CARTILAGE REGENERATIVE MATERIAL AND METHOD FOR PRODUCING SAME
20190216976 ยท 2019-07-18
Assignee
Inventors
- Kentaro NAKAMURA (Ashigarakami-gun, JP)
- Hayato Miyoshi (Ashigarakami-gun, JP)
- Satoko HADA (Gamagori-shi, JP)
- Masatoki WATANABE (Gamagori-shi, JP)
Cpc classification
A61L27/00
HUMAN NECESSITIES
A61L27/58
HUMAN NECESSITIES
A61L27/227
HUMAN NECESSITIES
A61L27/3817
HUMAN NECESSITIES
International classification
A61L27/22
HUMAN NECESSITIES
A61L27/58
HUMAN NECESSITIES
Abstract
An object of the invention is to provide a cartilage regenerative material that suppresses infiltration of fibrous soft tissue and brings about satisfactory cartilage regeneration, and a method for producing the cartilage regenerative material. Provided is a cartilage regenerative material including a porous body of a biocompatible polymer and a biocompatible polymer film, in which the porous body contains chondrocytes and cartilage matrix, and the cartilage matrix exists in a region of 10% or more of a region extending from the surface of the transplant face of the porous body to a depth of 150 m along the thickness.
Claims
1. A cartilage regenerative material comprising: a porous body of a biocompatible polymer; and a biocompatible polymer film, wherein the porous body contains chondrocytes and cartilage matrix, and the cartilage matrix exists in a region of 10% or more of a region extending from the surface of the transplant face of the porous body to a depth of 150 m along the thickness.
2. The cartilage regenerative material according to claim 1, wherein the cartilage matrix exists in a region of 20% or more of a region extending from the surface of the transplant face of the porous body to a depth of 150 m along the thickness.
3. The cartilage regenerative material according to claim 1, wherein the biocompatible polymer of the porous body is a recombinant peptide or a chemically synthesized peptide.
4. The cartilage regenerative material according to claim 1, wherein the biocompatible polymer of the porous body is a recombinant gelatin or a chemically synthesized gelatin.
5. The cartilage regenerative material according to claim 4, wherein the recombinant gelatin or the chemically synthesized gelatin is represented by Formula 1,
A-[(Gly-X-Y).sub.n].sub.m-B Formula 1: in Formula 1, n units of X each independently represent any amino acid residue; n units of Y each independently represent any amino acid residue; m represents an integer from 2 to 10; n represents an integer from 3 to 100; A represents an arbitrary amino acid residue or amino acid sequence; and B represents an arbitrary amino acid residue or amino acid sequence.
6. The cartilage regenerative material according to claim 4, wherein the recombinant gelatin or the chemically synthesized gelatin is any one of the following: a peptide comprising the amino acid sequence set forth in SEQ ID NO:1; a peptide having biocompatibility and comprising an amino acid sequence obtained by modifying the amino acid sequence set forth in SEQ ID NO:1 by deletion, substitution or addition of one or several amino acid residues; and a peptide having biocompatibility and comprising an amino acid sequence having at least 80% sequence identity with the amino acid sequence set forth in SEQ ID NO:1.
7. The cartilage regenerative material according to claim 1, wherein the porous body is obtainable by freeze-drying an aqueous solution containing a biocompatible polymer.
8. The cartilage regenerative material according to claim 1, wherein the biocompatible polymer film is a film for isolating a portion or the entirety of the transplant face of the porous body from the site of transplantation.
9. The cartilage regenerative material according to claim 1, wherein the biocompatible polymer of the biocompatible polymer film is a recombinant gelatin or a chemically synthesized gelatin.
10. The cartilage regenerative material according to claim 9, wherein the biocompatible polymer of the biocompatible polymer film is represented by Formula 1,
A-[(Gly-X-Y).sub.n].sub.m-B Formula 1: in Formula 1, n units of X each independently represent any amino acid residue; n units of Y each independently represent any amino acid residue; m represents an integer from 2 to 10; n represents an integer from 3 to 100; A represents an arbitrary amino acid residue or amino acid sequence; and B represents an arbitrary amino acid residue or amino acid sequence.
11. The cartilage regenerative material according to claim 9, wherein the biocompatible polymer of the biocompatible polymer film is any one of the following: a peptide comprising the amino acid sequence set forth in SEQ ID NO:1; a peptide having biocompatibility and comprising an amino acid sequence obtained by modifying the amino acid sequence set forth in SEQ ID NO:1 by deletion, substitution or addition of one or several amino acid residues; and a peptide having biocompatibility and comprising an amino acid sequence having at least 80% sequence identity with the amino acid sequence set forth in SEQ ID NO:1.
12. The cartilage regenerative material according to claim 1, wherein the biocompatible polymer of the biocompatible polymer film has a degree of crosslinking of 4 to 15.
13. The cartilage regenerative material according to claim 1, wherein the biocompatible polymer of the biocompatible polymer film has a degree of crosslinking of 4 to 8.
14. The cartilage regenerative material according to claim 1, wherein the rate of decomposition, which is represented by Formula 4, of the biocompatible polymer of the biocompatible polymer film is 0.1 to 20 mass %/hour,
Rate of decomposition=((WWe)wo)/wo/T Formula 4: in Formula 4, W represents the mass of a tube containing a sample, which is recorded after decomposition by a collagenase and freeze-drying; We represents the blank mass of the tube that has been recorded in advance; wo represents the actual amount of addition of the sample; and T represents the time taken for shaking in a collagenase solution.
15. The cartilage regenerative material according to claim 1, wherein the rate of decomposition, which is represented by Formula 4, of the biocompatible polymer of the biocompatible polymer film is 5 to 10 mass %/hour,
Rate of decomposition=((WWe)wo)/wo/T Formula 4: in Formula 4, W represents the mass of a tube containing a sample, which is recorded after decomposition by a collagenase and freeze-drying; We represents the blank mass of the tube that has been recorded in advance; wo represents the actual amount of addition of the sample; and T represents the time taken for shaking in a collagenase solution.
16. The cartilage regenerative material according to claim 1, wherein the chondrocytes are at least one type of chondrocytes selected from the group consisting of articular cartilage-derived chondrocytes, auricular cartilage-derived chondrocytes, nasal cartilage-derived chondrocytes, iPS cell-derived chondrocytes, ES cell-derived chondrocytes, mesenchymal stem cell-derived chondrocytes, and chondrocytes obtained by a direct reprogramming method.
17. The cartilage regenerative material according to claim 1, wherein the cartilage matrix exists in a region occupying 10% or more of a region extending from the surface of the articular cavity face of the porous body to a depth of 150 m along the thickness.
18. The cartilage regenerative material according to claim 1, further comprising: a pin of a biocompatible polymer.
19. A method for producing a cartilage regenerative material being the cartilage regenerative material according to claim 1, the method comprising: Step A of freeze-drying an aqueous solution containing a biocompatible polymer and obtaining a porous body; Step B of inoculating chondrocytes into the porous body obtained in Step A and culturing the chondrocytes; and Step C of providing a biocompatible polymer film.
20. The method for producing a cartilage regenerative material according to claim 19, wherein in Step A, a porous body is obtained by stirring the aqueous solution containing a biocompatible polymer and then freeze-drying the aqueous solution.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
DESCRIPTION OF THE PREFERRED EMBODIMENTS
[0069] Hereinafter, embodiments of the invention will be explained in detail.
[0070] The cartilage regenerative material of the invention comprises a porous body of a biocompatible polymer and a biocompatible polymer film, in which the porous body contains chondrocytes and cartilage matrix, and the cartilage matrix exists in a region occupying 10% or more of a region extending from the surface of a transplant face of the porous body to a depth of 150 m along the thickness.
[0071] The cartilage regenerative material of the invention suppresses infiltration of fibrous soft tissue and brings about satisfactory cartilage regeneration, and therefore, the cartilage regenerative material can be used for cartilage regeneration. The cartilage regenerative material of the invention can be used as, for example, a transplant material to be transplanted to a cartilage defect site.
[0072] It is a completely unexpected remarkable effect that the cartilage regenerative material of the invention comprising a porous body of a biocompatible polymer and a biocompatible polymer film, in which the porous body contains chondrocytes and cartilage matrix, and the cartilage matrix exists in a region occupying 10% or more of a region extending from the surface of a transplant face of the porous body to a depth of 150 m along the thickness, suppresses infiltration of fibrous soft tissue and brings about satisfactory cartilage regeneration as described above. In WO2011/108537A, description on bone regeneration is given; however, no investigation was conducted on cartilage regeneration. Bone regeneration and cartilage regeneration are different phenomena, and cartilage regeneration action cannot be predicted from bone regeneration action. Also, in JP2001-519210A, the feature of the invention that cartilage matrix exists in a region occupying 10% or more of a region extending from the surface of a transplant face of a porous body to a depth of 150 m along the thickness, is neither described nor suggested. JP2001-519210A suggests nothing about the possibility of achieving an effect that infiltration of fibrous soft tissue is suppressed and satisfactory cartilage regeneration is brought about as a result of the above-described feature.
[0073] In the cartilage regenerative material of the invention, the cartilage matrix exists in a region occupying 10% or more (preferably 20% or more, and more preferably 30% or more) of a region extending from the surface of a transplant face of a porous body to a depth of 150 m along the thickness. The proportion of the region in which the cartilage matrix exists in the region extending from the surface of a transplant face of the porous body to a depth of 150 m along the thickness, is referred to as cartilage matrix filling proportion in the present specification. As described above, by adjusting the cartilage matrix filling proportion on the transplant face side to be 10% or higher, the cartilage regenerative material of the invention is enabled to suppress infiltration of fibrous soft tissue and bring about satisfactory cartilage regeneration. The upper limit of the cartilage matrix filling proportion on the transplant face side is not particularly limited, and the upper limit may be 100%, or may be less than 100%.
[0074] Preferably, in the cartilage regenerative material of the invention, cartilage matrix exists in a region of 10% or more (more preferably 20% or more, even more preferably 30% or more, and still more preferably 50% or more) of a region extending from the surface of the articular cavity face of the porous body to a depth of 150 m along the thickness. The upper limit of the cartilage matrix filling proportion on the articular cavity face side is not particularly limited, and the upper limit may be 100%, or may be less than 100%.
[0075] A transplant face of the porous body means the face on the side that is brought into contact with the defect part in vivo (in the case of the sponge of
[0076] Measurement of the cartilage matrix filling proportion can be carried out according to the method described in [14] Evaluation of samples having different cartilage matrix filling proportions of bottom face in the Examples of the present specification. That is, slices of a porous body are produced (formalin fixation and paraffin embedment), and cross-sections are visualized by performing safranin O staining. Thus, evaluation is carried out. That is, attention was paid to a thickness of 150 m from the surface of the transplant face (bottom face) or the articular cavity face (face on the opposite side of the transplant face) of the stained tissue slices, and the area of a region that was positive for safranin O staining was measured. By determining the proportion of the area of the safranin O staining positive region with respect to the total area of the region from the surface to a depth of 150 m, the cartilage matrix filling proportion in the 150-m layer can be determined.
[0077] Hereinafter, the constituent elements of the invention will be explained.
[0078] (1) Porous Body of Biocompatible Polymer
[0079] The porous body used in the invention is constructed from a biocompatible polymer.
[0080] (1-1) Biocompatible Polymer
[0081] Biocompatibility means that in a case in which the material is brought into contact with a living body, the material does not give a rise to a noticeably harmful reaction such as a long-term and chronic inflammation reaction. Whether the biocompatible polymer used in the invention is decomposed in vivo is not particularly limited, as long as the polymer has biocompatibility; however, it is preferable that the polymer is a biodegradable polymer. Specific examples of a non-biodegradable polymer include polytetrafluoroethylene (PTFE), polyurethane, polypropylene, polyester, vinyl chloride, polycarbonate, acryl, stainless steel, titanium, silicone, and MPC (2-methacryloyloxyethylphosphorylcholine). Specific examples of a biodegradable polymer include polypeptides such as a recombinant peptide and a chemically synthesized peptide (for example, gelatin that will be explained below), polylactic acid, polyglycolic acid, a lactic acid-glycolic acid copolymer (PLGA), hyaluronic acid, glycosaminoglycan, proteoglycan, chondroitin, cellulose, agarose, carboxymethyl cellulose, chitin, and chitosan. Among the compounds described above, a recombinant peptide is particularly preferred. These biocompatible polymers may be devised in order to increase the cell adhesiveness. Specifically, methods such as coating of a base material surface with a cell adhesion matrix (fibronectin, vitronectin, or laminin) or a cell adhesion sequence (an RGD sequence, a LDV sequence, a REDV sequence, a YIGSR sequence, a PDSGR sequence, a RYVVLPR sequence, a LGTIPG sequence, a RNIAEIIKDI sequence, an IKVAV sequence, a LRE sequence, a DGEA sequence, or a HAV sequence; all indicated by one-letter codes of amino acids) peptide, amination or cationization of the base material surface, or hydrophilic treatment of the base material surface by a plasma treatment or corona discharge can be used.
[0082] The type of the polypeptide such as a recombinant peptide or a chemically synthesized peptide is not particularly limited as long as the polypeptide has biocompatibility; however, for example, gelatin, collagen, elastin, fibronectin, pronectin, laminin, tenascin, fibrin, fibroin, entactin, thrombospondin, and retronectin are preferred, while gelatin, collagen, and atelocollagen are most preferred. Gelatin that is intended to be used in the invention is preferably naturally occurring gelatin, a recombinant gelatin, or a chemically synthesized gelatin, and more preferred is a recombinant gelatin. The term naturally occurring gelatin as used herein means a gelatin produced from naturally occurring collagen.
[0083] The term chemically synthesized peptide or chemically synthesized gelatin means a peptide or gelatin that has been artificially synthesized. Synthesis of a peptide such as gelatin may be solid-phase synthesis or liquid-phase synthesis; however, solid-phase synthesis is preferred. Solid-phase synthesis of peptides is well known to those ordinarily skilled in the art, and examples include a Fmoc group synthesis method of using a Fmoc group (Fluorenyl-Methoxy-Carbonyl group) as a protective group for an amino group; and a Boc group synthesis method of using a Boc group (tert-ButylOxyCarbonyl group) as a protective group for an amino group. Regarding preferred embodiments of the chemically synthesized gelatin, the matters described in section (1-3) Recombinant gelatin given below in the present specification can be applied.
[0084] Recombinant gelatin will be explained below in the present specification.
[0085] The hydrophilicity value 1/IOB value of the biocompatible polymer used in the invention is preferably from 0 to 1.0. The hydrophilicity value is more preferably from 0 to 0.6, and even more preferably from 0 to 0.4. IOB is an index of hydrophilicity/hydrophobicity based on an organic conceptual diagram showing the polarity/non-polarity of organic compounds suggested by FUJITA, Atsushi, and the details thereof are explained in, for example, Pharmaceutical Bulletin, Vol. 2, 2, pp. 163-173 (1954), Kagaku no Ryoiki (Domain of Chemistry), Vol. 11, 10, pp. 719-725 (1957), and Fragrance Journal, Vol. 50, pp. 79-82 (1981). To describe briefly, the root of all organic compounds is considered to be methane (CH.sub.4), and other compounds are all regarded as derivatives of methane. Certain values are set respectively for the number of carbon atoms, substituents, modified parts, rings, and the like of the compounds, and the scores are added to determine the organic values (OV) and the inorganic values (IV). These values are plotted on a graph, with the X-axis representing the organic values and the Y-axis representing the inorganic values. The IOB in the organic conceptual diagram means the ratio of the inorganic value (IV) with respect to the organic value (OV) in the organic conceptual diagram, that is, inorganic value (IV)/organic value (OV). Regarding the details of the organic conceptual diagram, reference can be made to Shinpan Yuki GainenzuKiso to Oyo(New Edition Organic Conceptual DiagramFundamentals and Applications) (written by KODA, Yoshio, et al., Sankyo Shuppan Co., Ltd., 2008). In the present specification, hydrophilicity and hydrophobicity is indicated with the 1/IOB value, which is the reciprocal of IOB. As the 1/IOB value is smaller (closer to 0), this indicates that the compound is hydrophilic.
[0086] By adjusting the 1/IOB value of the biocompatible polymer used in the invention to the range described above, the biocompatible polymer has higher hydrophilicity and has enhanced water absorbing properties. Accordingly, it is speculated that the high hydrophilicity acts effectively on the retention of nutrient components.
[0087] In a case in which the biocompatible polymer used in the invention is a polypeptide, the hydrophilicity/hydrophobicity index represented by the Grand average of hydropathicity (GRAVY) value of the polypeptide is preferably 0.3 or lower and 9.0 or higher, and more preferably 0.0 or lower and 7.0 or higher. The Grand average of hydropathicity (GRAVY) value can be obtained by the method described in Gasteiger E., Hoogland C., Gattiker A., Duvaud S., Wilkins M. R., Appel R. D., Bairoch A.; Protein Identification and Analysis Tools on the ExPASy Server; (In) John M. Walker (ed): The Proteomics Protocols Handbook, Humana Press (2005). pp. 571-607 and Gasteiger E., Gattiker A., Hoogland C., Ivanyi I., Appel R. D., Bairoch A.; ExPASy: the proteomics server for in-depth protein knowledge and analysis.; Nucleic Acids Res. 31: 3784-3788 (2003).
[0088] By adjusting the GRAVY value of the biocompatible polymer used in the invention to the range described above, the biocompatible polymer has higher hydrophilicity and has enhanced water absorbing properties. Accordingly, it is speculated that the high hydrophilicity acts effectively on the retention of nutrient components.
[0089] (1-2) Crosslinking
[0090] The biocompatible polymer used in the invention may be a crosslinked polymer, or may be a polymer that is not crosslinked; however, a crosslinked polymer is preferred. By using a crosslinked biocompatible polymer, there is obtained an effect that in a case in which the cartilage regenerative material of the invention is cultured in a medium, and in a case in which the cartilage regenerative material is transplanted into a living body, the cartilage regenerative material being instantaneously decomposed is prevented. Regarding general crosslinking methods, thermal crosslinking, crosslinking by means of an aldehyde (for example, formaldehyde or glutaraldehyde), crosslinking by means of a condensing agent (carbodiimide, cyanamide, or the like), enzymatic crosslinking, photocrosslinking, ultraviolet crosslinking, hydrophobic interaction, hydrogen bonding, ionic interaction, and the like are known. The crosslinking method used in the invention is preferably thermal crosslinking, ultraviolet crosslinking, or enzymatic crosslinking, and particularly preferably thermal crosslinking.
[0091] In a case in which enzyme-induced crosslinking is carried out, the enzyme is not particularly limited as long as the enzyme has an effect of crosslinking between polymer molecules; however, preferably a transglutaminase and a laccase, and most preferably a transglutaminase, can be used. There are no particular limitations on specific examples of the polymer that is enzymatically crosslinked by a transglutaminase as long as the polymer is a protein having a lysine residue and a glutamine residue. The transglutaminase may be a mammal-derived enzyme or a microbially derived enzyme, and specifically, ACTIVA series manufactured by Ajinomoto Co., Inc., and mammal-derived transglutaminases that are released as reagents, for example, Guinea pig liver-derived transglutaminase, goat-derived transglutaminase, and rabbit-derived transglutaminase, which are products of Oriental Yeast Co., Ltd.; Upstate USA, Inc.; Biodesign International, Inc.; and the like, and human-derived blood coagulation factor (Factor XIIIa, Haematologic Technologies, Inc.).
[0092] The reaction temperature in the case of performing crosslinking (for example, thermal crosslinking) is not particularly limited as long as crosslinking is enabled; however, the reaction temperature is preferably 100 C. to 500 C., more preferably 0 C. to 300 C., even more preferably 50 C. to 300 C., still more preferably 100 C. to 250 C., and even more preferably 120 C. to 200 C.
[0093] (1-3) Recombinant Gelatin
[0094] The recombinant gelatin as used herein means a polypeptide or protein-like substance having an amino acid sequence similar to that of gelatin, which is produced by a gene recombination technology. It is preferable that the recombinant gelatin that can be used in the invention has repeats of a sequence represented by Gly-X-Y (where X and Y each independently represent any amino acid residue), which is characteristic to collagen. Here, a plurality of the Gly-X-Y sequences may be identical to or different from one another. Preferably, two or more sequences of cell adhesion signals are included in one molecule. Regarding the recombinant gelatin that is used in the invention, a recombinant gelatin having an amino acid sequence derived from a partial amino acid sequence of collagen can be used. For example, the recombinant gelatins described in EP1014176B, U.S. Pat. No. 6,992,172B, WO2004/85473A, and WO2008/103041A can be used; however, the examples are not limited to these. Preferred examples of the recombinant gelatin that is used in the invention are recombinant gelatins of the following embodiments.
[0095] A recombinant gelatin has the original properties of naturally occurring gelatin and thus has excellent biocompatibility. Also, since it is not a substance derived from a natural source, a recombinant gelatin has no risk of bovine spongiform encephalopathy (BSE) or the like, and has an excellent characteristic of being non-infectious. Since a recombinant gelatin is homogeneous compared to naturally occurring gelatin and has a predetermined sequence, it is possible to precisely design a recombinant gelatin with fewer fluctuations, in connection with strength and degradability, through crosslinking or the like.
[0096] The molecular weight of the recombinant gelatin is not particularly limited; however, the molecular weight is preferably from 2,000 to 100,000 (from 2 kDa to 100 kDa), more preferably from 2,500 to 95,000 (from 2.5 kDa to 95 kDa), even more preferably from 5,000 to 90,000 (from 5 kDa to 90 kDa), and most preferably from 10,000 to 90,000 (from 10 kDa to 90 kDa).
[0097] It is preferable that the recombinant gelatin has repeats of a sequence represented by Gly-X-Y, which is characteristic to collagen. Here, a plurality of the Gly-X-Y sequences may be identical to or different from one another. In regard to the sequence Gly-X-Y, Gly represents glycine, and X and Y each represent an arbitrary amino acid (preferably, any arbitrary amino acid other than glycine). The sequence represented by Gly-X-Y characteristic to collagen is a highly specific partial structure present in the amino acid compositions and sequences of gelatin and collagen, compared to other proteins. In this partial structure, glycine accounts for about one-third of the whole composition, and in the amino acid sequence, glycine repeatedly appears at a rate of one in every three amino acid residues. Glycine is the simplest amino acid, and there are fewer restrictions to the arrangement in a molecular chain. Thus, glycine greatly contributes to regeneration of the helix structure in the case of gelation. It is preferable that the amino acids represented by X and Y include a large proportion of imino acids (proline and oxyproline), and imino acids account for 10% to 45% of the total amount of the amino acids. Preferably, amino acids that account for 80% or more, more preferably 95% or more, and most preferably 99% or more, of the sequence of the recombinant gelatin, constitute the repeating structure of Gly-X-Y.
[0098] In general gelatins, polar amino acids that have an electric charge and polar amino acids that are uncharged exist at a ratio of 1:1. Here, the term polar amino acid specifically refers to cysteine, aspartic acid, glutamic acid, histidine, lysine, asparagine, glutamine, serine, threonine, tyrosine, or arginine, and among these, polar uncharged amino acids include cysteine, asparagine, glutamine, serine, threonine, and tyrosine. In regard to the recombinant gelatin used in the invention, the proportion of polar amino acids among all the amino acids that constitute the recombinant gelatin is 10% to 40%, and preferably 20% to 30%. Meanwhile, the proportion of uncharged amino acids in the polar amino acids is preferably 5% or more and less than 20%, and more preferably 5% or more and less than 10%. It is also preferable that any one amino acid, and preferably 2 or more amino acids, of serine, threonine, asparagine, tyrosine, and cysteine are not included in the amino acid sequence.
[0099] Generally, in regard to polypeptides, minimal amino acid sequences that function as cell adhesion signal sequences are known (for example, Byotai Seiri (Pathophysiology), Vol. 9, No. 7 (1990), p. 527, published by Nagai Shoten Co., Ltd.). It is preferable that the recombinant gelatin used in the invention contains two or more such minimal amino acid sequences that function as cell adhesion signals in one molecule. Regarding specific sequences, from the viewpoint of being applicable to many kinds of adhering cells, an RGD sequence, a LDV sequence, a REDV sequence, a YIGSR sequence, a PDSGR sequence, a RYVVLPR sequence, a LGTIPG sequence, a RNIAEIIKDI sequence, an IKVAV sequence, a LRE sequence, a DGEA sequence, and a HAV sequence, which are expressed in one-letter codes of amino acids, are preferred. More preferred sequences include an RGD sequence, a YIGSR sequence, a PDSGR sequence, a LGTIPG sequence, an IKVAV sequence, and a HAV sequence, and particularly preferred is an RGD sequence. Among RGD sequences, an ERGD sequence is preferred. When a recombinant gelatin having cell adhesion signal sequences is used, the amount of cell matrix production can be increased. For example, in a case in which mesenchymal stem cells are used as cells, the production of glycosaminoglycans (GAG) in chondrocyte differentiation can be increased.
[0100] In regard to the disposition of RGD sequences in the recombinant gelatin used in the invention, it is preferable that the number of amino acids between RGD sequences is between 0 and 100, and preferably between 25 and 60, and is not uniform.
[0101] The content of these minimal amino acid sequences is preferably 3 to 50, more preferably 4 to 30, even more preferably 5 to 20, and most preferably 12, in one molecule of protein, from the viewpoints of cell adhesion and proliferation properties.
[0102] In regard to the recombinant gelatin used in the invention, the proportion of the RGD sequences (motifs) with respect to the total number of amino acid residues is preferably at least 0.4%. In a case in which a recombinant gelatin includes 350 or more amino acid residues, it is preferable that each stretch of 350 amino acid residues includes at least one RGD motif. The proportion of the RGD motif with respect to the total number of amino acid residues is more preferably at least 0.6%, even more preferably at least 0.8%, still more preferably at least 1.0%, even more preferably at least 1.2%, and most preferably at least 1.5%. The number of RGD motifs within a recombinant peptide is preferably at least 4, more preferably at least 6, even more preferably at least 8, still more preferably from 12 to 16, per 250 amino acid residues. The proportion of 0.4% of the RGD motifs corresponds to at least one RGD sequence per 250 amino acid residues. Since the number of the RGD motifs is an integer, in order to satisfy the characteristic requirement of 0.4%, a gelatin molecule containing 251 amino acid residues must include at least two RGD sequences. Preferably, the recombinant gelatin of the invention includes at least two RGD sequences per 250 amino acid residues; more preferably includes at least three RGD sequences per 250 amino acid residues; and even more preferably includes at least four RGD sequences per 250 amino acid residues. According to another embodiment of the recombinant gelatin of the invention, the recombinant gelatin includes at least four RGD motifs, preferably at least six RGD motifs, more preferably at least eight RGD motifs, and still more preferably from 12 to 16 RGD motifs.
[0103] The recombinant gelatin may be partially hydrolyzed.
[0104] Preferably, the recombinant gelatin used in the invention is represented by Formula 1: A-[(Gly-X-Y).sub.n].sub.m-B. n units of X each independently represent any one amino acid residue, and n units of Y each independently represent any one amino acid residue. m represents an integer from 2 to 10, and preferably 3 to 5. n represents an integer from 3 to 100, preferably 15 to 70, and more preferably 50 to 65. A represents an arbitrary amino acid residue or amino acid sequence, and B represents an arbitrary amino acid residue or amino acid sequence.
[0105] More preferably, the recombinant gelatin used in the invention is represented by formula: Gly-Ala-Pro-[(Gly-X-Y).sub.63].sub.3-Gly (in the formula, 63 units of X each independently represent any one amino acid residue; 63 units of Y each independently represent any one amino acid residue; and 63 units of Gly-X-Y may be identical to or different from one another).
[0106] It is preferable that a plurality of the sequence units of naturally occurring collagen are bonded to the repeating unit. The naturally occurring collagen as used herein may be any collagen substance that exists in nature; however, the collagen is preferably type I, type II, type III, type IV, or type V collagen. The collagen is more preferably type I, type II, or type III collagen. According to another embodiment, the source of the above-mentioned collagens is preferably human, cow, pig, mouse, or rat, and more preferably a human source.
[0107] The isoelectric point of the recombinant gelatin used in the invention is preferably 5 to 10, more preferably 6 to 10, and even more preferably 7 to 9.5.
[0108] Preferably, the recombinant gelatin is not deaminated.
[0109] Preferably, the recombinant gelatin does not have a telopeptide.
[0110] Preferably, the recombinant gelatin is a substantially pure polypeptide produced from a nucleic acid that encodes an amino acid sequence.
[0111] The recombinant gelatin used in the invention is particularly preferably:
[0112] (1) a peptide comprising the amino acid sequence set forth in SEQ ID NO:1;
[0113] (2) a peptide having biocompatibility and comprising an amino acid sequence obtained by modifying the amino acid sequence set forth in SEQ ID NO:1 by deletion, substitution or addition of one or several amino acid residues; or
[0114] (3) a peptide having biocompatibility and comprising an amino acid sequence having at least 80% (preferably at least 90%, more preferably at least 95%, and most preferably at least 98%) sequence identity with the amino acid sequence set forth in SEQ ID NO:1.
[0115] The term one or several in the phrase amino acid sequence obtained by modifying . . . by deletion, substitution or addition of one or several amino acid residues means preferably 1 to 20, more preferably 1 to 10, even more preferably 1 to 5, and particularly preferably 1 to 3.
[0116] The recombinant gelatin used in the invention can be produced by a gene recombination technology that is known to those ordinarily skilled in the art, and the recombinant gelatin can be produced according to the methods described in, for example, EP1014176A2, U.S. Pat. No. 6,992,172B, WO2004/85473A, and WO2008/103041A. Specifically, a gene that encodes the amino acid sequence of a predetermined recombinant gelatin is obtained, this is incorporated into an expression vector to produce a recombinant expression vector, and this is introduced into an appropriate host. Thus, a transformant is produced. The transformant thus obtained is cultured in an appropriate medium, and thereby, a recombinant gelatin is produced. Then, the recombinant gelatin thus produced is collected from the culture product. Thereby, the recombinant gelatin used in the invention can be produced.
[0117] (1-4) Method for Producing Porous Body of Biocompatible Polymer
[0118] The method for producing a porous body of a biocompatible polymer is not particularly limited; however, for example, a porous body of a biocompatible polymer can be obtained by freeze-drying an aqueous solution including a biocompatible polymer. As an example of the method for producing a porous body of a biocompatible polymer, there may be mentioned a production method including:
[0119] (a) a step of cooling a solution of a biocompatible polymer to an unfrozen state at a temperature at which the difference between the temperature of a part having the highest liquid temperature in the solution and the temperature of a part having the lowest liquid temperature in the solution is 2.5 C. or less, and the temperature of the part having the highest liquid temperature in the solution is lower than or equal to the melting point of the solvent;
[0120] (b) a step of freezing the solution in an unfrozen state of the biocompatible polymer obtained in Step (a); and
[0121] (c) a step of freeze-drying the frozen solution of the biocompatible polymer obtained in Step (b).
[0122] In a case in which the biocompatible polymer solution is cooled to an unfrozen state, as the difference between the temperature of a part having the highest liquid temperature in the solution and the temperature of a part having the lowest liquid temperature in the solution is adjusted to be 2.5 C. or less (preferably 2.3 C. or less, and more preferably 2.1 C. or less), that is, as the difference in temperature is adjusted to be smaller, the difference in the size of the pores in the porous body thus obtainable is made smaller. The lower limit of the difference between the temperature of a part having the highest liquid temperature in the solution and the temperature of a part having the lowest liquid temperature in the solution is not particularly limited, and the temperature difference may be 0 C. or more, and for example, may be 0.1 C. or more, 0.5 C. or more, 0.8 C. or more, or 0.9 C. or more. A porous body produced thereby can achieve a superior cartilage regeneration effect.
[0123] In regard to the cooling of Step (a), it is preferable to perform cooling by means of, for example, a material having a thermal conductivity lower than that of water (preferably, TEFLON (registered trademark)), and the part having the highest liquid temperature in the solution can be assumed to be a part remotest from the cooling surface, and the part having the lowest liquid temperature in the solution can be assumed to be the liquid temperature at the cooling surface.
[0124] Preferably, in Step (a), the difference between the temperature of a part having the highest liquid temperature in the solution and the temperature of a part having the lowest liquid temperature in the solution immediately before the generation of the heat of solidification is 2.5 C. or less, more preferably 2.3 C. or less, and even more preferably 2.1 C. or less. Here, the temperature difference immediately before the generation of the heat of solidification means the temperature difference at the time when the temperature difference becomes the largest in a time period between 1 second and 10 seconds before the generation of the heat of solidification.
[0125] Preferably, in Step (a), the temperature of a part having the lowest liquid temperature in the solution is (melting point of the solvent5 C.) or lower, more preferably (melting point of the solvent5 C.) or lower and (melting point of the solvent20 C.) or higher, and even more preferably (melting point of the solvent6 C.) or lower and (melting point of the solvent16 C.) or higher. The solvent of the melting point of the solvent is the solvent of the solution of the biocompatible polymer.
[0126] In Step (b), the solution of the biocompatible polymer in an unfrozen state obtained in Step (a) is frozen. The cooling temperature for freezing in Step (b) is not particularly limited and may vary depending on the cooling equipment. Preferably, the cooling temperature is a temperature lower by 3 C. to 30 C., more preferably a temperature lower by 5 C. to 25 C., and even more preferably a temperature lower by 10 C. to 20 C., than the temperature of the part having the lowest liquid temperature in the solution.
[0127] In Step (c), the frozen solution of the biocompatible polymer obtained in Step (b) is freeze-dried. Freeze-drying can be carried out by a conventional method, and for example, freeze-drying can be carried out by performing vacuum drying at a temperature lower than the melting point of the solvent, and further performing vacuum drying at room temperature (20 C.).
[0128] The shape and size of the porous body of the biocompatible polymer are not particularly limited, and a porous body having an appropriate shape and an appropriate size for the purpose of use can be used. Examples of the shape include, but are not particularly limited to, a cylinder and a cuboid, and any shape that coincides with the shape of the defect part, which is an affected part, can be employed. The size of the cylinder is preferably such that the diameter is 2 mm to 2 cm, and the height (thickness) is 1 mm to 2 cm. The size of the cuboid is preferably such that the longitudinal length and the horizontal length are 2 mm to 2 cm, and the height (thickness) is 1 mm to 2 cm.
[0129] The average pore size of the porous body of the biocompatible polymer is not particularly limited; however, the average pore size is preferably 10 to 400 m, more preferably 20 to 200 m, even more preferably 30 to 100 m, and particularly preferably 40 to 90 m. The average pore size of the porous body can be measured according to the method described in [8] Evaluation of pore size of recombinant peptide porous body in the Examples.
[0130] (2) Chondrocytes and Cartilage Matrix
[0131] Regarding the chondrocytes used in the invention, any chondrocytes can be used as long the cells are capable of cell transplantation and exhibiting cartilage regenerative capacity, and the type of the cells is not particularly limited. Furthermore, one kind of chondrocytes may be used, or multiple kinds of chondrocytes may also be used in combination. Furthermore, the chondrocytes to be used are preferably animal cells, more preferably vertebrate-derived cells, and particularly preferably human-derived cells. Regarding the chondrocytes, at least one type of chondrocytes selected from the group consisting of articular cartilage-derived chondrocytes, auricular cartilage-derived chondrocytes, nasal cartilage-derived chondrocytes, induced pluripotent stem cell (iPS cell)-derived chondrocytes, embryonic stem cell (ES cell)-derived chondrocytes, mesenchymal stem cell (MSC)-derived chondrocytes, and chondrocytes obtained by a direct reprogramming method, can be used. A direct reprogramming method is a technique of directly changing cells such as fibroblasts extracted from the skin to chondrocytes. The origin of the cells may be any of autologous cells and heterologous cells.
[0132] Cartilage matrix means components produced by chondrocytes, and it is mainly extracellular matrix. Cartilage matrix includes glycosaminoglycans (GAG), chondroitin sulfate, and proteoglycans as main components, and depending on cases, cartilage matrix also includes collagenous fibers and elastic fibers. The presence of the cartilage matrix can be checked by safranin O staining.
[0133] The amount of use of chondrocytes with respect to the porous body of a biocompatible polymer is not particularly limited; however, the amount of use is preferably 1.010.sup.5 cells/cm.sup.3 to 1.010.sup.8 cells/cm.sup.3, more preferably 1.010.sup.6 cells/cm.sup.3 to 5.010.sup.7 cells/cm.sup.3, and even more preferably 2.010.sup.6 cells/cm.sup.3 to 1.010.sup.7 cells/cm.sup.3, per unit volume of the porous body of the biocompatible polymer. As the lower limit is adjusted to the range described above, the effects of the cells can be exhibited in a case in which the cells are used for transplantation applications, and as the upper limit is adjusted to the range described above, the components that may be optionally present inside the porous body of the biocompatible polymer can be supplied to the cells. Here, the components inside the porous body of a biocompatible polymer are not particularly limited; however, the components that are included in the medium that will be described below may be mentioned.
[0134] (3) Biocompatible Polymer Film
[0135] The cartilage regenerative material of the invention includes a biocompatible polymer film together with a porous body of a biocompatible polymer. That is, according to the invention, a porous body of a biocompatible polymer including chondrocytes and cartilage matrix is used in combination with a biocompatible polymer film.
[0136] The porous body of a biocompatible polymer and the biocompatible polymer film may be supplied separately in the form of kits, or the porous body of a biocompatible polymer and the biocompatible polymer film may also be supplied in the form of a product bonded together. Preferably, the porous body of a biocompatible polymer and the biocompatible polymer film are in the form of separate kits.
[0137] In a case in which the porous body of a biocompatible polymer and the biocompatible polymer film are supplied separately in the form of kits, the user may bond the porous body of a biocompatible polymer and the biocompatible polymer film together and then transplant the resultant. Alternatively, the use may transplant the biocompatible polymer film and then transplant the porous body of a biocompatible polymer.
[0138] It is preferable that the biocompatible polymer film is used as a film for isolating a portion or the entirety of the transplant face of the porous body of a biocompatible polymer from the site of transplantation. For example, it is preferable that the biocompatible polymer film is transplanted first onto the site of transplantation, and subsequently, the porous body of a biocompatible polymer is transplanted onto the top surface (surface on the opposite side of the surface that is in contact with the site of transplantation) of the biocompatible polymer film. Alternatively, in a case in which the porous body of a biocompatible polymer and the biocompatible polymer film are bonded together and then transplanted, it is preferable to transplant the biocompatible polymer film so as to be brought into direct contact with the site of transplantation.
[0139] Specific examples and preferred ranges of the biocompatible polymer that constitutes the biocompatible polymer film are the same as those in the case of the biocompatible polymer that constitutes the porous body of a biocompatible polymer, and specifically, the specific examples and the preferred ranges are as described in the above sections (1-1) Biocompatible polymer, (1-2) Crosslinking, and (1-3) Recombinant gelatin in the present specification. The biocompatible polymer that constitutes the biocompatible polymer film may be the same as, or may be different from, the biocompatible polymer that constitutes the porous body of a biocompatible polymer.
[0140] The method for producing a biocompatible polymer film is not particularly limited, and the production can be carried out by a conventional method. For example, a biocompatible polymer film can be produced by causing an aqueous solution of a biocompatible polymer to flow into a plastic tray, and drying the aqueous solution at low temperature (for example, in a refrigerator).
[0141] The biocompatible polymer film can be crosslinked. In a case in which the polymer film is crosslinked, the degree of crosslinking is not particularly limited; however, the degree of crosslinking is generally 4 to 15, more preferably 6 to 13, even more preferably 4 to 8, and particularly preferably 5 to 7. The degree of crosslinking is the number of crosslinks per molecule. Measurement of the degree of crosslinking can be carried out using the TNBS (2,4,6-trinitrobenzenesulfonic acid) method described in section [10] Method for measuring degree of crosslinking in the Examples.
[0142] The rate of decomposition of the biocompatible polymer film varies depending on the degree of crosslinking. The rate of decomposition of the biocompatible polymer film can be measured and evaluated by the method described below in section [11] Method for measuring rate of decomposition in the Examples.
[0143] Specifically, 5 mg of a sample (film) is introduced into a tube, the mass of which has been measured in advance, and the actual amount of addition is recorded. 2.5 mg of Actinomyces-derived collagenase is dissolved in 50 ml of phosphate buffered saline (PBS), and a collagenase solution is obtained. 1 ml of this collagenase solution is added to the tube containing the sample, and the content is mixed by vortexing. Subsequently, the mixture is shaken for a predetermined time (=T) at 37 C. Subsequently, the tube is centrifuged for 1 minute at 10,000 G, and the supernatant is removed using a pipette. 1 ml of ultrapure water is added to the tube, and the content is mixed by vortexing. Subsequently, the tube is centrifuged for 1 minute at 10,000 G, and the supernatant is removed using a pipette. This operation is repeated one more time. Subsequently, the sample is freeze-dried, and the mass of the tube containing the sample is recorded. The rate of decomposition of the film is calculated by the following formula (Formula 4).
Rate of decomposition=((WWe)wo)/wo/T (Formula 4)
[0144] In Formula 4, W represents the mass of the tube containing the sample, which was recorded after freeze-drying; and We represents the blank mass of the tube that was recorded in advance. wo represents the actual amount of addition of the sample. T represents the time taken for shaking in the collagenase solution.
[0145] The rate of decomposition of the biocompatible polymer film measured by the method described above is not particularly limited; however, the rate of decomposition is generally 0.1 to 20 [mass %/hour], preferably 0.5 to 20 [mass %/hour], more preferably 1 to 10 [mass %/hour], and particularly preferably 5 to 10 [mass %/hour].
[0146] (4) Method for Producing Cartilage Regenerative Material
[0147] The invention also provides a method for producing the cartilage regenerative material of the invention described above.
[0148] The production method includes Step A of freeze-drying an aqueous solution including a biocompatible polymer and obtaining a porous body; Step B of inoculating chondrocytes into the porous body obtained in Step A and culturing the chondrocytes; and Step C of providing a biocompatible polymer film.
[0149] Step A can be carried out as described in the above section (1-4) Method for producing porous body of biocompatible polymer. In Step A, preferably, a porous body can be obtained by stirring an aqueous solution including a biocompatible polymer and then freeze-drying the aqueous solution.
[0150] Step B is a step of inoculating chondrocytes into the porous body and culturing the chondrocytes. The inoculation and culturing of chondrocytes in the porous body can be carried out by a conventional method.
[0151] By regulating the amount of use of chondrocytes with respect to the porous body and the duration of culture, the proportion of the region in which the cartilage matrix exists in a region extending from the surface of the transplant face of the porous body to a depth of 150 m along the thickness (cartilage matrix filling proportion on the transplant face side) and the proportion of the region in which cartilage matrix exists in a region extending from the surface of the articular cavity face of the porous body to a depth of 150 m along the thickness (cartilage matrix filling proportion on the articular cavity face side) can be regulated.
[0152] Step C is a step of providing a biocompatible polymer film. As described in the above section (3) Biocompatible polymer film in the present specification, a biocompatible polymer film can be provided.
[0153] (5) Method of Using Cartilage Regenerative Material
[0154] The cartilage regenerative material of the invention can be used for the purpose of cell transplantation to a diseased site of cartilage defect. Examples of the disease associated with cartilage defect include, but are not particularly limited to, arthrosis deformans, osteochondral defect, osteochondritis dissecans, traumatic cartilage injury, osteoarthritis, relapsing polychondritis, achondroplasia, injury of intervertebral discs, and hernia of intervertebral discs.
[0155] Examples of the method for transplantation include incision, injection, arthroscopy, and endoscopy. Regarding the cartilage regenerative material of the invention, unlike cell transplants such as a cell sheet, the size of the cartilage regenerative material can be made small, and therefore, a less invasive transplantation method such as transplantation by injection is enabled.
[0156] As described in section [19] Evaluation of effectiveness of split transplantation of sponge with cartilage matrix (sufficient cartilage matrix filling proportion) in the Examples, it has been verified, concerning the cartilage regenerative material of the invention, that cartilage regeneration is recognized even in a case in which the cartilage regenerative material is subjected to split transplantation. Therefore, it is also possible to split a porous body including chondrocytes and cartilage matrix once and then transplant the split parts onto the site of defect.
[0157] Furthermore, as described in section [20] Verification of whether fixation to site of defect is appropriate in the Examples, the cartilage regenerative material of the invention is such that the cartilage regenerative material can be fixed to a site of defect with pins after transplantation. The material of the pins is not particularly limited; however, it is preferable to use a biocompatible polymer. Specific examples and preferred range of the biocompatible polymer that constitutes the pins are the same as those in the case of the biocompatible polymer that constitutes the porous body of a biocompatible polymer, and specifically, the specific examples and the preferred range are as described in the above sections (1-1) Biocompatible polymer, (1-2) Crosslinking, and (1-3) Recombinant gelatin in the present specification. The biocompatible polymer that constitutes the pins may be the same as, or may be different from, the biocompatible polymer that constitutes the porous body of a biocompatible polymer.
[0158] The amount used in the case of transplanting the cartilage regenerative material of the invention can be appropriately selected according to the diseased state or the like; however, the number of cells to be transplanted is preferably 1.010.sup.4 cells/cm.sup.3 to 2.010.sup.7 cells/cm.sup.3, and more preferably 2.510.sup.5 cells/cm.sup.3 to 5.010.sup.6 cells/cm.sup.3.
[0159] Regarding the number of times of transplantation of the cartilage regenerative material of the invention, transplantation may be carried out only once, or transplantation may be carried out two or more times as necessary.
[0160] (6) Applications and Cartilage Regeneration Method
[0161] According to the invention, there is provided a cartilage regenerative material intended for use for the treatment of cartilage regeneration, the cartilage regenerative material including a porous body of a biocompatible polymer and a biocompatible polymer film, in which the porous body contains chondrocytes and cartilage matrix, and the cartilage matrix exists in a region of 10% or more of a region extending from the surface of the transplant face of the porous body to a depth of 150 m along the thickness. Preferred ranges of the various constituent components are similar to those described above in the present specification.
[0162] According to the invention, there is provided a cartilage regeneration method including a step of transplanting the cartilage regenerative material of the invention as described above, to a patient in need of cartilage regeneration. Preferred ranges of the various constituent components of the cartilage regenerative material are as described above in the present specification.
[0163] According to the invention, there is provided use of a porous body of a biocompatible polymer and a biocompatible polymer film for the production of a cartilage regenerative material, in which the porous body contains chondrocytes and cartilage matrix, and the cartilage matrix exists in a region of 10% or more of a region extending from the surface of the transplant face of the porous body to a depth of 150 m along the thickness. Preferred ranges of the porous body of a biocompatible polymer and the biocompatible polymer film are as described above in the present specification.
[0164] The invention will be explained more specifically by way of the following Examples; however, the invention is not intended to be limited by the following Examples.
EXAMPLES
[0165] [1] Recombinant Peptide (Recombinant Gelatin)
[0166] As a recombinant peptide (recombinant gelatin), the following CBE3 was prepared (described in WO2008/103041A).
[0167] CBE3:
[0168] Molecular weight: 51.6 kD
[0169] Structure: GAP[(GXY).sub.63].sub.3G
[0170] Number of amino acid residues: 571
[0171] RGD sequence: 12 sequences
[0172] Imino acid content: 33%
[0173] Almost 100% of the amino acid residues constitute a repeating structure of GXY. Serine, threonine, asparagine, tyrosine, and cysteine were not included in the amino acid sequence of CBE3. CBE3 comprises an ERGD sequence.
[0174] Isoelectric point: 9.34
[0175] GRAVY value: 0.682
[0176] 1/IOB value: 0.323
[0177] Amino acid sequence (SEQ ID NO:1 in the Sequence Listing) (Identical to SEQ ID NO:3 disclosed in WO2008/103041A. However, X at the end was corrected to P)
TABLE-US-00001 GAP(GAPGLQGAPGLQGMPGERGAAGLPGPKGERGDAGPKGADGAPGAPG LQGMPGERGAAGLPGPKGERGDAGPKGADGAPGKDGVRGLAGPIGPPGER GAAGLPGPKGERGDAGPKGADGAPGKDGVRGLAGPIGPPGPAGAPGAPGL QGMPGERGAAGLPGPKGERGDAGPKGADGAPGKDGVRGLAGPP)3G
[0178] Furthermore, a porous body and a sponge according to the present specification are synonyms.
[0179] [2] Production of Recombinant Peptide Porous Body
[0180] [PTFE Thick Cylindrical Container]
[0181] A cylindrical cup-shaped container made of polytetrafluoroethylene (PTFE) and having a bottom face thickness of 3 mm, a diameter of 51 mm, a lateral face thickness of 8 mm, and a height of 25 mm was prepared. The cylindrical cup was such that when the curved face was erected as the lateral face, the lateral face was closed with a PTFE plate having a thickness of 8 mm, and the bottom face (circular-shaped flat plate) was also closed with a PTFE plate having a thickness of 3 mm. Meanwhile, the cylindrical cup had an open top face. Therefore, the inner diameter of the cylindrical cup was 43 mm. Hereinafter, this container will be referred to as PTFE thick cylindrical container.
[0182] [Aluminum Glass Plate Cylindrical Container]
[0183] A cylindrical cup-shaped container made of aluminum and having a thickness of 1 mm and a diameter of 47 mm was prepared. The cylindrical cup was such that when the curved face was erected as the lateral face, the lateral face was closed with an aluminum plate with a thickness of 1 mm, and the bottom face (circular-shaped flat plate) was also closed with an aluminum plate having a thickness of 1 mm. Meanwhile, the cylindrical cup had an open top face. A TEFLON (registered trademark) plate having a thickness of 1 mm was uniformly lined over the entire surface on the inner side of the lateral face, and as a result, the inner diameter of the cylindrical cup was 45 mm. The bottom face of this container was in a state of being joined with a glass plate having a thickness of 2.2 mm on the outside of aluminum. Hereinafter, this container will be referred to as an aluminum glass cylindrical container.
[0184] [Freezing Step with Small Temperature Difference, and Drying Step]
[0185] An aqueous solution of CBE3 was poured respectively into the PTFE thick cylindrical container and the aluminum glass plate cylindrical container, and the aqueous solution of CBE3 was cooled through the bottom face using a cooling shelf board inside a vacuum freeze-drying machine (TF5-85ATNNN: Takara Co., Ltd.).
[0186] The container, the final concentration of the aqueous solution of CBE3, the liquid amount, and the setting of the shelf board temperature employed in this case were as described below.
[0187] Condition A:
[0188] PTFE thick cylindrical container, final concentration of the aqueous solution of CBE3: 4 mass %, amount of the aqueous solution: 4 mL. Regarding the setting of the shelf board temperature, cooling was performed until the temperature reached 10 C., and freezing was performed for 1 hour at 10 C., subsequently for 2 hours at 20 C., for 3 hours at 40 C., and lastly for 1 hour at 50 C. Subsequently, the shelf board temperature was returned to the setting of 20 C., and then the present frozen product was subjected to vacuum drying for 24 hours at 20 C. After 24 hours, while vacuum drying was still continued, the shelf board temperature was raised to 20 C., and vacuum drying was performed for another 48 hours at 20 C. until the degree of vacuum sufficiently decreased (1.910.sup.5 Pa). Subsequently, the frozen product was removed from the vacuum freeze-drying machine. Thus, a porous body was obtained.
[0189] Condition B:
[0190] Aluminum glass plate cylindrical container, final concentration of aqueous solution of CBE3: 4 mass %, amount of the aqueous solution: 4 mL. Regarding the setting of the shelf board temperature, cooling was performed until the temperature reached 10 C., and freezing was performed for 1 hour at 10 C., subsequently for 2 hours at 20 C., for 3 hours at 40 C., and lastly for 1 hour at 50 C. Subsequently, the shelf board temperature was returned to the setting of 20 C., and then the present frozen product was subjected to vacuum drying for 24 hours at 20 C. After 24 hours, while vacuum drying was still continued, the shelf board temperature was raised to 20 C., and vacuum drying was performed for another 48 hours at 20 C. until the degree of vacuum sufficiently decreased (1.910.sup.5 Pa). Subsequently, the frozen product was removed from the vacuum freeze-drying machine. Thus, a porous body was obtained.
[0191] Condition C:
[0192] PTFE thick cylindrical container, final concentration of the aqueous solution of CBE3: 4 mass %, amount of the aqueous solution: 10 mL. Regarding the setting of the shelf board temperature, cooling was performed until the temperature reached 10 C., and freezing was performed for 1 hour at 10 C., subsequently for 2 hours at 20 C., for 3 hours at 40 C., and lastly for 1 hour at 50 C. Subsequently, the shelf board temperature was returned to the setting of 20 C., and then the present frozen product was subjected to vacuum drying for 24 hours at 20 C. After 24 hours, while vacuum drying was still continued, the shelf board temperature was raised to 20 C., and vacuum drying was performed for another 48 hours at 20 C. until the degree of vacuum sufficiently decreased (1.910.sup.5 Pa). Subsequently, the frozen product was removed from the vacuum freeze-drying machine. Thus, a porous body was obtained.
[0193] [3] Measurement of Temperature Difference in Various Freezing Steps
[0194] In regard to each of Condition A to Condition C, the liquid temperature of the liquid surface at the circle center in the container was measured as the liquid temperature at the remotest place from the cooling side (non-cooling surface liquid temperature) within the solution, and the liquid temperature at the bottom in the container was measured as the liquid temperature closest to the cooling side (cooling surface liquid temperature) within the solution.
[0195] As a result, the profiles of the respective temperatures and the temperature differences were obtained as shown in
[0196] From these
[0197] In the following description, the temperature difference at the time when the non-cooling surface liquid temperature reached the melting point (0 C.), the temperature difference immediately before lowering of the shelf board temperature from 10 C. to 20 C., and the temperature difference immediately before the generation of the heat of solidification will be described in conjunction with Condition A, Condition B, and Condition C. The temperature difference immediately before as used in the present specification means the largest temperature difference among the temperature differences detectable in a period between 1 second and 20 seconds before the main event.
[0198] Condition A
[0199] Temperature difference at the time when the liquid temperature of the non-cooling surface reached the melting point (0 C.): 1.1 C.
[0200] Temperature difference immediately before lowering from 10 C. to 20 C.: 0.2 C.
[0201] Temperature difference immediately before the generation of the heat of solidification: 1.1 C.
[0202] Condition B
[0203] Temperature difference at the time when the liquid temperature of the non-cooling surface reached the melting point (0 C.): 1.0 C.
[0204] Temperature difference immediately before lowering from 10 C. to 20 C.: 0.1 C.
[0205] Temperature difference immediately before the generation of the heat of solidification: 0.9 C.
[0206] Condition C
[0207] Temperature difference at the time when the liquid temperature of the non-cooling surface reached the melting point (0 C.): 1.8 C.
[0208] Temperature difference immediately before lowering from 10 C. to 20 C.: 1.1 C.
[0209] Temperature difference immediately before the generation of the heat of solidification: 2.1 C.
[0210] Hereinafter, these will be referred to as freezing step with small temperature difference/porous body.
[0211] [4] Freezing Step with Small Temperature Difference in 1 Mass % Ethanol-Containing Solution, and Drying Step
[0212] A 1 mass % (w/w) ethanol-containing aqueous solution of CBE3 was respectively poured into the PTFE thick cylindrical container and the aluminum glass plate cylindrical container, and the aqueous solution of CBE3 was cooled through the bottom face using a cooling shelf board inside a vacuum freeze-drying machine (TF5-85ATNNN: Takara Co., Ltd.). Since an ethanol-containing aqueous solution at a final concentration of 1 mass % was used, the melting point was 0.4 C. The melting point change at the ethanol/water concentration ratio was calculated from literature Pickering S. U.: A Study of the Properties of Some Strong Solutions. J. Chem. Soc. London, 63 (1893), 998-1027.
[0213] The container, the final concentration of the aqueous solution of CBE3, the liquid amount, and the setting of the shelf board temperature employed in this case were as described below.
[0214] Condition AA:
[0215] PTFE thick cylindrical container, final concentration of the aqueous solution of CBE3: 4 mass %, final ethanol concentration: 1 mass %, amount of the aqueous solution: 4 mL. Regarding the setting of the shelf board temperature, cooling was performed until the temperature reached 10 C., and freezing was performed for 1 hour at 10 C., subsequently for 2 hours at 20 C., for 3 hours at 40 C., and lastly for 1 hour at 50 C. Subsequently, the shelf board temperature was returned to the setting of 20 C., and then the present frozen product was subjected to vacuum drying for 24 hours at 20 C. After 24 hours, while vacuum drying was still continued, the shelf board temperature was raised to 20 C., and vacuum drying was performed for another 48 hours at 20 C. until the degree of vacuum sufficiently decreased. Subsequently, the frozen product was removed from the vacuum freeze-drying machine. Thus, a porous body was obtained.
[0216] Condition BB:
[0217] Aluminum glass plate cylindrical container, final concentration of the aqueous solution of CBE3: 4 mass %, final ethanol concentration: 1 mass %, amount of the aqueous solution: 4 mL. Regarding the setting of the shelf board temperature, cooling was performed until the temperature reached 10 C., and freezing was performed for 1 hour at 10 C., subsequently for 2 hours at 20 C., for 3 hours at 40 C., and lastly for 1 hour at 50 C. Subsequently, the shelf board temperature was returned to the setting of 20 C., and then the present frozen product was subjected to vacuum drying for 24 hours at 20 C. After 24 hours, while vacuum drying was still continued, the shelf board temperature was raised to 20 C., and vacuum drying was performed for another 48 hours at 20 C. until the degree of vacuum sufficiently decreased. Subsequently, the frozen product was removed from the vacuum freeze-drying machine. Thus, a porous body was obtained.
[0218] [Measurement of Temperature Difference of 1 Mass % Ethanol-Containing Solution in Freezing Step]
[0219] In regard to Condition AA and Condition BB, the liquid temperature of the liquid surface at the circle center in the container was measured as the liquid temperature at the remotest place from the cooling side (non-cooling surface liquid temperature) within the solution, and the liquid temperature at the bottom in the container was measured as the liquid temperature closest to the cooling side (cooling surface liquid temperature) within the solution. Here, since 1 mass % ethanol was used as the solvent, the solvent melting point was 0.4 C. The melting point change at the ethanol/water concentration ratio was calculated from literature Pickering S. U.: A Study of the Properties of Some Strong Solutions. J. Chem. Soc. London, 63 (1893), 998-1027.
[0220] As a result, the profiles of the respective temperatures and the temperature differences were obtained as shown in
[0221] In the following description, the temperature difference at the time when the non-cooling surface liquid temperature reached the melting point (0.4 C.), the temperature difference immediately before lowering of the shelf board temperature from 10 C. to 20 C., and the temperature difference immediately before the generation of the heat of solidification will be described in conjunction with Condition AA and Condition BB.
[0222] Condition AA
[0223] Temperature difference at the time when the liquid temperature of the non-cooling surface reached the melting point (0.4 C.): 0.8 C.
[0224] Temperature difference immediately before lowering from 10 C. to 20 C.: 0.3 C.
[0225] Temperature difference immediately before the generation of the heat of solidification: 0.8 C.
[0226] Condition BB
[0227] Temperature difference at the time when the liquid temperature of the non-cooling surface reached the melting point (0.4 C.): 1.3 C.
[0228] Temperature difference immediately before lowering from 10 C. to 20 C.: 0.0 C.
[0229] Temperature difference immediately before the generation of the heat of solidification: 1.3 C.
[0230] As a result, it was found that even under Condition AA and Condition BB, the porous body can be produced as freezing step with small temperature difference/porous body, similarly to Condition A and Condition B.
[0231] [5] Production of Recombinant Peptide Tin Layer Frozen Porous Body
[0232] A cylindrical cup-shaped container made of aluminum and having a thickness of 1 mm and a diameter of 47 mm was prepared. The cylindrical cup was such that when the curved face was erected as the lateral face, the lateral face was closed with an aluminum plate having a thickness of 1 mm, and the bottom face (circular-shaped flat plate) was also closed with an aluminum plate having a thickness of 1 mm. Meanwhile, the cylindrical cup had an open top face. A TEFLON (registered trademark) plate having a thickness of 1 mm was uniformly lined over the entire surface on the inner side of the lateral face, and as a result, the inner diameter of the cylindrical cup was 45 mm. Hereinafter, this container will be referred to as cylindrical container.
[0233] An aqueous solution of CBE3 was prepared, and this aqueous solution of CBE3 was caused to flow into the cylindrical container. The aqueous solution of CBE3 was cooled through the bottom face using a cooling shelf board inside a refrigerator. In this case, the temperature of the cooling shelf board, the thickness of the heat-insulating plate (glass plate) interposed between the shelf board and the cylindrical container, the final concentration of the aqueous solution of CBE3 to be introduced, and the amount of the aqueous solution were as described below. Temperature of shelf board: 40 C., thickness of glass plate: 2.2 mm, final concentration of aqueous solution of CBE3: 4.0%, amount of aqueous solution: 4 mL. The frozen CBE3 block obtained as described above was freeze-dried, and a CBE3 porous body was obtained. The porous body obtained as described above will be hereinafter referred to as thin layer frozen porous body.
[0234] [6] Production of Recombinant Peptide Porous Body by Stirring
[0235] A stirring method porous body was produced using the recombinant peptide CBE3. In the present Example, a solution was prepared at the following composition, and the solution was stirred for 30 seconds at 17,000 rpm with a homogenizer (AM-11, manufactured by Nihon Seiki Co., Ltd.) at 4 C. The solution was transferred into an aluminum cup container and was rapidly cooled for 3 hours at 80 C. Subsequently, freeze-drying was performed for 3 days in a freeze-dryer, and thus a porous body was obtained. The porous body obtained as described above will be hereinafter referred to as stirring method porous body.
[0236] Composition: 10-mL portion of 10 mass % of porous body (CBE3: 1,000 mg, ultrapure water: 9,895 L, 1 mol/L HCl: 105 L)
[0237] [7] Crosslinking of Recombinant Peptide Porous Body
[0238] For the freezing step with small temperature difference/porous body obtained in the above section [2] and [3], the ethanol-containing freezing step with small temperature difference/porous body obtained in the above section [4], the thin layer frozen porous body obtained in the above section [5], and the stirring method porous body obtained in the above section [6], the respective porous bodies were subjected to thermal crosslinking for 20 hours at 160 C. under reduced pressure.
[0239] [8] Evaluation of Pore Size of Recombinant Peptide Porous Body
[0240] The various porous bodies obtained in the above section [7] were swollen with physiological saline for a sufficient time. Subsequently, frozen tissue slices were produced with a microtome, and HE (haematoxylin and eosin) stained specimens were produced. Cross-sectional images having a size of 1.5 mm on the actual scale were prepared from the specimens, and the individual pore areas were measured. Subsequently, the equivalent circle diameter obtainable in a case in which the area was considered equivalent to a circle was calculated, and this value was designated as the pore size. The average value of 20 or more sites of these pores was designated as the average pore size. As a result, the average pore size of the freezing step with small temperature difference/porous body derived from sections [2] and [3] was 59 m, the average pore size of the ethanol-containing freezing step with small temperature difference/porous body derived from section [4] was 72 m, the average pore size of the stirring method porous body derived from section [6] was 82 m, and the average pore size of the thin layer frozen porous body derived from section [5] was 45 m.
[0241] [9] Method for Producing Recombinant Peptide Film
[0242] An aqueous solution of CBE3 at a concentration of 4 mass % was prepared, and 5.4 ml of this aqueous solution of CBE3 was caused to flow into a plastic tray provided with a silicon frame (8 cm3.5 cm). This plastic tray was transferred into a refrigerator, and the aqueous solution was dried until no moisture left. Thus, a recombinant peptide film was obtained. The recombinant peptide film was taken out from the plastic tray/silicon frame, and was subjected to thermal crosslinking at 160 C. under reduced pressure (crosslinking time was 48 hours or 72 hours). Thus, a sample for an animal test was obtained.
[0243] [10] Method for Measuring Degree of Crosslinking
[0244] The degree of crosslinking (number of crosslinks per molecule) of the film produced in the above section [9] was calculated. For the measurement, a TNBS (2,4,6-trinitrobenzenesulfonic acid) method was used.
[0245] <Preparation of Sample>
[0246] A sample (about 10 mg), a 4 mass % aqueous solution of NaHCO.sub.3 (1 mL), and a 1 mass % aqueous solution of TNBS (2 mL) were introduced into a glass vial, and the mixture was shaken for 3 hours at 37 C. Subsequently, 37 mass % hydrochloric acid (10 mL) and pure water (5 mL) were added thereto, and then the mixture was left to stand for 16 hours or longer at 37 C. The resultant was used as a sample.
[0247] <Preparation of Blank>
[0248] A sample (about 10 mg), a 4 mass % aqueous solution of NaHCO.sub.3 (1 mL), and a 1 mass % aqueous solution of TNBS (2 mL) were introduced into a glass vial, 37 mass % hydrochloric acid (3 mL) was added thereto immediately thereafter, and the mixture was shaken for 3 hours at 37 C. Subsequently, 37 mass % hydrochloric acid (7 mL) and pure water (5 mL) were added thereto, and then the mixture was left to stand for 16 hours or longer at 37 C. The resultant was used as a blank.
[0249] The light absorbance (345 nm) of a dilution of the sample obtained by diluting 10 times with pure water, and the light absorbance of the blank were measured, and the degree of crosslinking (number of crosslinks per molecule) was calculated from (Formula 2) and (Formula 3).
(AsAb)/14600V/w (Formula 2)
[0250] (Formula 2) represents the amount of lysine (molar equivalent) per gram of the recombinant peptide.
[0251] In Formula 2, As represents the light absorbance of the sample; Ab represents the light absorbance of the blank; V represents the amount of the reaction liquid (g); and w represents the mass (mg) of the recombinant peptide.
1(Sample (Formula 1)/uncrosslinked recombinant peptide (Formula 1))34 (Formula 3)
[0252] (Formula 3) represents the number of crosslinks per molecule.
[0253] As a result, the film obtained by crosslinking for 48 hours in the above section [9] had a degree of crosslinking of 6, and the film obtained by crosslinking for 72 hours in the above section [6] had a degree of crosslinking of 13. The degree of crosslinking of the porous body of the above section [7] measured in the same manner was 9.
[0254] [11] Method for Measuring Rate of Decomposition
[0255] The rate of decomposition of the film produced in the above section [9] was evaluated.
[0256] 5 mg of a sample produced in the above section [9] was introduced into a plastic tube, the mass of which had been measured in advance, and the actual amount of addition was recorded.
[0257] 2.5 mg of Actinomyces-derived collagenase was dissolved in 50 ml of phosphate buffered saline (PBS), and a collagenase solution was obtained. 1 ml of this collagenase solution was added to the tube containing the sample, and the content was mixed by vortexing. Subsequently, the mixture was shaken for 5 hours at 37 C. Subsequently, the tube was centrifuged for 1 minute at 10,000 G, and the supernatant was removed using a pipette. 1 ml of ultrapure water was added to the tube, and the content was mixed by vortexing. Subsequently, the tube was centrifuged for 1 minute at 10,000 G, and the supernatant was removed using a pipette. This operation was repeated one more time. Subsequently, the sample was freeze-dried, and the mass of the tube containing the sample was recorded.
[0258] The rate of decomposition of the film was calculated from the following formula (Formula 4).
Rate of decomposition=((WWe)wo)/wo/T (Formula 4)
[0259] In Formula 4, W represents the mass of the tube containing the sample, which was recorded after freeze-drying; and We represents the blank mass of the tube that was recorded in advance. wo represents the actual amount of addition of the sample. T represents the time taken for shaking in the collagenase solution, and in this test, T was 5 hours.
[0260] As a result, the film of the above section [9] resulted in a rate of decomposition of 6.9 [mass %/hour] under crosslinking for 48 hours, and a rate of decomposition of 0.5 [mass %/hour] under crosslinking for 72 hours.
[0261] [12] Method for Collecting Rabbit Chondrocytes
[0262] 3- to 4-week old Japanese white rabbits were victimized by intravenous administration of somnopentyl, and cartilage tissues were collected from femurs and tibias (humeri). The cartilage tissues were disinfected with an isodine dilution and were washed with DULBECCO's phosphate buffered saline (DPBS). 0.25 mass % trypsin was added thereto, and the mixture was allowed to react for about 1 hour at 37 C. Subsequently, the mixture was allowed to react with a 3,000 units/mL collagenase type IX solution for about 3 hours, the digest was passed through a cell strainer, and the residue was eliminated. Subsequently, a medium was added to the cells, and the mixture was centrifuged in order to eliminate the collagenase. The supernatant was removed, and a medium was added to the residue. Rabbit chondrocytes were obtained through this process.
[0263] The medium used as described above was a medium for chondrocyte culture in all cases, and the medium is a medium composed of DULBECCO's modified Eagle medium (DMEM), 10 vol % fetal bovine serum (FBS), 20 mM HEPES (4-(2-hydroyethyl)-1-piperazine ethanesulfonic acid), 50 g/mL magnesium L-ascorbyl phosphate, 0.25 g/mL amphotericin B, and 50 g/mL gentamycin. In the following description, in a case in which the description medium is given, this medium was used in all the cases.
[0264] [13] Production of Rabbit Chondrocyte Culture Sponges Having Different Cartilage Matrix Filling Proportions
[0265] The stirring method porous body (pore size 82 m) prepared in the above section [6] was cut out into a size with a diameter of 5 mm and a thickness of 2 mm, the rabbit chondrocytes prepared in the above section [12] were inoculated thereon at a concentration of 5.010.sup.6 cells/cm.sup.3, and culture was carried out. Therefore, a sponge with cartilage matrix was obtained. Here, a porous body that was not inoculated with rabbit chondrocytes was also prepared, and that was prepared as a sponge without cartilage matrix. Even in the case of using the ethanol-containing freezing step with small temperature difference/porous body (pore size 72 m) prepared in the above sections [7] and [8], the same results were obtained as the subsequent results. Therefore, in the following description, the data of the stirring method porous body derived from [6] will be suggested as a representative example.
[0266] [14] Evaluation of Samples Having Different Cartilage Matrix Filling Proportions of Bottom Faces
[0267] The sponge with cartilage matrix obtained by inoculating cells and culturing in the above section [13] could be used to produce sponges with cartilage matrix having different cartilage matrix filling proportions of the bottom faces with the elapse time of culture (3 days, 7 days, 14 days, 21 days, and 28 days). For the measurement of the cartilage matrix filling proportion of the bottom face, tissue slices of the sponge with cartilage matrix were produced (formalin fixation and paraffin embedment), and the cross-sections of the slices were visualized by performing safranin O staining. Thus, the cross-sections were evaluated (
[0268] Particularly, attention was paid to the region having a thickness of 150 m of the bottom face part of the stained tissue slices produced as such, and in this region having a thickness of 150 m, cartilage matrix existed. Therefore, the area of the region in which safranin O staining produced positive results was measured. Meanwhile, the proportion of the area of the safranin O staining-positive region with respect to the total area of the region having a thickness of 150 m was determined, and the proportion was designated as cartilage matrix filling proportion in 150-m layer. As a result, regarding the sponges with cartilage matrix produced in the above section [13], the cartilage matrix filling proportions in 150-m layer were 2.9%, 5.4%, 20%, 33%, and 90%.
[0269] In all of the sponges having cartilage matrix filling proportions in 150-m layer of 2.9%, 5.4%, 20%, 33%, and 90%, which were produced in the above sections [13] and [14], cartilage matrix existed in a region of 30% or more of a region extending from the surface of the articular cavity face to a depth of 150 m along the thickness.
[0270] [15] Production of Rabbit Cartilage Defect Model
[0271] At a knee joint site of a 22-week old male Japanese white rabbit (Kitayama Labes Co., Ltd., SPF), an osteochondral defect having a size with a diameter of 5 mm and a depth of about 2 mm was produced.
[0272] [16] Evaluation of Sample Transplantation Onto Rabbit Cartilage Defect Model (One Month) (Influence of Cartilage Matrix Filling Proportion)
[0273] Samples of various evaluation objects were transplanted onto the rabbit cartilage defect sites produced in the above section [15], and the rabbits were autopsied at a time point of one month after the transplantation. Thus, osteochondral tissue slices of the periphery of the transplantation sites were produced. The tissues were subjected to formalin fixation and paraffin embedment, and thus tissue slices including the transplants were produced. Regarding staining of the slices, HE staining (haematoxylin and eosin staining), or safranin O staining, or safranin O and fast green staining were carried out.
[0274] Here, regarding the film in the case of using a film, samples obtained by cutting the films prepared in the above section [9] (since the same results were obtained for the films having a degree of crosslinking of 6 and the films having a degree of crosslinking of 13, no distinction was made between them in this Example) into the size of the low bottom face area (diameter: 5 mm) of the defect, were used. Furthermore, in the case of using a film, the film was transplanted in a state in which the film came to the transplant face (lower bone side). The positional relation of the sponge and the film in the case of transplanting the sponge and the film onto the rabbit osteochondral defect site is depicted in
[0275] The samples evaluated and the results are presented in
[0276] Cartilage Regeneration
[0277] A: Satisfactory cartilage regeneration is recognized.
[0278] B: Slight cartilage regeneration is recognized in some part.
[0279] C: Cartilage regeneration is not recognized.
[0280] Suppression of Infiltration of Fibrous Soft Tissue
[0281] A: Suppression of the infiltration of fibrous soft tissue is recognized.
[0282] B: Suppression of the infiltration of fibrous soft tissue is slightly recognized.
[0283] C: Suppression of the infiltration of fibrous soft tissue is not recognized.
[0284] D: Infiltration of inflammation cannot be suppressed, and suppression of the infiltration of fibrous soft tissue is poorly achieved.
TABLE-US-00002 TABLE 1 Suppression of Cartilage infiltration of Remarks for group Summary of evaluation regeneration fibrous soft tissue Comparative Only sponge without cartilage Infiltration of inflammation cannot be C D Example 1 matrix was transplanted. suppressed, and suppression of infiltration of fibrous soft tissue is poor. Cartilage regeneration was not recognized. Comparative Sponge without cartilage matrix was Suppression of infiltration of inflammation C B Example 2 transplanted integrally with film was successful compared to the case of having diameter of 5 mm, with the film Comparative Example 1, and suppression being placed below the sponge. of the infiltration of fibrous soft tissue was slightly recognized. Cartilage regeneration was not recognized. Comparative Sponge with cartilage matrix (cartilage Suppression of infiltration of fibrous soft C C Example 3 matrix filling proportion: 2.9%) was tissue was not recognized, and cartilage transplanted integrally with film regeneration was also not recognized. having diameter of 5 mm, with the film being placed below the sponge. Comparative Sponge with cartilage matrix (cartilage Suppression of infiltration of fibrous soft C C Example 4 matrix filling proportion: 5.4%) was tissue was not recognized, and cartilage transplanted integrally with film regeneration was also not recognized. having diameter of 5 mm, with the film being placed below the sponge. Example 1 Sponge with cartilage matrix (cartilage Suppression of infiltration of fibrous soft A A matrix filling proportion: 20%) was tissue was significantly recognized, and it transplanted integrally with film was understood that cartilage regeneration having diameter of 5 mm, with the film was also satisfactory. being placed below the sponge. Example 2 Sponge with cartilage matrix (cartilage Suppression of infiltration of fibrous soft A A matrix filling proportion: 33%) was tissue was significantly recognized, and it transplanted integrally with film was understood that cartilage regeneration having diameter of 5 mm, with the film was also satisfactory. being placed below the sponge. Example 3 Sponge with cartilage matrix (cartilage Suppression of infiltration of fibrous soft A A matrix filling proportion: 90%) was tissue was significantly recognized, and it transplanted integrally with film was understood that cartilage regeneration having diameter of 5 mm, with the film was also satisfactory. being placed below the sponge. Comparative Only sponge with cartilage matrix Suppression of infiltration of fibrous soft C C Example 5 (cartilage matrix filling proportion: tissue was not recognized, and cartilage 20%) was transplanted. regeneration was also not recognized.
[0285] From the results described above, it was found that in a case in which the cartilage matrix filling proportion in 150-m layer was sufficient (20%, 33%, and 90%), and in a case in which the film was provided at the bottom face (transplant face), satisfactory suppression of the infiltration of fibrous soft tissue and satisfactory cartilage regeneration were brought about.
[0286] [17] Evaluation of Sample Transplantation Into Rabbit Cartilage Defect Model (Long-Term 6 Months) (Influence of Degree of Film Crosslinking)
[0287] Similarly to the method of the above section [16], sponges with cartilage matrix having the same cartilage matrix filling proportions (33%) (sections [13] and [14]), and films having different degrees of crosslinking (degrees of crosslinking of sections [9] and [10]: 6 and 13) were transplanted onto rabbit cartilage defect sites produced in the above section [15]. These were transplanted such that the film would exist at the transplant face (lower bone side). The rabbits were autopsied at a time point of 6 months after transplantation, and osteochondral tissue slices of the periphery of the sites of transplantation were produced. The tissue was subjected to formalin fixation, followed by paraffin embedment, and thus tissue slices including the transplant were produced. Regarding the slice staining, HE staining (haematoxylin and eosin staining), or safranin O staining, or safranin O and fast green staining were carried out.
[0288] Here, regarding the film in the case of using a film, samples obtained by cutting the films prepared in the above section [9], which had two degrees of crosslinking (measured in section [10]) (degree of crosslinking: 6 and 13), respectively into the size of the low bottom face area (diameter: 5 mm) of the defect, were used.
[0289] The results are presented in
[0290] [18] Biodegradability of Film
[0291] The film having a degree of crosslinking of 13 produced in the above sections [9] and [10] was placed at the rabbit cartilage defect site produced in the above section [15], and after one month and after two months, the rabbits were autopsied. Osteochondral tissue slices of the periphery of the transplantation site were produced. The tissue was subjected to formalin fixation, followed by paraffin embedment, and tissue slices including the transplant were produced. Regarding the slice staining, HE staining (haematoxylin and eosin staining) was carried out.
[0292] The results are presented in
[0293] [19] Evaluation of Effectiveness of Split Transplantation of Sponge with Cartilage Matrix (Sufficient Cartilage Matrix Filling Proportion)
[0294] In the actual clinical field, it is more desirable that transplantation therapy is enabled by using arthroscopy. In order to enable transplantation by arthroscopy, it is necessary that the transplant can pass through the arthroscopic portals. In order to do so, it is important that even in a case in which an osteochondral defect is filled with split transplants, cartilage regeneration is recognized to the same extent as in the case of using transplants that are not split. As a method for evaluating this, in a case in which a sponge with cartilage matrix having a sufficient cartilage matrix filling proportion was split once and then transplanted onto the site of defect, whether cartilage regeneration was recognized at the split portions was evaluated.
[0295] The sponge with cartilage matrix (cartilage matrix filling proportion 90%) produced in the above sections [13] and [14] was split as shown in
[0296] Here, regarding the film in the case of using a film, samples obtained by cutting the films prepared in the above section [9], which had a degree of crosslinking of 13 (measured in section [10]), respectively into the size of the low bottom face area (diameter: 5 mm) of the defect, were used.
[0297] The results are presented in
[0298] [20] Verification of Whether Fixation to Site of Defect is Appropriate
[0299] In the actual clinical field, it is frequently desired that a transplant is fixed to the site of defect with pins after transplantation. It is necessary that whether this fixation is possible does not have a serious negative influence on cartilage regeneration even in a case in which the transplant is perforated with pins. As a method for evaluating this, verification of placing a sponge with cartilage matrix, which has a sufficient cartilage matrix filling proportion, onto an osteochondral defect site and then opening a through-hole by means of fixing pins, was performed. It is verified that even in a case where a through-hole that penetrates through the sponge with cartilage matrix, the film, and the bone at the defect bottom portion, is opened, there is no adverse effect on cartilage regeneration.
[0300] The sponge with cartilage matrix produced in the above sections [13] and [14] (cartilage matrix filling proportion 90%) and the film having a degree of crosslinking of 13 produced in the above sections [9] and [10] were transplanted onto the rabbit cartilage defect site produced in the above section [15], and subsequently, a through-hole that reached the sponge, the film and the lower bone was opened using a Kirschner wire having a diameter of 0.8 mm or a diameter of 1.5 mm. The rabbits were autopsied at the time point of passing one month in the state of having the through-hole maintained, and osteochondral tissue slices of the periphery of the site of transplantation were produced. The tissues were subjected to formalin fixation, followed by paraffin embedment, and thus tissue slices including the transplant were produced. Regarding the slice staining, HE staining (haematoxylin and eosin staining), or safranin O staining, or safranin O and fast green staining were carried out.
[0301] Here, regarding the film in the case of using a film, samples obtained by cutting the film having a degree of crosslinking of 13 (measured in section [10]), which was prepared in the above section [9], into the size of the low bottom face area (diameter: 5 mm) of the defect, were used. The samples were installed in the form in which the film existed on the transplant face (lower bone side).
[0302] The results are presented in
[0303] [21] Production of Pins Using Recombinant Peptide
[0304] Regarding a fixing pin that accomplishes fixation such as in the above section [19], it is required that such a pin has a performance that does not come out after piercing through a through-hole produced in the bone. At the same time, it is also desirable that the pin is bioabsorbable. Among existing products, for example, GRANDFIX (manufactured by Gunze, Ltd.) that is produced from poly-L-lactic acid, can be used.
[0305] Furthermore, a pin made of a recombinant peptide could be produced using CBE3 of the above section [1]. A 10 mass % aqueous solution of CBE3 was prepared using the CBE3 of section [1]. Subsequently, the aqueous solution was caused to flow into a template made of TEFLON (registered trademark) shown in
[0306] On the other hand, a sponge bone test material was prepared as a substituent for bone, and a through-hole was produced using a Kirschner wire (K-wire) having a diameter of 0.8 mm was produced therein. The above-mentioned CBE3 pin was pierced into the hole having a diameter of 0.8 mm produced in the sponge bone test material, and the material was sufficiently swollen with water. This CBE3 pin maintained the shape without escaping even after being placed therein for one day. Thus, it was confirmed that the pin was a pin that can be used for fixation (
SEQUENCE LIST
[0307] International Application Application 15F02955 Cartilage Regenerative Material and Method for Producing Same JP16058541 2016031700200338451600554136 Normal 20160317153921201602251518509130_P1AP101_15_1.app Based on International Reception Patent Cooperation Treaty