal Disease in Mice.
[0105] Together the findings suggest that the MG1-IL12 ICV can significantly slow the outgrowth of B16F10 tumours within the peritoneal compartment by stimulating the recruitment of activated NK cells. Since peritoneal carcinomatosis is a common presentation for late stage gastrointestinal and gynecological malignancies, the authors of the present disclosure sought to determine whether the MG1-IL12 ICV could provide therapeutic benefit in a clinically relevant model of colon cancer (CT26) with peritoneal disease at time of treatment. To accomplish this BALB/c mice were seeded with CT26 tumour cells (
[0106] Next, the authors sought to measure the effects of treatment in established bulky tumours. Between day 10 and 17 following implantation, tumors were visualized by MRI and mice bearing significant tumour masses (Class 1>8 mm and Class 2>3 mm) were randomly allocated into a treatment group prior to treatment with 6 doses of irradiated cells, MG1 ICV or MG1-IL12 ICV administered over a two week period (
[0107] MG1-IL-12 ICV Enhances Human NK Cell Cytoxicity and Migratory Capacity.
[0108] Given the fact that murine p40 and p35 subunits of IL-12 share 70% and 60% homology with their human counterparts respectively, they are able to functionally activate human NK and T cells (20). The authors next sought to confirm that the vaccine could elicit a similar effect on human NK cells ex vivo. To accomplish this, irradiated SW620 colon cancer cells were infected with MG1 or MG1-IL12 and cultured with peripheral blood mononuclear cells (PBMCs) isolated from a healthy donor as part of a (Perioperative Blood Collection Protocol approved by the Ottawa Health Science Network Research Ethics Board #2011884). In agreement with previous findings, MG1-IL12 ICV resulted in a significant increase in the expression of CD69, an established marker of NK cell activation, in the NK cell (CD56.sup.+ CD3.sup.) subset of PBMCs (
[0109] While the above examples demonstrate the efficacy of a particular Maraba virus in mice, the authors believe that Maraba viruses and ICVs according to the present disclosure will also address or ameliorate one or more shortcomings involved with oncolytic virus treatment of cancer in humans.
[0110] Peritoneal carcinamatosis is used as an example of a cancer presentation that can be treated using a Maraba virus according to the present disclosure. The authors believe that other tumour types, and tumours in other locations, would also be amenable to treatment with Maraba viruses and ICVs according to the present disclosure.
[0111] In the preceding description, for purposes of explanation, numerous details are set forth in order to provide a thorough understanding of the examples. However, it will be apparent to one skilled in the art that these specific details are not required. Accordingly, what has been described is merely illustrative of the application of the described examples and numerous modifications and variations are possible in light of the above teachings.
[0112] Since the above description provides examples, it will be appreciated that modifications and variations can be effected to the particular examples by those of skill in the art. Accordingly, the scope of the claims should not be limited by the particular examples set forth herein, but should be construed in a manner consistent with the specification as a whole.
REFERENCES
[0113] 1. de Gruijl T D, van den Eertwegh A J, Pinedo H M, Scheper R J: Whole-cell cancer vaccination: from autologous to allogeneic tumor- and dendritic cell-based vaccines. Cancer Immunol Immunother 2008, 57(10):1569-1577. [0114] 2. Chiang C L, Coukos G, Kandalaft L E: Whole Tumor Antigen Vaccines: Where Are We? Vaccines (Basel) 2015, 3(2):344-372. [0115] 3. Srivatsan S, Patel J M, Bozeman E N, Imasuen I E, He S, Daniels D, Selvaraj P: Allogeneic tumor cell vaccines: the promise and limitations in clinical trials. Hum Vaccin Immunother 2014, 10(1):52-63. [0116] 4. Campbell C T, Gulley J L, Oyelaran O, Hodge J W, Schlom J, Gildersleeve J C: Humoral response to a viral glycan correlates with survival on PROSTVAC-VF. Proc Natl Acad Sci USA 2014, 111(17):E1749-1758. [0117] 5. Tugues S, Burkhard S H, Ohs I, Vrohlings M, Nussbaum K, Vom Berg J, Kulig P, Becher B: New insights into IL-12-mediated tumor suppression. Cell Death Differ 2015, 22(2):237-246. [0118] 6. Brun J, McManus D, Lefebvre C, Hu K, Falls T, Atkins H, Bell J C, McCart J A, Mahoney D, Stojdl D F: Identification of genetically modified Maraba virus as an oncolytic rhabdovirus. Mol Ther 2010, 18(8):1440-1449. [0119] 7. Mohamed F, Cecil T, Moran B, Sugarbaker P: A new standard of care for the management of peritoneal surface malignancy. Curr Oncol 2011, 18(2):e84-96. [0120] 8. Aoyagi T, Terracina K P, Raza A, Takabe K: Current treatment options for colon cancer peritoneal carcinomatosis. World J Gastroenterol 2014, 20(35):12493-12500. [0121] 9. Labbe A, Nelles M, Walia J, Jia L, Furlonger C, Nonaka T, Medin J A, Paige C J: IL-12 immunotherapy of murine leukaemia: comparison of systemic versus gene modified cell therapy. J Cell Mol Med 2009, 13(8B):1962-1976. [0122] 10. Vaillant J C, Nordlinger B, Deuffic S, Arnaud J P, Pelissier E, Favre J P, Jaeck D, Fourtanier G, Grandjean J P, Marre P et al: Adjuvant intraperitoneal 5-fluorouracil in high-risk colon cancer: A multicenter phase III trial. Ann Surg 2000, 231(4):449-456. [0123] 11. Mortarini R, Borri A, Tragni G, Bersani I, Vegetti C, Bajetta E, Pilotti S, Cerundolo V, Anichini A: Peripheral burst of tumor-specific cytotoxic T lymphocytes and infiltration of metastatic lesions by memory CD8+ T cells in melanoma patients receiving interleukin 12. Cancer Res 2000, 60(13):3559-3568. [0124] 12. Lutz M B, Kukutsch N, Ogilvie A L, Rossner S, Koch F, Romani N, Schuler G: An advanced culture method for generating large quantities of highly pure dendritic cells from mouse bone marrow. J Immunol Methods 1999, 223(1):77-92. [0125] 13. Cheng M, Chen Y, Xiao W, Sun R, Tian Z: NK cell-based immunotherapy for malignant diseases. Cell Mol Immunol 2013, 10(3):230-252. [0126] 14. Ardolino M, Azimi C S, lannello A, Trevino T N, Horan L, Zhang L, Deng W, Ring A M, Fischer S, Garcia K C et al: Cytokine therapy reverses NK cell anergy in MHC-deficient tumors. J Clin Invest 2014, 124(11):4781-4794. [0127] 15. Lemay C G, Rintoul J L, Kus A, Paterson J M, Garcia V, Falls T J, Ferreira L, Bridle B W, Conrad D P, Tang V A et al: Harnessing oncolytic virus-mediated antitumor immunity in an infected cell vaccine. Mol Ther 2012, 20(9):1791-1799. [0128] 16. Power A T, Wang J, Falls T J, Paterson J M, Parato K A, Lichty B D, Stojdl D F, Forsyth P A, Atkins H, Bell J C: Carrier cell-based delivery of an oncolytic virus circumvents antiviral immunity. Mol Ther 2007, 15(1):123-130. [0129] 17. Watford W T, Moriguchi M, Morinobu A, O'Shea J J: The biology of IL-12: coordinating innate and adaptive immune responses. Cytokine Growth Factor Rev 2003, 14(5):361-368. [0130] 18. Hara T, Jung L K, Bjorndahl J M, Fu S M: Human T cell activation. Ill. Rapid induction of a phosphorylated 28 kD/32 kD disulfide-linked early activation antigen (EA 1) by 12-o-tetradecanoyl phorbol-13-acetate, mitogens, and antigens. J Exp Med 1986, 164(6):1988-2005. [0131] 19. Lanier L L, Buck D W, Rhodes L, Ding A, Evans E, Barney C, Phillips J H: Interleukin 2 activation of natural killer cells rapidly induces the expression and phosphorylation of the Leu-23 activation antigen. J Exp Med 1988, 167(5):1572-1585. [0132] 20. Schoenhaut D S, Chua A O, Wolitzky A G, Quinn P M, Dwyer C M, McComas W, Familletti P C, Gately M K, Gubler U: Cloning and expression of murine IL-12. J Immunol 1992, 148(11):3433-3440.
TABLE-US-00001 APPENDIXA Sequences: SEQIDNO:1-HumanIL12p35subunit mwppgsasqpppspaaatglhpaarpvslqcrlsmcparslllvatlvlldhlslarnlp 61 vatpdpgmfpclhhsqnllravsnmlqkarqtlefypctseeidheditkdktstveacl 121 pleltknesclnsretsfitngsclasrktsfmmalclssiyedlkmyqvefktmnakll 181 mdpkrqifldqnmlavidelmqalnfnsetvpqkssleepdfyktkiklcillhafrira 241 vtidrvmsylnas SEQIDNO:2-HumanIL12p40subunit mchqqlviswfslvflasplvaiwelkkdvyvveldwypdapgemvvltcdtpeedgitw 61 tldqssevlgsgktltiqvkefgdagqytchkggevlshsllllhkkedgiwstdilkdq 121 kepknktflrceaknysgrftcwwlttistdltfsvkssrgssdpqgvtcgaatlsaerv 181 rgdnkeyeysvecqedsacpaaeeslpievmvdavhklkyenytssffirdiikpdppkn 241 lqlkplknsrqvevsweypdtwstphsyfsltfcvqvqgkskrekkdrvftdktsatvic 301 rknasisvraqdryyssswsewasvpcs SEQIDNO:3-MouseIL12p35subunit mvsvptaspsasssssqcrssmcqsryllflatlallnhlslarvipvsgparclsqsrn 61 llkttddmvktareklkhysctaedidheditrdqtstlktclplelhknesclatrets 121 sttrgsclppqktslmmtlclgsiyedlkmyqtefqainaalqnhnhqqiildkgmlvai 181 delmqslnhngetlrqkppvgeadpyrvkmklcillhafstrvvtinrvmgylssa SEQIDNO:4-MouseIL12p40subunit mcpqkltiswfaivllvsplmamwelekdvyvvevdwtpdapgetvnltcdtpeedditw 61 tsdqrhgvigsgktltitvkefldagqytchkggetlshshlllhkkengiwsteilknf 121 knktflkceapnysgrftcswlvqrnmdlkfnikssssspdsravtcgmaslsaekvtld 181 qrdyekysvscqedvtcptaeetlpielalearqqnkyenystsffirdiikpdppknlq 241 mkplknsqvevsweypdswstphsyfslkffvriqrkkekmketeegcnqkgaflvekts 301 tevqckggnvcvqaqdryynsscskwacvpcrvrs