Clostridial Neurotoxins Comprising an Exogenous Activation Loop
20240175001 ยท 2024-05-30
Inventors
- Sai Man LIU (Wrexham, GB)
- Vineeta TRIPATHI (Wrexham, GB)
- Shilpa PALAN (Wrexham, GB)
- Kevin MOORE (Wrexham, GB)
- Karen DELAHAY (Wrexham, GB)
Cpc classification
C12Y304/24069
CHEMISTRY; METALLURGY
C12N15/63
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention relates to a method for proteolytically processing a single-chain clostridial neurotoxin into a corresponding di-chain clostridial neurotoxin, the method comprising: providing a single-chain clostridial neurotoxin; and contacting the single-chain clostridial neurotoxin with furin; wherein the single-chain clostridial neurotoxin has an activation loop comprising or consisting of the polypeptide sequence Arg-Xaa-Xaa-Arg; and wherein furin hydrolyses a peptide bond of the activation loop thereby producing a di-chain clostridial neurotoxin. The invention also relates to engineered clostridial neurotoxins and methods for manufacturing the same, as well as related pharmaceutical compositions, nucleotide sequences, and therapeutic and cosmetic uses.
Claims
1. An engineered clostridial neurotoxin, comprising a furin cleavage site, wherein cleavage at said furin cleavage site results in the production of a di-chain form of the engineered clostridial neurotoxin.
2. The engineered clostridial neurotoxin according to claim 1, wherein the furin cleavage site comprises an amino acid sequence Arg-Xaa-Xaa-Arg (SEQ ID NO: 1), preferably Arg-Xaa-Lys/Arg-Arg (SEQ ID NOs: 2 and 3), even more preferably Arg-Lys-Lys-Arg (SEQ ID No: 4), and even more preferably KQKSSNSRKKR (SEQ ID NO: 5).
3. The engineered clostridial neurotoxin according to claim 1 or 2, wherein the engineered clostridial neurotoxin comprises an exogenous activation loop which comprises or consists of any one of SEQ ID NOs: 14 to 22), preferably SEQ ID NO: 22.
4. The engineered clostridial neurotoxin according to any one of the preceding claims, wherein an endogenous activation loop of a clostridial neurotoxin or part thereof has been replaced by a furin cleavage site.
5. The engineered clostridial neurotoxin according to claim 4, wherein the endogenous neurotoxin activation loop is one or more selected from SEQ ID NO: 34 to 57.
6. The engineered clostridial neurotoxin according to any one of the preceding claims, wherein the clostridial neurotoxin is: (a) a Botulinum Neurotoxin (BoNT) serotype A, serotype B, serotype C, serotype D, serotype E, serotype F, serotype G or serotype X, or a Tetanus Neurotoxin (TeNT); or (b) a chimeric BoNT or a hybrid BONT.
7. The engineered clostridial neurotoxin according to claim 6 which is BoNT/A, optionally BONT/A1.
8. The engineered clostridial neurotoxin according to any one of the preceding claims, which is a single-chain clostridial neurotoxin: (a) encoded by a nucleotide sequence having at least 70% sequence identity to SEQ ID NO: 23; and/or (b) comprising a polypeptide sequence having at least 70% sequence identity to one or more of SEQ ID NOs: 24 or 70 to 78.
9. The engineered clostridial neurotoxin according to any one of the preceding claims, which is a re-targeted clostridial neurotoxin in which an endogenous H.sub.C or H.sub.CC of a clostridial neurotoxin is replaced by an exogenous targeting moiety (TM).
10. An engineered BoNT/A comprising a furin cleavage site, which comprises a polypeptide sequence having at least 70% sequence identity, preferably at least 80%, more preferably at least 90%, even more preferably at least 95% sequence identity to SEQ ID NO: 24.
11. A method for proteolytically processing an engineered clostridial neurotoxin according to any one of claims 1 to 9 or an engineered BoNT/A according to claim 10 into a corresponding di-chain clostridial neurotoxin or BoNT/A, the method comprising contacting the engineered clostridial neurotoxin or engineered BoNT/A with furin, thereby producing a di-chain clostridial neurotoxin or BoNT/A.
12. A di-chain clostridial neurotoxin or BoNT/A obtainable by the method of claim 11.
13. A polynucleotide encoding an engineered clostridial neurotoxin as defined in any one of claims 1 to 9 or an engineered BoNT/A according to claim 10.
14. An expression vector comprising a polynucleotide as defined in claim 13, which is operably linked to a promoter.
15. A polynucleotide according to claim 13, or an expression vector according to claim 14, wherein said polynucleotide or expression vector: (a) comprises a nucleotide sequence having at least 70% sequence identity to SEQ ID NO: 23; and/or (b) encodes a polypeptide sequence having at least 70% sequence identity to one or more of SEQ ID NOs: 24 or 70 to 78.
16. A method of producing an engineered clostridial neurotoxin as defined in any one of claims 1 to 9, or an engineered BoNT/A according to claim 10 comprising the step of expressing a polynucleotide as defined in claim 13 or 15 or an expression vector as defined in claim 14 or 15 in a cell, and recovering the expressed engineered clostridial neurotoxin or engineered BoNT/A.
17. The method of claim 16, which further comprises a step of introducing a polynucleotide as defined in claim 13 or 15 or an expression vector as defined in claim 14 or 15 into the cell.
18. A cell expressing an engineered clostridial neurotoxin as defined in any one of claims 1 to 9 or an engineered BoNT/A according to claim 10.
19. The cell of claim 18, which comprises a polynucleotide as defined in claim 13 or 15, or an expression vector as defined in claim 14 or 15.
20. A pharmaceutical composition comprising an engineered clostridial neurotoxin as defined in any one of claims 1 to 9, an engineered BoNT/A according to claim 10, or a di-chain clostridial neurotoxin or di-chain BoNT/A as defined in claim 12, and a pharmaceutically acceptable carrier, excipient, diluent, adjuvant, propellant and/or salt.
21. An engineered clostridial neurotoxin as defined in any one of claims 1 to 9, an engineered BoNT/A according to claim 10, a di-chain clostridial neurotoxin or di-chain BONT/A as defined in claim 12, or a pharmaceutical composition as defined in claim 20, for use in a method of preventing or treating a disease or disorder for which a therapy with a botulinum neurotoxin is indicated, wherein optionally said disease or disorder is selected from a condition associated with unwanted immune secretion, strabismus, blepharospasm, squint, dystonia (e.g. spasmodic dystonia, oromandibular dystonia, focal dystonia, tardive dystonia, laryngeal dystonia, limb dystonia, cervical dystonia), torticollis (e.g. spasmodic torticollis), beauty therapy (cosmetic) applications benefiting from cell/muscle incapacitation (via SNARE down-regulation or inactivation), neuromuscular disorder or condition of ocular motility (e.g. concomitant strabismus, vertical strabismus, lateral rectus palsy, nystagmus, dysthyroid myopathy), writer's cramp, bruxism, Wilson's disease, tremor, tics, segmental myoclonus, spasms, spasticity due to chronic multiple sclerosis, spasticity resulting in abnormal bladder control, animus, back spasm, charley horse, levator pelvic syndrome, spina bifida, tardive dyskinesia, Parkinson's disease, stuttering, hemifacial spasm, eyelid disorder, cerebral palsy, focal spasticity, spasmodic colitis, neurogenic bladder, anismus, limb spasticity, tics, tremors, bruxism, anal fissure, achalasia, dysphagia, lacrimation, hyperhydrosis, excessive salivation, excessive gastrointestinal secretions, muscle pain (e.g. pain from muscle spasms), headache pain (e.g. tension headache or migraine), phantom pain (e.g. phantom limb pain), brow furrows, skin wrinkles, cancer, uterine disorders, uro-genital disorders, urogenital-neurological disorders, bladder pain syndrome, interstitial cystitis, chronic neurogenic inflammation, and a smooth muscle disorder.
22. Use of an engineered clostridial neurotoxin as defined in any one of claims 1 to 9, an engineered BoNT/A according to claim 10, a di-chain clostridial neurotoxin or di-chain BONT/A as defined in claim 12, or a pharmaceutical composition as defined in claim 20, in the manufacture of a medicament for preventing or treating a disease or disorder for which a therapy with a botulinum neurotoxin is indicated, wherein optionally said disease or disorder is selected from a condition associated with unwanted immune secretion, strabismus, blepharospasm, squint, dystonia (e.g. spasmodic dystonia, oromandibular dystonia, focal dystonia, tardive dystonia, laryngeal dystonia, limb dystonia, cervical dystonia), torticollis (e.g. spasmodic torticollis), beauty therapy (cosmetic) applications benefiting from cell/muscle incapacitation (via SNARE down-regulation or inactivation), neuromuscular disorder or condition of ocular motility (e.g. concomitant strabismus, vertical strabismus, lateral rectus palsy, nystagmus, dysthyroid myopathy), writer's cramp, bruxism, Wilson's disease, tremor, tics, segmental myoclonus, spasms, spasticity due to chronic multiple sclerosis, spasticity resulting in abnormal bladder control, animus, back spasm, charley horse, levator pelvic syndrome, spina bifida, tardive dyskinesia, Parkinson's disease, stuttering, hemifacial spasm, eyelid disorder, cerebral palsy, focal spasticity, spasmodic colitis, neurogenic bladder, anismus, limb spasticity, tics, tremors, bruxism, anal fissure, achalasia, dysphagia, lacrimation, hyperhydrosis, excessive salivation, excessive gastrointestinal secretions, muscle pain (e.g. pain from muscle spasms), headache pain (e.g. tension headache or migraine), phantom pain (e.g. phantom limb pain), brow furrows, skin wrinkles, cancer, uterine disorders, uro-genital disorders, urogenital-neurological disorders, bladder pain syndrome, interstitial cystitis, chronic neurogenic inflammation, and a smooth muscle disorder.
23. A cosmetic composition comprising an engineered clostridial neurotoxin as defined in any one of claims 1 to 9, an engineered BoNT/A according to claim 10, or a di-chain clostridial neurotoxin or di-chain BoNT/A as defined in claim 12, and a cosmetically acceptable carrier, excipient, diluent, adjuvant, propellant and/or salt.
24. Use of a cosmetic composition as defined in claim 23, for preventing or alleviating a cosmetic indication for which the application of a botulinum neurotoxin is indicated.
25. A method for proteolytically processing a single-chain clostridial neurotoxin into a corresponding di-chain clostridial neurotoxin, the method comprising: (a) providing a single-chain clostridial neurotoxin; and (b) contacting the single-chain clostridial neurotoxin with furin; wherein the single-chain clostridial neurotoxin has an activation loop comprising or consisting of the polypeptide sequence Arg-Xaa-Xaa-Arg (SEQ ID NO: 1); and wherein furin hydrolyses a peptide bond of the activation loop thereby producing a di-chain clostridial neurotoxin.
26. The method according to claim 25, wherein the activation loop comprises or consists of: TABLE-US-00011 (a) (SEQIDNOs:2or3) Arg-Xaa-Lys/Arg-Arg; (b) (SEQIDNo:4) Arg-Lys-Lys-Arg; and/or (c) (SEQIDNO:5) KQKSSNSRKKR
27. The method according to claim 25 or 26, wherein the single-chain clostridial neurotoxin: (a) is an engineered clostridial neurotoxin as defined in any one of claims 1 to 9; (b) is encoded by a nucleotide sequence having at least 70% sequence identity to SEQ ID NO: 23; (c) comprises a polypeptide sequence having at least 70% sequence identity to one or more of SEQ ID NOs: 24 or 70 to 78.
28. A clostridial neurotoxin, or a pharmaceutical composition comprising said clostridial neurotoxin, for use in a method of preventing or treating a disease or disorder for which a therapy with a botulinum neurotoxin is indicated, wherein the clostridial neurotoxin is administered to a subject in single-chain form.
29. The clostridial neurotoxin, or a pharmaceutical composition for use according to claim 28, wherein the clostridial neurotoxin or pharmaceutical composition is substantially free of a di-chain form of the clostridial neurotoxin.
30. The clostridial neurotoxin, or a pharmaceutical composition for use according to claim 29, wherein the clostridial neurotoxin or pharmaceutical composition comprises less than 400 pg di-chain clostridial neurotoxin per 100 ng single-chain clostridial neurotoxin, or less than 300 pg di-chain clostridial neurotoxin per 100 ng single-chain clostridial neurotoxin, or less than 200 pg di-chain clostridial neurotoxin per 100 ng single-chain clostridial neurotoxin, or less than 100 pg di-chain clostridial neurotoxin per 100 ng single-chain clostridial neurotoxin, or less than 50 pg di-chain clostridial neurotoxin per 100 ng single-chain clostridial neurotoxin.
31. The clostridial neurotoxin, or a pharmaceutical composition for use according to any one of claims 28 to 30, wherein said disease or disorder is selected from a condition associated with unwanted immune secretion, strabismus, blepharospasm, squint, dystonia (e.g. spasmodic dystonia, oromandibular dystonia, focal dystonia, tardive dystonia, laryngeal dystonia, limb dystonia, cervical dystonia), torticollis (e.g. spasmodic torticollis), beauty therapy (cosmetic) applications benefiting from cell/muscle incapacitation (via SNARE down-regulation or inactivation), neuromuscular disorder or condition of ocular motility (e.g. concomitant strabismus, vertical strabismus, lateral rectus palsy, nystagmus, dysthyroid myopathy), writer's cramp, bruxism, Wilson's disease, tremor, tics, segmental myoclonus, spasms, spasticity due to chronic multiple sclerosis, spasticity resulting in abnormal bladder control, animus, back spasm, charley horse, levator pelvic syndrome, spina bifida, tardive dyskinesia, Parkinson's disease, stuttering, hemifacial spasm, eyelid disorder, cerebral palsy, focal spasticity, spasmodic colitis, neurogenic bladder, anismus, limb spasticity, tics, tremors, bruxism, anal fissure, achalasia, dysphagia, lacrimation, hyperhydrosis, excessive salivation, excessive gastrointestinal secretions, muscle pain (e.g. pain from muscle spasms), headache pain (e.g. tension headache or migraine), phantom pain (e.g. phantom limb pain), brow furrows, skin wrinkles, cancer, uterine disorders, uro-genital disorders, urogenital-neurological disorders, bladder pain syndrome, interstitial cystitis, chronic neurogenic inflammation, and a smooth muscle disorder.
32. Use of a cosmetic composition comprising a single-chain clostridial neurotoxin, and a cosmetically acceptable carrier, excipient, diluent, adjuvant, propellant and/or salt for preventing or alleviating a cosmetic indication for which the application of a botulinum neurotoxin is indicated, wherein the single-chain clostridial neurotoxin is administered to a subject in single-chain form.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0036] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. Singleton, et al., DICTIONARY OF MICROBIOLOGY AND MOLECULAR BIOLOGY, 20 ED., John Wiley and Sons, New York (1994), and Hale & Marham, THE HARPER COLLINS DICTIONARY OF BIOLOGY, Harper Perennial, NY (1991) provide the skilled person with a general dictionary of many of the terms used in this disclosure. The meaning and scope of the terms should be clear; however, in the event of any latent ambiguity, definitions provided herein take precedent over any dictionary or extrinsic definition.
[0037] It should be understood that this invention is not limited to the particular methodology, protocols, and reagents, etc., described herein and as such can vary. In particular, any methods and materials similar or equivalent to those described herein can be used in the practice or testing of embodiments of this disclosure.
[0038] The description of embodiments of the disclosure is not intended to be exhaustive or to limit the disclosure to the precise form disclosed. While specific embodiments of, and examples for, the disclosure are described herein for illustrative purposes, various equivalent modifications are possible within the scope of the disclosure, as those skilled in the relevant art will recognize. For example, while method steps or functions are presented in a given order, alternative embodiments may perform functions in a different order, or functions may be performed substantially concurrently. The teachings of the disclosure provided herein can be applied to other procedures or methods as appropriate. The various embodiments described herein can be combined to provide further embodiments. Aspects of the disclosure can be modified, if necessary, to employ the compositions, functions and concepts of the above references and application to provide yet further embodiments of the disclosure. Moreover, due to biological functional equivalency considerations, some changes can be made in protein structure without affecting the biological or chemical action in kind or amount. These and other changes can be made to the disclosure in light of the detailed description. All such modifications are intended to be included within the scope of the appended claims.
[0039] Unless otherwise indicated, any nucleic acid sequences are written left to right in 5 to 3 orientation; amino acid sequences are written left to right in amino to carboxy orientation, respectively.
[0040] The headings provided herein are not limitations of the various aspects or embodiments of this disclosure.
[0041] As used herein, the term capable of when used with a verb, encompasses or means the action of the corresponding verb. For example, capable of interacting also means interacting, capable of cleaving also means cleaves, capable of binding also means binds and capable of specifically targeting . . . also means specifically targets.
[0042] Numeric ranges are inclusive of the numbers defining the range. Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limits of that range is also specifically disclosed. Each smaller range between any stated value or intervening value in a stated range and any other stated or intervening value in that stated range is encompassed within this disclosure. The upper and lower limits of these smaller ranges may independently be included or excluded in the range, and each range where either, neither or both limits are included in the smaller ranges is also encompassed within this disclosure, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in this disclosure.
[0043] Amino acids are referred to herein using the name of the amino acid, the three letter abbreviation or the single letter abbreviation. The term protein, as used herein, includes proteins, polypeptides, and peptides. As used herein, the term amino acid sequence is synonymous with the term polypeptide and/or the term protein. In some instances, the term amino acid sequence is synonymous with the term peptide. In some instances, the term amino acid sequence is synonymous with the term enzyme. The terms protein and polypeptide are used interchangeably herein. In the present disclosure and claims, the conventional one-letter and three-letter codes for amino acid residues may be used. The 3-letter code for amino acids as defined in conformity with the IUPACIUB Joint Commission on Biochemical Nomenclature (JCBN). It is also understood that a polypeptide may be coded for by more than one nucleotide sequence due to the degeneracy of the genetic code.
[0044] A fragment of a polypeptide typically comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 97% or more of the original polypeptide.
[0045] As used herein, the terms polynucleotides, nucleic acid and nucleic acid sequence refers to any molecule, preferably a polymeric molecule, incorporating units of ribonucleic acid, deoxyribonucleic acid or an analogue thereof. The nucleic acid can be either single-stranded or double-stranded. A single-stranded nucleic acid can be one nucleic acid strand of a denatured double-stranded DNA Alternatively, it can be a single-stranded nucleic acid not derived from any double-stranded DNA. In one aspect, the nucleic acid can be DNA. In another aspect, the nucleic acid can be RNA Suitable nucleic acid molecules are DNA, including genomic DNA or cDNA. Other suitable nucleic acid molecules are RNA, including siRNA, shRNA, and antisense oligonucleotides.
[0046] The terms increased, increase, enhance, or activate are all used herein to mean an increase by a statically significant amount. The terms increased, increase, enhance, or activate can mean an increase of at least 10% as compared to a reference level, for example an increase of at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90% or up to and including a 100% increase or any increase between 10-100% as compared to a reference level, or at least about a 2-fold, or at least about a 3-fold, or at least about a 4-fold, or at least about a 5-fold or at least about a 10-fold increase, or any increase between 2-fold and 10-fold or greater as compared to a reference level.
[0047] The terms decrease, reduced, reduction, or inhibit are all used herein to mean a decrease by a statistically significant amount. The terms reduce, reduction or decrease or inhibit typically means a decrease by at least 10% as compared to a reference level (e.g. the absence of a given treatment) and can include, for example, a decrease by at least about 10%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99% , or more. As used herein, reduction or inhibition encompasses a complete inhibition or reduction as compared to a reference level. Complete inhibition is a 100% inhibition (i.e. abrogation) as compared to a reference level.
[0048] Other definitions of terms may appear throughout the specification. Before the exemplary embodiments are described in more detail, it is to be understood that this disclosure is not limited to particular embodiments described, and as such may vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present disclosure will be defined only by the appended claims.
[0049] It must be noted that as used herein and in the appended claims, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a clostridial neurotoxin includes a plurality of such candidate agents and reference to the clostridial neurotoxin includes reference to one or more clostridial neurotoxins and equivalents thereof known to those skilled in the art, and so forth.
[0050] Furthermore, the use of the term including, as well as other forms, such as includes and included, is not limiting.
[0051] About may generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Exemplary degrees of error are within 20 percent (%), typically, within 10%, and more typically, within 5% of a given value or range of values. Preferably, the term about shall be understood herein as plus or minus (?) 5%, preferably ?4%, ?3%, ?2%, ?1%, ?0.5%, ?0.1%, of the numerical value of the number with which it is being used.
[0052] The term consisting of refers to compositions, methods, and respective components thereof as described herein, which are exclusive of any element not recited in that description of the invention.
[0053] As used herein the term consisting essentially of refers to those elements required for a given invention. The term permits the presence of elements that do not materially affect the basic and novel or functional characteristic(s) of that invention (i.e. inactive or non-immunogenic ingredients).
[0054] Embodiments described herein as comprising one or more features may also be considered as disclosure of the corresponding embodiments consisting of and/or consisting essentially of such features.
[0055] Concentrations, amounts, volumes, percentages and other numerical values may be presented herein in a range format. It is also to be understood that such range format is used merely for convenience and brevity and should be interpreted flexibly to include not only the numerical values explicitly recited as the limits of the range but also to include all the individual numerical values or sub-ranges encompassed within that range as if each numerical value and sub-range is explicitly recited.
[0056] An individual can be one who has been previously diagnosed with or identified as suffering from or having a condition in need of treatment or one or more complications related to such a condition, and optionally, have already undergone treatment for a condition as defined herein or the one or more complications related to said condition. Alternatively, an individual can also be one who has not been previously diagnosed as having a condition as defined herein or one or more complications related to said condition. For example, an individual can be one who exhibits one or more risk factors for a condition, or one or more complications related to said condition or a subject who does not exhibit risk factors.
[0057] An individual in need of treatment for a particular condition can be an individual having that condition, diagnosed as having that condition, or at risk of developing that condition.
[0058] The terms subject, individual and patient are used interchangeably herein to refer to a mammalian individual. An individual may be any mammal. Generally, the individual may be human; in other words, in one embodiment, the individual is a human. A individual may be an adult, juvenile or infant. An individual may be male or female.
[0059] The term pharmaceutically acceptable as used herein means approved by a regulatory agency of the Federal or a state government, or listed in the U.S. Pharmacopeia, European Pharmacopeia or other generally recognized pharmacopeia.
[0060] The publications discussed herein are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that such publications constitute prior art to the claims appended hereto.
Engineered Clostridial Neurotoxins
[0061] The present invention provides an engineered clostridial neurotoxin, comprising a furin cleavage site. Typically cleavage at said furin cleavage site results in the production of a di-chain form of the engineered clostridial neurotoxin. In other words, cleavage at the furin cleavage site results in activation of an engineered clostridial neurotoxin. The endogenous (native) activation loop of a clostridial neurotoxin may be replaced (or partially replaced) by a furin cleavage site. As such the term furin cleavage site may be used interchangeably with the terms furin activation site, and an exogenous activation loop as defined herein will typically comprise or consist of a furin cleavage site. The engineered clostridial neurotoxins of the invention may be activated in vivo. Thus, the engineered clostridial neurotoxins open up a new field of processing and therapeutic use for clostridial neurotoxins, enabling toxins to be produced and administered as single-chain clostridial neurotoxins, which are then cleaved to produce the active di-chain form in vivo. As described herein, this represents a paradigm shift in the field of clostridial neurotoxins.
[0062] The clostridial neurotoxin (pre-engineering) is typically characterised in that the endogenous activation loop is inefficiently proteolytically processed by furin. In contrast to the clostridial neurotoxin (pre-engineering), an engineered clostridial neurotoxin of the invention is not inefficiently proteolytically processed by furin and/or a peptide bond outside of the exogenous activation loop of the engineered clostridial neurotoxin is not hydrolysed by furin. Thus, the clostridial neurotoxin (pre-engineering) is typically resistant to proteolytic processing by furin. The terms inefficiently proteolytically processed by furin, resistant to proteolytic processing by furin, not substantially hydrolysed by furin inefficiently activated by furin, resistant to activation by furin and not substantially activated by furin are used interchangeably herein.
[0063] A clostridial neurotoxin (pre-engineering) is typically one in which a peptide bond (either within or outside of the activation loop) is not, or is not substantially, hydrolysed by furin. The term not substantially hydrolysed means that less than 10%, 5%, 4%, 3%, 2% or 1% of the clostridial neurotoxin present in a reaction contains a peptide bond that has been hydrolysed by furin in a method of the invention.
[0064] Accordingly, a clostridial neurotoxin (pre-engineering) typically does not contain a furin cleavage site (e.g. as defined herein) within its endogenous activation loop. Therefore, in some embodiments, the invention relates to clostridial neurotoxins (pre-engineering) that are not the BoNT/DC of UniProt Accession No. AB745660 (version 1 of the sequence, accessed 19 Jan. 2022), BoNT/C1 of UniProt Accession No. P18640 (version 3 of the sequence, accessed 23 Mar. 2022), BoNT/CD of UniProt Accession No. Q5DW55 (version 1 of the sequence, accessed 23 Mar. 2022), BoNT/D of NCBI Accession No. AB012112 (version 1 of the sequence, accessed 23 Mar. 2022) and/or BoNT/F5 of UniProt Accession No. D2KHQ9 (version 1 of the sequence, accessed 23 Mar. 2022).
[0065] The invention may comprise replacing an endogenous activation loop (or part thereof) of any clostridial neurotoxin with an (exogenous) furin cleavage site or an exogenous activation loop comprising a furin cleavage site as described herein. The clostridial neurotoxin may be a botulinum neurotoxin (BoNT) or a tetanus neurotoxin (TeNT). Preferably the clostridial neurotoxin is a botulinum neurotoxin, such as BoNT/A, BoNT/B, BONT/C1, BONT/D, BONT/E, BONT/F, BONT/G or BoNT/X, or a chimeric or hybrid thereof.
[0066] The term endogenous activation loop as used herein means an activation loop present in a subject clostridial neurotoxin, e.g. a subject clostridial neurotoxin of the indicated serotype. For example, BoNT/A1 includes a BoNT/A1 heavy chain and light chain, thus the endogenous activation loop of BoNT/A1 is an A1 activation loop. For clostridial neurotoxin chimeras or hybrids, the person skilled in the art can identify the endogenous activation loop, for example by determining the serotype(s) from which the L-chain and H.sub.N domain are derived. In some embodiments, a chimera or hybrid clostridial neurotoxin may have an endogenous activation loop that is a fusion of an activation loop from two different serotypes. By way of example, a chimeric clostridial neurotoxin such as BoNT/A1C1 has a BoNT/A1 light chain and translocation domain, thus the endogenous BoNT/A1C1 activation loop is an A1 activation loop. Examples of activation loops are provided in
[0067] Typically an endogenous activation loop is any activation loop that is does not comprise or consist of SEQ ID NO: 1. Preferably endogenous activation loop is any activation loop that is not SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 and/or SEQ ID NO: 5.
[0068] By contrast, an exogenous activation loop as used herein means an activation loop that is different to the endogenous activation loop present in a subject clostridial neurotoxin, e.g., a subject clostridial neurotoxin of the indicated serotype, and wherein the exogenous activation loop comprises a furin cleavage site. For example, a BoNT/C1 activation loop has a different polypeptide sequence to a wild-type BoNT/A1 activation loop, therefore the BoNT/C1 activation loop is exogenous to BoNT/A1. For clostridial neurotoxin chimeras or hybrids, the person skilled in the art can determine whether an activation loop is an exogenous activation loop, for example by determining the serotype(s) from which the L-chain and H.sub.N domain are derived. For example, where the L-chain is a BoNT/B L-chain and the H.sub.N domain is from BoNT/D, the endogenous activation loop may have a portion of a BoNT/B sequence and a portion of a BoNT/D sequence, and if an activation loop (e.g. a C1 activation loop) is different thereto, and comprises a furin cleavage site, it is considered an exogenous activation loop.
[0069] Determination of whether an activation loop is an endogenous activation loop may be made by aligning the sequence of a subject clostridial neurotoxin with the activation loop, and seeing if the activation loop is present in the subject clostridial neurotoxin sequence. If it is present, then the activation loop can be identified as an endogenous activation loop. As described herein, the endogenous activation loop of a clostridial neurotoxin is replaced by an exogenous cleavage site which is a furin cleavage site, or by an exogenous activation loop which comprises a furin cleavage site.
[0070] Typically according to the invention a furin cleavage site is inserted between the two cysteine residues that bound the endogenous activation loop of a pre-engineering clostridial neurotoxin, although the precise position of the furin cleavage site within the endogenous activation loop is not limited, provided that the conformation of the resultant engineered clostridial neurotoxin is not disrupted and/or the engineered clostridial neurotoxin rendered non-functional.
[0071] The entire endogenous activation loop replaced by a furin cleavage site or an exogenous activation loop comprising a furin cleavage site as described herein. Alternatively, a part or portion of the endogenous activation loop may be replaced (also referred to herein as partial replacement of the endogenous activation loop), such as at least 5, 10, 15, 20, 25, 30, 35 or 40 amino acid residues of the endogenous activation loop are replaced. Preferably 5 to 20, more preferably 5 to 15 amino acid residues of the endogenous activation loop are replaced. Typically partial replacement involves the replacement of consecutive amino acids within the endogenous activation loop.
[0072] Replacement of an endogenous activation loop may be achieved by any method known in the art. For example, replacement might be achieved by way of an amino acid modification. An endogenous activation loop may be replaced by deleting one or more amino acid residues of the endogenous activation loop. An endogenous activation loop may be replaced by substituting one or more amino acid residues of the endogenous activation loop with amino acid residues of an exogenous activation loop. An endogenous activation loop (or a portion thereof) may be deleted, and a furin cleavage site or an exogenous activation loop comprising a furin cleavage site inserted, preferably at the position formally occupied by the endogenous activation loop. Alternatively, the endogenous activation loop may be retained in an engineered clostridial neurotoxin of the invention, and preferably inactivated (e.g. by way of mutation). It is preferred that the endogenous activation loop (a portion thereof or the entire endogenous activation loop) is not present in the engineered clostridial neurotoxin of the invention. It is preferred that the furin cleavage site or the exogenous activation loop comprising the furin cleavage site occupies the position in the clostridial neurotoxin formally occupied by the endogenous activation loop. For the avoidance of doubt, when an endogenous activation loop is modified to comprise a furin cleavage site (e.g. by substitution of residues within the endogenous activation loop or by the addition of one or more amino acids to form a furin cleavage site within the endogenous activation loop), the modified activation loop is an exogenous activation loop according to the invention. Therefore, potentially an engineered clostridial neurotoxin can comprise both its endogenous activation/cleavage site and a furin cleavage site, and as such may be activated either by the native activating protease (or equivalents used in recombinant BONT production, e.g. trypsin or Lys-C), or by furin.
[0073] Methods for modifying proteins by substitution, insertion or deletion of amino acid residues are known in the art and may be employed in the practice of the present invention. By way of example, amino acid modifications may be introduced by modification of a DNA sequence encoding a clostridial neurotoxin. This can be achieved using standard molecular cloning techniques, for example by site-directed mutagenesis where short strands of DNA (oligonucleotides) coding for the desired amino acid(s) are used to replace the original coding sequence using a polymerase enzyme, or by inserting/deleting parts of the gene with various enzymes (e.g., ligases and restriction endonucleases). Alternatively a modified gene sequence can be chemically synthesised.
[0074] An endogenous activation loop replaced according to the invention may comprise or consist of a polypeptide sequence having at least 70% (e.g. at least 80% or 90%) sequence identity to SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56 or SEQ ID NO: 57. In particular, an endogenous activation loop may comprise or consist of a polypeptide sequence having at least 95% sequence identity to SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56 or SEQ ID NO: 57. Preferably, an endogenous activation loop comprises or consists of a polypeptide sequence shown as SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ
[0075] ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56 or SEQ ID NO: 57.
[0076] An endogenous activation loop replaced according to the invention may comprise or consist of a polypeptide sequence having at least 70% (e.g. at least 80% or 90%) sequence identity to SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40 or SEQ ID NO: 41. An endogenous activation loop may comprise or consist of a polypeptide sequence having at least 95% sequence identity to SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40 or SEQ ID NO: 41. Preferably, an endogenous activation loop comprises or consists of a polypeptide sequence shown as SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40 or SEQ ID NO: 41.
[0077] Preferably an endogenous activation loop replaced according to the invention comprises or consists of a polypeptide sequence having at least 70% (e.g. at least 80% or 90%) sequence identity to SEQ ID NO: 39. An endogenous activation loop may comprise or consist of a polypeptide sequence having at least 95% sequence identity to SEQ ID NO: 39. More preferably, an endogenous activation loop comprises or consists of a polypeptide sequence shown as SEQ ID NO: 39.
[0078] The present invention encompasses methods and clostridial neurotoxins in which an endogenous activation loop has been replaced by an exogenous cleavage site, which is a furin cleavage site, or an exogenous activation loop which comprises a furin cleavage site. Typically a furin cleavage site comprises or consists of the amino acid sequence Arg-Xaa-Yaa-Arg (SEQ ID NO: 1), where Xaa and Yaa may each be independently selected from any amino acid.
[0079] It is not intended that either Xaa or Yaa be limited to only one type of amino acid. Thus, one or more residues present at Xaa and Yaa may be independently selected from the standard amino acids: aspartic acid, glutamic acid, arginine, lysine, histidine, asparagine, glutamine, serine, threonine, tyrosine, methionine, tryptophan, cysteine, alanine, glycine, valine, leucine, isoleucine, proline, and phenylalanine. One or more residues present at position Yaa may be independently selected from the standard amino acids: aspartic acid, glutamic acid, arginine, lysine, histidine, asparagine, glutamine, serine, threonine, tyrosine, methionine, tryptophan, cysteine, alanine, glycine, valine, leucine, isoleucine, proline, and phenylalanine.
[0080] Alternatively/additionally, one or more residues present at Xaa and Yaa may be independently selected from a non-standard amino acid (an amino acid that is not part of the standard set of 20 described above). By way of example, non-standard amino acids may include 4-hydroxyproline, 6-N-methyl lysine, 2-aminoisobutyric acid, isovaline, ?-methyl serine, trans-3-methylproline, 2,4-methano-proline, cis-4-hydroxyproline, trans-4-hydroxy-proline, N-methylglycine, allo-threonine, methyl-threonine, hydroxy-ethylcysteine, hydroxyethylhomo-cysteine, nitro-glutamine, homoglutamine, pipecolic acid, tert-leucine, norvaline, 2-azaphenylalanine, 3-azaphenyl-alanine, 4-azaphenyl-alanine, L-Ornithine, L-2-amino-3-guanidinopropionic acid, or D-isomers of Lysine, Arginine and/or Ornithine, and 4-fluorophenylalanine. Methods for introducing non-standard amino acids into proteins are known in the art, and include recombinant protein synthesis using E. coli auxotrophic expression hosts.
[0081] Properties of the standard amino acids are indicated in the table below:
TABLE-US-00001 AMINO ACID SIDE CHAIN Aspartic acid Asp D Charged (acidic) Glutamic acid Glu E Charged (acidic) Arginine Arg R Charged (basic) Lysine Lys K Charged (basic) Histidine His H Uncharged (polar) Asparagine Asn N Uncharged (polar) Glutamine Gln Q Uncharged (polar) Serine Ser S Uncharged (polar) Threonine Thr T Uncharged (polar) Tyrosine Tyr Y Uncharged (polar) Methionine Met M Uncharged (polar) Tryptophan Trp W Uncharged (polar) Cysteine Cys C Uncharged (polar) Alanine Ala A Uncharged (hydrophobic) Glycine Gly G Uncharged (hydrophobic) Valine Val V Uncharged (hydrophobic) Leucine Leu L Uncharged (hydrophobic) Isoleucine Ile I Uncharged (hydrophobic) Proline Pro P Uncharged (hydrophobic) Phenylalanine Phe F Uncharged (hydrophobic)
[0082] The following amino acids are considered charged amino acids: aspartic acid (negative), glutamic acid (negative), arginine (positive), and lysine (positive).
[0083] Typically Xaa is a small and/or hydrophilic amino acid and/or Yaa is a positively charged amino acid. Preferred examples of furin cleavage sites of the invention include amino acid sequences comprising or consisting of Arg-Xaa-Lys-Arg (SEQ ID NO: 2), Arg-Xaa-Arg-Arg (SEQ ID NO: 3) and Arg-Lys-Lys-Arg (SEQ ID NO: 4).
[0084] A furin cleavage site of the invention may comprise or consist of a core or minimal furin cleavage site such as any one of SEQ ID NO:1, SEQ ID NO: 2, SEQ ID NO: 3 or SEQ ID NO: 4 and one or more additional amino acids. Preferably, a furin cleavage site of the invention may comprise or consist of a core or minimal furin cleavage site such as any one of SEQ ID NO: 2, SEQ ID NO: 3 or SEQ ID NO: 4 and one or more additional amino acids. The one or more additional amino acids may be either N-terminal and/or C-terminal to the core furin cleavage site. The one or more additional amino acid may be preferably selected from small and/or hydrophilic amino acids (such as serine and/or lysine).
[0085] One or more amino acid residue (such as two, three, four, five, six, seven, eight, nine or ten amino acids) immediately N-terminal to the N-terminal Arg of the core furin cleavage site (e.g. SEQ ID NO:1, SEQ ID NO: 2, SEQ ID NO: 3 or SEQ ID NO: 4) may be polar (hydrophilic) amino acid (e.g. serine or threonine), or a positively charged amino acid (e.g. lysine or arginine).
[0086] Alternatively or in addition, one or more amino acid residue (such as two, three, four, five, six, seven, eight, nine or ten amino acids) immediately C-terminal to the C-terminal Arg of the core furin cleavage site (e.g. SEQ ID NO:1, SEQ ID NO: 2, SEQ ID NO: 3 or SEQ ID NO: 4) may be polar (hydrophilic) amino acid (e.g. serine or threonine), or a positively charged amino acid (e.g. lysine or arginine).
[0087] Preferably, one or more amino acid residue (such as two, three, four, five, six, seven, eight, nine or ten amino acids) immediately N-terminal to the N-terminal Arg of the core furin cleavage site (e.g. SEQ ID NO:1, SEQ ID NO: 2, SEQ ID NO: 3 or SEQ ID NO: 4) is polar (hydrophilic) amino acid (e.g. serine or threonine), or a positively charged amino acid (e.g. lysine or arginine) and one or more amino acid residue (such as two, three, four, five, six, seven, eight, nine or ten amino acids) immediately C-terminal to the C-terminal Arg of the core furin cleavage site (e.g. SEQ ID NO:1, SEQ ID NO: 2, SEQ ID NO: 3 or SEQ ID NO: 4) may be polar (hydrophilic) amino acid (e.g. serine or threonine), or a positively charged amino acid (e.g. lysine or arginine).
[0088] Non-limiting examples of furin cleavage sites comprising one or more additional amino acids include: KQKSSNSRKKR (SEQ ID NO: 5), SRKKRS (SEQ ID NO: 6), SRKRRS (SEQ ID NO: 7), SKRKKRS (SEQ ID NO: 8), SKRKRRS (SEQ ID NO: 9), TSSKSRRRKKRSTS (SEQ ID NO: 10), AGLITGGRRTRRSI (SEQ ID NO: 11), KVADSLSTRKQKR (SEQ ID NO: 12) and LATGLRNTSQRSRRRKKRGL (SEQ ID NO: 13).
[0089] In some embodiments a furin cleavage site of the invention has at least 70% sequence identity to SEQ ID NO: 5. A furin cleavage site may have at least 80%, 85% or 90% sequence identity to SEQ ID NO: 5. Preferably a furin cleavage site has at least 95% sequence identity to SEQ ID NO: 5. More preferably, a furin cleavage site has at least 99% sequence identity to SEQ ID NO: 5. Particularly preferred is a furin cleavage site comprising or consisting of SEQ ID NO: 5.
[0090] The engineered clostridial neurotoxins of the invention may comprise an exogenous activation loop comprising any furin cleavage site as described herein. An exogenous activation loop may be produced by replacing one or more amino acids of an endogenous activation loop of a clostridial neurotoxin, as described herein. In some preferred embodiments, the replaced amino acids of the endogenous activation loop are replaced by a furin cleavage site or exogenous activation loop having the same number of amino acids. In other words, by way of illustration, if five amino acids are replaced in an endogenous activation loop, the replacement furin cleavage site or exogenous activation loop comprising said furin cleavage site has five amino acids. If ten amino acids are replaced in an endogenous activation loop, the replacement furin cleavage site or exogenous activation loop comprising said furin cleavage site has ten amino acids.
[0091] Non-limiting examples of such exogenous activation loops include CVRGIITSKTKSLSRKKRSALNDLC (SEQ ID NO: 14), CVRGIITSKTKSLSRKRRSALNDLC (SEQ ID NO: 15), CVRGIITSKTKSSKRKKRSALNDLC (SEQ ID NO: 16) CVRGIITSKTKSSKRKRRSALNDLC (SEQ ID NO: 17), CVRGITSSKSRRRKKRSTSALNDLC (SEQ ID NO: 18), CVRGIAGLITGGRRTRRSIALNDLC (SEQ ID NO: 19), CVRGIIKVADSLSTRKQKRALNDLC (SEQ ID NO: 20), CVRGILATGLRNTSQRSRRRKKRGLALNDLC (SEQ ID NO: 21) and CVRGIKQKSSNSRKKRSTSALNDLC (SEQ ID NO: 22), all of which are derived from the BONT/A1 activation loop. SEQ ID NO: 22 is a preferred example of an exogenous activation loop.
[0092] The invention provides a method for manufacturing an engineered clostridial neurotoxin according to the invention, comprising replacing an endogenous activation loop (or part thereof) of a clostridial neurotoxin by an exogenous activation loop or an exogenous cleavage site, thereby providing an engineered clostridial neurotoxin, wherein the exogenous cleavage site is a furin cleavage site as described herein, or the exogenous activation loop comprises said furin cleavage site. Typically said furin cleavage site comprises or consists of the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 or SEQ ID NO: 5, or the exogenous activation loop comprises said furin cleavage site.
[0093] The invention provides an engineered clostridial neurotoxin (e.g. obtainable by a method of the invention), wherein an endogenous activation loop (or part thereof) of a clostridial neurotoxin has been replaced by an exogenous activation loop or an exogenous cleavage site, thereby providing an engineered clostridial neurotoxin, wherein the exogenous cleavage site is a furin cleavage site as described herein, or the exogenous activation loop comprises said furin cleavage site. Typically said furin cleavage site comprises or consists of the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 or SEQ ID NO: 5, or the exogenous activation loop comprises said furin cleavage site.
[0094] A clostridial neurotoxin of the present invention (e.g. engineered clostridial neurotoxin) may be encoded by a nucleotide sequence having at least 70% sequence identity to SEQ ID NO: 23. A clostridial neurotoxin of the present invention may be encoded by a nucleotide sequence having at least 80% or 90% sequence identity to SEQ ID NO: 23. Preferably, a clostridial neurotoxin of the present invention may be encoded by a nucleotide sequence comprising (more preferably consisting of) SEQ ID NO: 23.
[0095] A clostridial neurotoxin of the present invention (e.g. engineered clostridial neurotoxin) may comprise a polypeptide sequence having at least 70% sequence identity to one or more of SEQ ID NOs: 24 or 70 to 78. A clostridial neurotoxin of the present invention may comprise a polypeptide sequence having at least 80% or 90% sequence identity to one or more of SEQ ID NOs: 24 or 70 to 78. Preferably, a clostridial neurotoxin of the present invention may comprise (more preferably consist of) a polypeptide sequence shown as any one of SEQ ID NOs: 24 or 70 to 78.
[0096] The clostridial neurotoxin of the present invention (e.g. engineered clostridial neurotoxin) is preferably BoNT/A, even more preferably BoNT/A1, wherein the clostridial neurotoxin is encoded by a nucleotide sequence having at least 70% sequence identity to SEQ ID NO: 23. The clostridial neurotoxin may be encoded by a nucleotide sequence having at least 80% or 90% sequence identity to SEQ ID NO: 23. Preferably the clostridial neurotoxin is encoded by a nucleotide sequence comprising (or consisting of) SEQ ID NO: 23. The clostridial neurotoxin of the present invention is preferably BoNT/A, even more preferably BoNT/A1, wherein the clostridial neurotoxin comprises a polypeptide sequence having at least 70% sequence identity to SEQ ID NO: 24. The clostridial neurotoxin may comprise a polypeptide sequence having at least 80% or 90% sequence identity to SEQ ID NO: 24. Preferably the clostridial neurotoxin comprises (or consists of) a polypeptide sequence shown as SEQ ID NO: 24.
[0097] The polypeptide sequences of the invention (or the nucleotide sequences encoding the same) may include a purification tag, such as a His-tag. It is intended that the present invention also encompasses polypeptide sequences (and nucleotide sequences encoding the same) where the purification tag is removed.
Clostridial Neurotoxins
[0098] The clostridial neurotoxin (e.g. pre-engineering) may be BoNT/A. An exemplary reference BoNT/A sequence is shown as SEQ ID NO: 25.
[0099] The clostridial neurotoxin (e.g. pre-engineering) may be BoNT/B. An exemplary reference BoNT/B sequence is shown as SEQ ID NO: 26.
[0100] The clostridial neurotoxin (e.g. pre-engineering) may be BoNT/C. An exemplary reference BoNT/C1 sequence is shown as SEQ ID NO: 27.
[0101] The clostridial neurotoxin (e.g. pre-engineering) may be BoNT/D. An exemplary reference BoNT/D sequence is shown as SEQ ID NO: 28.
[0102] The clostridial neurotoxin (e.g. pre-engineering) may be BoNT/E. An exemplary reference BoNT/E sequence is shown as SEQ ID NO: 29.
[0103] The clostridial neurotoxin (e.g. pre-engineering) may be BoNT/F. An exemplary reference BoNT/F sequence is shown as SEQ ID NO: 30.
[0104] The clostridial neurotoxin (e.g. pre-engineering) may be BoNT/G. An exemplary reference BoNT/G sequence is shown as SEQ ID NO: 31.
[0105] The clostridial neurotoxin (e.g. pre-engineering) may be BoNT/X. An exemplary reference BoNT/X sequence is shown as SEQ ID NO: 32.
[0106] The clostridial neurotoxin (e.g. pre-engineering) may be TeNT. An exemplary reference TeNT sequence is shown as SEQ ID NO: 33.
[0107] As discussed above, activated clostridial neurotoxins are formed from two polypeptide chains, the heavy chain (H-chain), which has a molecular mass of approximately 100 kDa, and the light chain (L-chain), which has a molecular mass of approximately 50 kDa. The H-chain comprises a C-terminal targeting component (receptor binding domain or H.sub.C domain) and an N-terminal translocation component (H.sub.N domain).
[0108] Examples of light chain reference sequences include: [0109] Botulinum type A neurotoxin: amino acid residues 1-448 [0110] Botulinum type B neurotoxin: amino acid residues 1-440 [0111] Botulinum type C1 neurotoxin: amino acid residues 1-441 [0112] Botulinum type D neurotoxin: amino acid residues 1-445 [0113] Botulinum type E neurotoxin: amino acid residues 1-422 [0114] Botulinum type F neurotoxin: amino acid residues 1-439 [0115] Botulinum type G neurotoxin: amino acid residues 1-441 [0116] Tetanus neurotoxin: amino acid residues 1-457
[0117] For recently-identified BoNT/X, the L-chain has been reported as corresponding to amino acids 1-439 thereof, with the L-chain boundary potentially varying by approximately 25 amino acids (e.g. 1-414 or 1-464).
[0118] The above-identified reference sequences should be considered a guide, as slight variations may occur according to sub-serotypes. By way of example, US 2007/0166332 (hereby incorporated by reference in its entirety) cites slightly different clostridial sequences: [0119] Botulinum type A neurotoxin: amino acid residues M1-K448 [0120] Botulinum type B neurotoxin: amino acid residues M1-K441 [0121] Botulinum type C1 neurotoxin: amino acid residues M1-K449 [0122] Botulinum type D neurotoxin: amino acid residues M1-R445 [0123] Botulinum type E neurotoxin: amino acid residues M1-R422 [0124] Botulinum type F neurotoxin: amino acid residues M1-K439 [0125] Botulinum type G neurotoxin: amino acid residues M1-K446 [0126] Tetanus neurotoxin: amino acid residues M1-A457
[0127] Alternatively, clostridial neurotoxin L-chains may be defined as the first amino acid (including or excluding an initial methionine residue) through to the first cysteine residue of the endogenous activation loop. In addition or alternatively, a clostridial neurotoxin L-chain may be defined as the amino acid sequence N-terminal to the cleavage site within the endogenous activation loop.
[0128] Clostridial neurotoxin L-chains may be defined as a clostridial neurotoxin domain which comprises the metal coordinating HExxH motif (SEQ ID NO: 58), which typically functions to cleave a SNARE protein substrate.
[0129] The term light-chain (or L-chain) encompasses variants and fragments thereof, provided said variants and fragments still demonstrate non-cytotoxic protease activity (which can be determined using standard assays known in the art, examples of which are described herein). By way of example, a variant may have at least 70%, preferably at least 80%, more preferably at least 90%, and most preferably at least 95% or at least 98% amino acid sequence homology with a reference L-chain. The term fragment, when used in relation to a L-chain, means a peptide having at least 200, preferably at least 250, more preferably at least 300, even more preferably at least 350, and most preferably at least 400 amino acid residues of the reference L-chain. In the case of a clostridial L-chain, the fragment preferably at least 300, more preferably at least 350, and most preferably at least 400 amino acid residues of the reference L-chain. L-chain fragments of the present invention embrace fragments of variant L-chains based on the reference sequences.
[0130] A clostridial neurotoxin H-chains may be defined as the second cysteine of the endogenous activation loop through to the final amino acid. In addition or alternatively, a clostridial neurotoxin H-chain may be defined as starting from the amino acid sequence C-terminal to the cleavage site within the endogenous activation loop. In addition or alternatively, a clostridial neurotoxin H-chain may be defined as starting from the amino acid C-terminal to the cysteine residue (typically the second cysteine residue) that forms a disulphide bond between the L- and H-chain and so defines the C-terminal of the endogenous activation loop.
[0131] A Translocation Domain is a molecule that enables translocation of a protease into a target cell such that a functional expression of protease activity occurs within the cytosol of the target cell. Whether any molecule (e.g. a protein or peptide) possesses the requisite translocation function of the present invention may be confirmed by any one of a number of conventional assays.
[0132] For example, Shone C. (1987) describes an in vitro assay employing liposomes, which are challenged with a test molecule. Presence of the requisite translocation function is confirmed by release from the liposomes of K.sup.+ and/or labelled NAD, which may be readily monitored (see Shone C. (1987) Eur. J. Biochem; vol. 167(1): pp. 175-180).
[0133] A further example is provided by Blaustein R. (1987), which describes a simple in vitro assay employing planar phospholipid bilayer membranes. The membranes are challenged with a test molecule and the requisite translocation function is confirmed by an increase in conductance across said membranes (see Blaustein (1987) FEBS Letts; vol. 226, no. 1: pp. 115-120).
[0134] Additional methodology to enable assessment of membrane fusion and thus identification of Translocation Domains suitable for use in the present invention are provided by Methods in Enzymology Vol 220 and 221, Membrane Fusion Techniques, Parts A and B, Academic Press 1993.
[0135] The present invention also embraces variants and/or fragments of translocation domains, so long as the variant domains still demonstrate the requisite translocation activity. By way of example, a variant may have at least 70%, preferably at least 80%, more preferably at least 90%, and most preferably at least 95% or at least 98% amino acid sequence homology with a reference translocation domain. The term fragment, when used in relation to a translocation domain, means a peptide having at least 20, preferably at least 40, more preferably at least 80, and most preferably at least 100 amino acid residues of the reference translocation domain. In the case of a clostridial translocation domain, the fragment preferably has at least 100, preferably at least 150, more preferably at least 200, and most preferably at least 250 amino acid residues of the reference translocation domain (eg. H.sub.N domain). Translocation fragments of the present invention embrace fragments of variant translocation domains based on the reference sequences.
[0136] The Translocation Domain is preferably capable of formation of ion-permeable pores in lipid membranes under conditions of low pH. Preferably it has been found to use only those portions of the protein molecule capable of pore-formation within the endosomal membrane.
[0137] The Translocation Domain may be obtained from a microbial protein source, in particular from a bacterial or viral protein source. Hence, the Translocation Domain may be a translocating domain of an enzyme, such as a bacterial toxin or viral protein.
[0138] It is well documented that certain domains of bacterial toxin molecules are capable of forming such pores. It is also known that certain translocation domains of virally expressed membrane fusion proteins are capable of forming such pores. Such domains may be employed in the present invention.
[0139] The Translocation Domain may be of a clostridial origin, such as the H.sub.N domain (or a functional component thereof). H.sub.N means a portion or fragment of the H-chain of a clostridial neurotoxin approximately equivalent to the amino-terminal half of the H-chain, or the domain corresponding to that fragment in the intact H-chain. The H.sub.C function of the H-chain may be removed by deletion of the H.sub.C amino acid sequence (either at the DNA synthesis level, or at the post-synthesis level by nuclease or protease treatment). Alternatively, the H.sub.C function may be inactivated by chemical or biological treatment. Thus, the H-chain may be incapable of binding to the Binding Site on a target cell to which native clostridial neurotoxin (i.e. holotoxin) binds.
[0140] Examples of suitable (reference) Translocation Domains include: [0141] Botulinum type A neurotoxinamino acid residues (449-871) [0142] Botulinum type B neurotoxinamino acid residues (441-858) [0143] Botulinum type C neurotoxinamino acid residues (442-866) [0144] Botulinum type D neurotoxinamino acid residues (446-862) [0145] Botulinum type E neurotoxinamino acid residues (423-845) [0146] Botulinum type F neurotoxinamino acid residues (440-864) [0147] Botulinum type G neurotoxinamino acid residues (442-863) [0148] Botulinum type X neurotoxinamino acid residues (461-890) [0149] Tetanus neurotoxinamino acid residues (458-879)
[0150] For recently-identified BoNT/X, the translocation domain has been reported as corresponding to amino acids 460-890 thereof, with the L-chain and H.sub.C boundaries potentially varying by approximately 10 amino acids (e.g. 461-889 or 454-891).
[0151] The above-identified reference sequence should be considered a guide as slight variations may occur according to sub-serotypes. By way of example, US 2007/0166332 (hereby incorporated by reference thereto) cites slightly different clostridial sequences: [0152] Botulinum type A neurotoxinamino acid residues (A449-K871) [0153] Botulinum type B neurotoxinamino acid residues (A442-S858) [0154] Botulinum type C neurotoxinamino acid residues (T450-N866) [0155] Botulinum type D neurotoxinamino acid residues (D446-N862) [0156] Botulinum type E neurotoxinamino acid residues (K423-K845) [0157] Botulinum type F neurotoxinamino acid residues (A440-K864) [0158] Botulinum type G neurotoxinamino acid residues (S447-S863) [0159] Tetanus neurotoxinamino acid residues (S458-V879)
[0160] In the context of the present invention, a variety of clostridial neurotoxin H.sub.N regions comprising a translocation domain can be useful in aspects of the present invention with the proviso that these active fragments can facilitate the release of a non-cytotoxic protease (e.g. a clostridial L-chain) from intracellular vesicles into the cytoplasm of the target cell and thus participate in executing the overall cellular mechanism whereby a clostridial neurotoxin proteolytically cleaves a substrate. The H.sub.N regions from the heavy chains of clostridial neurotoxins are approximately 410-430 amino acids in length and comprise a translocation domain. Research has shown that the entire length of a H.sub.N region from a clostridial neurotoxin heavy chain is not necessary for the translocating activity of the translocation domain. Thus, in the context of the present invention a translocation domain can include clostridial neurotoxin H.sub.N regions comprising a translocation domain having a length of, for example, at least 350 amino acids, at least 375 amino acids, at least 400 amino acids and at least 425 amino acids. Also encompassed are clostridial neurotoxin H.sub.N regions comprising translocation domain having a length of, for example, at most 350 amino acids, at most 375 amino acids, at most 400 amino acids and at most 425 amino acids.
[0161] For further details on the genetic basis of toxin production in Clostridium botulinum and C. tetani, we refer to Henderson et al (1997) in The Clostridia: Molecular Biology and Pathogenesis, Academic press.
[0162] The term H.sub.N embraces naturally-occurring neurotoxin H.sub.N portions, and modified H.sub.N portions having amino acid sequences that do not occur in nature and/or synthetic amino acid residues, so long as the modified H.sub.N portions still demonstrate the above-mentioned translocation function.
[0163] Alternatively, the Translocation Domain may be of a non-clostridial origin. Examples of non-clostridial (reference) Translocation Domain origins include, but not be restricted to, the translocation domain of diphtheria toxin (O'Keefe et al., Proc. Natl. Acad. Sci. USA (1992) 89, 6202-6206; Silverman et al., J. Biol. Chem. (1993) 269, 22524-22532; and London, E. (1992) Biochem. Biophys. Acta., 1112, pp.25-51), the translocation domain of Pseudomonas exotoxin type A (Prior et al. Biochemistry (1992) 31, 3555-3559), the translocation domains of anthrax toxin (Blanke et al. Proc. Natl. Acad. Sci. USA (1996) 93, 8437-8442), a variety of fusogenic or hydrophobic peptides of translocating function (Plank et al. J. Biol. Chem. (1994) 269, 12918-12924; and Wagner et al (1992) PNAS, 89, pp.7934-7938), and amphiphilic peptides (Murata et al (1992) Biochem., 31, pp. 1986-1992). The Translocation Domain may mirror the Translocation Domain present in a naturally-occurring protein, or may include amino acid variations so long as the variations do not destroy the translocating ability of the Translocation Domain.
[0164] Particular examples of viral (reference) Translocation Domains suitable for use in the present invention include certain translocating domains of virally expressed membrane fusion proteins. For example, Wagner et al. (1992) and Murata et al. (1992) describe the translocation (i.e. membrane fusion and vesiculation) function of a number of fusogenic and amphiphilic peptides derived from the N-terminal region of influenza virus haemagglutinin. Other virally expressed membrane fusion proteins known to have the desired translocating activity are a translocating domain of a fusogenic peptide of Semliki Forest Virus (SFV), a translocating domain of vesicular stomatitis virus (VSV) glycoprotein G, a translocating domain of SER virus F protein and a translocating domain of Foamy virus envelope glycoprotein. Virally encoded Aspike proteins have particular application in the context of the present invention, for example, the E1 protein of SFV and the G protein of the G protein of VSV.
[0165] Use of the (reference) Translocation Domains listed in Table (below) includes use of sequence variants thereof. A variant may comprise one or more conservative nucleic acid substitutions and/or nucleic acid deletions or insertions, with the proviso that the variant possesses the requisite translocating function. A variant may also comprise one or more amino acid substitutions and/or amino acid deletions or insertions, so long as the variant possesses the requisite translocating function.
TABLE-US-00002 Translocation Domainsource Aminoacidresidues References Diphtheriatoxin 194-380 Silvermanetal.,1994,J.Biol.Chem. 269,22524-22532 LondonE.,1992,Biochem.Biophys. Acta.,1113,25-51 DomainIIof 405-613 Prioretal.,1992,Biochemistry31,3555- pseudomonas 3559 exotoxin Kihara&Pastan,1994,BioconjChem.5, 532-538 Influenzavirus GLFGAIAGFIENGWE Planketal.,1994,J.Biol.Chem.269, haemagglutinin GMIDGWYG(SEQID 12918-12924 NO:73),and Wagneretal.,1992,PNAS,89,7934- Variantsthereof 7938 Murataetal.,1992,Biochemistry31, 1986-1992 SemlikiForestvirus Translocationdomain Kielianetal.,1996,JCellBiol.134(4), fusogenicprotein 863-872 VesicularStomatitis 118-139 Yaoetal.,2003,Virology310(2),319-332 virusglycoprotein G SERvirusFprotein Translocationdomain Sethetal.,2003,JVirol77(11)6520- 6527 Foamyvirus Translocationdomain Picard-Maureauetal.,2003,JVirol. envelope 77(8),4722-4730 glycoprotein
[0166] Examples of clostridial neurotoxin H.sub.C domain reference sequences include: [0167] BONT/AN872-L1296 [0168] BONT/BE859-E1291 [0169] BONT/C1N867-E1291 [0170] BONT/DS863-E1276 [0171] BONT/ER846-K1252 [0172] BONT/FK865-E1274 [0173] BONT/GN864-E1297 [0174] TeNTI880-D1315
[0175] For recently-identified BoNT/X, the H.sub.C domain has been reported as corresponding to amino acids 893-1306 thereof, with the domain boundary potentially varying by approximately 25 amino acids (e.g. 868-1306 or 918-1306).
[0176] The clostridial neurotoxins described herein may further comprise a translocation facilitating domain. Said domain facilitates delivery of the non-cytotoxic protease into the cytosol of the target cell and are described, for example, in WO 08/008803 and WO 08/008805, each of which is herein incorporated by reference thereto.
[0177] By way of example, suitable translocation facilitating domains include an enveloped virus fusogenic peptide domain, for example, suitable fusogenic peptide domains include influenzavirus fusogenic peptide domain (eg. influenza A virus fusogenic peptide domain of 23 amino acids), alphavirus fusogenic peptide domain (eg. Semliki Forest virus fusogenic peptide domain of 26 amino acids), vesiculovirus fusogenic peptide domain (eg. vesicular stomatitis virus fusogenic peptide domain of 21 amino acids), respirovirus fusogenic peptide domain (eg. Sendai virus fusogenic peptide domain of 25 amino acids), morbiliivirus fusogenic peptide domain (eg. Canine distemper virus fusogenic peptide domain of 25 amino acids), avulavirus fusogenic peptide domain (eg. Newcastle disease virus fusogenic peptide domain of 25 amino acids), henipavirus fusogenic peptide domain (eg. Hendra virus fusogenic peptide domain of 25 amino acids), metapneumovirus fusogenic peptide domain (eg. Human metapneumovirus fusogenic peptide domain of 25 amino acids) or spumavirus fusogenic peptide domain such as simian foamy virus fusogenic peptide domain; or fragments or variants thereof.
[0178] By way of further example, a translocation facilitating domain may comprise a clostridial neurotoxin H.sub.CN domain or a fragment or variant thereof. In more detail, a clostridial neurotoxin H.sub.CN translocation facilitating domain may have a length of at least 200 amino acids, at least 225 amino acids, at least 250 amino acids, at least 275 amino acids. In this regard, a clostridial neurotoxin H.sub.CN translocation facilitating domain preferably has a length of at most 200 amino acids, at most 225 amino acids, at most 250 amino acids, or at most 275 amino acids. Specific (reference) examples include: [0179] Botulinum type A neurotoxinamino acid residues (872-1110) [0180] Botulinum type B neurotoxinamino acid residues (859-1097) [0181] Botulinum type C neurotoxinamino acid residues (867-1111) [0182] Botulinum type D neurotoxinamino acid residues (863-1098) [0183] Botulinum type E neurotoxinamino acid residues (846-1085) [0184] Botulinum type F neurotoxinamino acid residues (865-1105) [0185] Botulinum type G neurotoxinamino acid residues (864-1105) [0186] Botulinum type X neurotoxinamino acid residues (890-1121) [0187] Tetanus neurotoxinamino acid residues (880-1127)
[0188] The above sequence positions may vary a little according to serotype/sub-type, and further examples of suitable (reference) clostridial neurotoxin H.sub.CN domains include: [0189] Botulinum type A neurotoxinamino acid residues (874-1110) [0190] Botulinum type B neurotoxinamino acid residues (861-1097) [0191] Botulinum type C neurotoxinamino acid residues (869-1111) [0192] Botulinum type D neurotoxinamino acid residues (865-1098) [0193] Botulinum type E neurotoxinamino acid residues (848-1085) [0194] Botulinum type F neurotoxinamino acid residues (867-1105) [0195] Botulinum type G neurotoxinamino acid residues (866-1105) [0196] Tetanus neurotoxinamino acid residues (882-1127)
[0197] Any of the above-described facilitating domains may be combined with any of the previously described translocation domain peptides that are suitable for use in the present invention. Thus, by way of example, a non-clostridial facilitating domain may be combined with non-clostridial translocation domain peptide or with clostridial translocation domain peptide. Alternatively, a clostridial neurotoxin H.sub.CN translocation facilitating domain may be combined with a non-clostridial translocation domain peptide. Alternatively, a clostridial neurotoxin HCN facilitating domain may be combined or with a clostridial translocation domain peptide, examples of which include: [0198] Botulinum type A neurotoxinamino acid residues (449-1110) [0199] Botulinum type B neurotoxinamino acid residues (442-1097) [0200] Botulinum type C neurotoxinamino acid residues (450-1111) [0201] Botulinum type D neurotoxinamino acid residues (446-1098) [0202] Botulinum type E neurotoxinamino acid residues (423-1085) [0203] Botulinum type F neurotoxinamino acid residues (440-1105) [0204] Botulinum type G neurotoxinamino acid residues (447-1105) [0205] Tetanus neurotoxinamino acid residues (458-1127)
[0206] In some embodiments the clostridial neurotoxins of the present invention may lack a functional H.sub.C domain of a clostridial neurotoxin. Accordingly, said clostridial neurotoxins are not able to bind rat synaptosomal membranes (via a clostridial H.sub.C component) in binding assays as described in Shone et al. (1985) Eur. J. Biochem. 151, 75-82. The clostridial neurotoxins may preferably lack the last 50 C-terminal amino acids of a clostridial neurotoxin holotoxin. The clostridial neurotoxins may preferably lack the last 100, preferably the last 150, more preferably the last 200, particularly preferably the last 250, and most preferably the last 300 C-terminal amino acid residues of a clostridial neurotoxin holotoxin. Alternatively, the H.sub.C binding activity may be negated/reduced by mutagenesisby way of example, referring to BoNT/A for convenience, modification of one or two amino acid residue mutations (W1266 to L and Y1267 to F) in the ganglioside binding pocket causes the H.sub.C region to lose its receptor binding function. Analogous mutations may be made to non-serotype A clostridial peptide components, e.g. a construct based on botulinum B with mutations (W1262 to L and Y1263 to F) or botulinum E (W1224 to L and Y1225 to F). Other mutations to the active site achieve the same ablation of H.sub.C receptor binding activity, e.g. Y1267S in botulinum type A toxin and the corresponding highly conserved residue in the other clostridial neurotoxins. Details of this and other mutations are described in Rummel et al (2004) (Molecular Microbiol. 51:631-634), which is hereby incorporated by reference thereto.
[0207] The H.sub.C peptide of a native clostridial neurotoxin comprises approximately 400-440 amino acid residues, and consists of two functionally distinct domains of approximately 25 kDa each, namely the N-terminal region (commonly referred to as the H.sub.CN peptide or domain) and the C-terminal region (commonly referred to as the Hcc peptide or domain). This fact is confirmed by the following publications, each of which is herein incorporated in its entirety by reference thereto: Umland TC (1997) Nat. Struct. Biol. 4:788-792; Herreros J (2000) Biochem. J. 347:199-204; Halpern J (1993) J. Biol. Chem. 268:15, pp. 11188-11192; Rummel A (2007) PNAS 104:359-364; Lacey DB (1998) Nat. Struct. Biol. 5:898-902; Knapp (1998) Am. Cryst. Assoc. Abstract Papers 25:90; Swaminathan and Eswaramoorthy (2000) Nat. Struct. Biol. 7:1751-1759; and Rummel A (2004) Mol. Microbiol. 51(3), 631-643. Moreover, it has been well documented that the C-terminal region (Hcc), which constitutes the C-terminal 160-200 amino acid residues, is responsible for binding of a clostridial neurotoxin to its natural cell receptors, namely to nerve terminals at the neuromuscular junctionthis fact is also confirmed by the above publications. Thus, reference throughout this specification to a clostridial heavy-chain lacking a functional heavy chain H.sub.C peptide (or domain) such that the heavy-chain is incapable of binding to cell surface receptors to which a native clostridial neurotoxin binds means that the clostridial heavy-chain simply lacks a functional H.sub.CC peptide. In other words, the H.sub.CC peptide region may be either partially or wholly deleted, or otherwise modified (e.g. through conventional chemical or proteolytic treatment) to inactivate its native binding ability for nerve terminals at the neuromuscular junction. Thus, a clostridial neurotoxin H.sub.N peptide of the present invention may be C-terminally extended, i.e. it may be associated with all or part of a clostridial neurotoxin H.sub.C domain, e.g. the H.sub.CN, H.sub.CC or H.sub.C domain. References herein to a clostridial neurotoxin H.sub.N peptide of the present invention encompass such C-terminally extended H.sub.N peptides, which comprise one or more amino acid residues from a clostridial neurotoxin H.sub.C domain. Alternatively, a clostridial neurotoxin H.sub.N peptide of the present invention may not be associated with (or lack) all or part of a clostridial neurotoxin H.sub.C domain, e.g. the H.sub.CN, H.sub.CC or H.sub.C domain.
[0208] Typically if a clostridial neurotoxin of the invention or a clostridial neurotoxin H.sub.N peptide of the present invention lacks all or part of a C-terminal peptide portion (H.sub.CC) of a clostridial neurotoxin it thus lacks the H.sub.C binding function of native clostridial neurotoxin. By way of example, a C-terminally extended clostridial H.sub.N peptide may lack the C-terminal 40 amino acid residues, or the C-terminal 60 amino acid residues, or the C-terminal 80 amino acid residues, or the C-terminal 100 amino acid residues, or the C-terminal 120 amino acid residues, or the C-terminal 140 amino acid residues, or the C-terminal 150 amino acid residues, or the C-terminal 160 amino acid residues of a clostridial neurotoxin heavy-chain. Alternatively, the clostridial H.sub.N peptide of the present invention may lack the entire C-terminal peptide portion (H.sub.CC) of a clostridial neurotoxin and thus lacks the H.sub.C binding function of native clostridial neurotoxin. By way of example, the clostridial H.sub.N peptide may lack the C-terminal 165 amino acid residues, or the C-terminal 170 amino acid residues, or the C-terminal 175 amino acid residues, or the C-terminal 180 amino acid residues, or the C-terminal 185 amino acid residues, or the C-terminal 190 amino acid residues, or the C-terminal 195 amino acid residues of a clostridial neurotoxin heavy-chain. By way of further example, the clostridial H.sub.N peptide of the present invention lacks a clostridial H.sub.CC reference sequence selected from the group consisting of: [0209] Botulinum type A neurotoxinamino acid residues (Y1111-L1296) [0210] Botulinum type B neurotoxinamino acid residues (Y1098-E1291) [0211] Botulinum type C neurotoxinamino acid residues (Y1112-E1291) [0212] Botulinum type D neurotoxinamino acid residues (Y1099-E1276) [0213] Botulinum type E neurotoxinamino acid residues (Y1086-K1252) [0214] Botulinum type F neurotoxinamino acid residues (Y1106-E1274) [0215] Botulinum type G neurotoxinamino acid residues (Y1106-E1297) [0216] Botulinum type X neurotoxinamino acid residues (Y1122-D1306) Tetanus neurotoxinamino acid residues (Y1128-D1315).
[0217] The above-identified reference sequences should be considered a guide as slight variations may occur according to sub-serotypes.
[0218] The present invention is suitable for application to many different varieties of clostridial neurotoxin. Thus, in the context of the present invention, the term clostridial neurotoxin embraces toxins produced by C. botulinum (botulinum neurotoxin serotypes A, B, C1, D, E, F, G, H, and X), C. tetani (tetanus neurotoxin), C. butyricum (botulinum neurotoxin serotype E), and C. baratii (botulinum neurotoxin serotype F), as well as modified clostridial neurotoxins or derivatives derived from any of the foregoing. The term clostridial neurotoxin also embraces botulinum neurotoxin serotype H. Preferably the clostridial neurotoxin is BoNT/A, more preferably BoNT/A.sub.1.
[0219] Botulinum neurotoxin (BoNT) is produced by C. botulinum in the form of a large protein complex, consisting of BoNT itself complexed to a number of accessory proteins. There are at present nine different classes of botulinum neurotoxin, namely: botulinum neurotoxin serotypes A, B, C1, D, E, F, G, H, and X all of which share similar structures and modes of action. Different BONT serotypes can be distinguished based on inactivation by specific neutralising anti-sera, with such classification by serotype correlating with percentage sequence identity at the amino acid level. BoNT proteins of a given serotype are further divided into different subtypes on the basis of amino acid percentage sequence identity.
[0220] BoNTs are absorbed in the gastrointestinal tract, and, after entering the general circulation, bind to the presynaptic membrane of cholinergic nerve terminals and prevent the release of their neurotransmitter acetylcholine. BoNT/B, BoNT/D, BoNT/F and BoNT/G cleave synaptobrevin/vesicle-associated membrane protein (VAMP); BoNT/C1, BoNT/A and BoNT/E cleave the synaptosomal-associated protein of 25 kDa (SNAP-25); and BoNT/C1 cleaves syntaxin. BoNT/X has been found to cleave SNAP-25, VAMP1, VAMP2, VAMP3, VAMP4, VAMP5, Ykt6, and syntaxin 1.
[0221] Tetanus toxin is produced in a single serotype by C. tetani. C. butyricum produces BONT/E, while C. baratii produces BoNT/F.
[0222] The term clostridial neurotoxin is also intended to embrace modified clostridial neurotoxins and derivatives thereof, including but not limited to those described below. A modified clostridial neurotoxin or derivative may contain one or more amino acids that has been modified as compared to the native (unmodified) form of the clostridial neurotoxin, or may contain one or more inserted amino acids that are not present in the native (unmodified) form of the clostridial neurotoxin. By way of example, a modified clostridial neurotoxin may have modified amino acid sequences in one or more domains relative to the native (unmodified) clostridial neurotoxin sequence. Such modifications may modify functional aspects of the toxin, for example biological activity or persistence. Thus, a clostridial neurotoxin of the invention may be a modified clostridial neurotoxin, or a modified clostridial neurotoxin derivative, or a clostridial neurotoxin derivative. In particular, an engineered clostridial neurotoxin of the invention may be an engineered modified clostridial neurotoxin, or an engineered modified clostridial neurotoxin derivative, or an engineered clostridial neurotoxin derivative.
[0223] A modified clostridial neurotoxin may have one or more modifications in the amino acid sequence of the heavy chain (such as a modified H.sub.C domain), wherein said modified heavy chain binds to target nerve cells with a higher or lower affinity than the native (unmodified) clostridial neurotoxin. Such modifications in the H.sub.C domain can include modifying residues in the ganglioside binding site of the H.sub.C domain or in the protein (SV2 or synaptotagmin) binding site that alter binding to the ganglioside receptor and/or the protein receptor of the target nerve cell. Examples of such modified clostridial neurotoxins are described in WO 2006/027207 and WO 2006/114308, both of which are hereby incorporated by reference in their entirety.
[0224] A modified clostridial neurotoxin may have one or more modifications in the amino acid sequence of the light chain, for example modifications in the substrate binding or catalytic domain which may alter or modify the SNARE protein specificity of the modified L-chain. Examples of such modified clostridial neurotoxins are described in WO 2010/120766 and US 2011/0318385, both of which are hereby incorporated by reference in their entirety.
[0225] A modified clostridial neurotoxin may comprise one or more modifications that increases or decreases the biological activity and/or the biological persistence of the modified clostridial neurotoxin. For example, a modified clostridial neurotoxin may comprise a leucine- or tyrosine-based motif, wherein said motif increases or decreases the biological activity and/or the biological persistence of the modified clostridial neurotoxin. Suitable leucine-based motifs include xDxxxLL (SEQ ID NO: 60), xExxxLL (SEQ ID NO: 61), xExxxIL (SEQ ID NO: 62), and xExxxLM (SEQ ID NO: 63) (wherein x is any amino acid). Suitable tyrosine-based motifs include Y-x-x-Hy (SEQ ID NO: 64) (wherein Hy is a hydrophobic amino acid). Examples of modified clostridial neurotoxins comprising leucine- and tyrosine-based motifs are described in WO 2002/008268, which is hereby incorporated by reference in its entirety.
[0226] The term clostridial neurotoxin is intended to embrace hybrid and chimeric clostridial neurotoxins. A hybrid clostridial neurotoxin comprises at least a portion of a light chain from one clostridial neurotoxin or subtype thereof, and at least a portion of a heavy chain from another clostridial neurotoxin or clostridial neurotoxin subtype. A hybrid clostridial neurotoxin may contain the entire light chain from one clostridial neurotoxin subtype and the heavy chain from another clostridial neurotoxin subtype. A chimeric clostridial neurotoxin may contain a portion (e.g. the binding domain) of the heavy chain of one clostridial neurotoxin subtype, with another portion of the heavy chain being from another clostridial neurotoxin subtype. A chimeric clostridial neurotoxin, particularly a chimeric BoNT, may be defined in terms of the serotype or sub-serotype of the four main domains of the neurotoxin: L-chain, H.sub.N, H.sub.CN and H.sub.CC (as defined herein). For example, the (pre-engineering) LH.sub.N/A1-H.sub.CB1 chimera of SEQ ID NO: 69 may be described as an AABB chimera. Similarly or alternatively, the therapeutic element may comprise light chain portions from different clostridial neurotoxins. Such hybrid or chimeric clostridial neurotoxins are useful, for example, as a means of delivering the therapeutic benefits of such clostridial neurotoxins to patients who are immunologically resistant to a given clostridial neurotoxin subtype, to patients who may have a lower than average concentration of receptors to a given clostridial neurotoxin heavy chain binding domain, or to patients who may have a protease-resistant variant of the membrane or vesicle toxin substrate (e.g., SNAP-25, VAMP and syntaxin). Hybrid and chimeric clostridial neurotoxins are described in U.S. Pat. No. 8,071,110, which publication is hereby incorporated by reference in its entirety. Thus, a clostridial neurotoxin of the invention may be a hybrid clostridial neurotoxin, or a chimeric clostridial neurotoxin. In particular, an engineered clostridial neurotoxin of the invention may be an engineered hybrid clostridial neurotoxin, or an engineered chimeric clostridial neurotoxin.
[0227] In some preferred embodiments, a clostridial neurotoxin is BoNT/A comprising at least one domain from a non-BoNT/A clostridial neurotoxin (e.g. a BoNT/A hybrid or chimera). For example, a clostridial neurotoxin of the invention (comprising a furin cleavage site) may comprise: [0228] i. A BONT/A L-chain and a non-BoNT/A H.sub.N and H.sub.C domain; [0229] ii. A BONT/A H.sub.N domain and a non-BoNT/A L-chain and H.sub.C domain [0230] iii. A BONT/A H.sub.C domain and a non-BoNT/A L-chain and H.sub.N domain; [0231] iv. A BONT/A L-chain and H.sub.N domain and a non-BoNT/A H.sub.C domain [0232] v. A BONT/A L-chain and H.sub.C domain and a non-BoNT/A H.sub.N domain; or [0233] vi. A BONT/A H.sub.N domain and H.sub.C domain and a non-BoNT/A L-chain.
[0234] By way of non-limiting example, a clostridial neurotoxin of the invention (e.g. an engineered clostridial neurotoxin) comprises a BoNT/A L-chain and H.sub.N domain and a BoNT/B H.sub.C domain (such as LH.sub.N/A1-H.sub.C/B1). An exemplary non-engineered LH.sub.N/A1-H.sub.CB1 chimera that may be modified to comprises a furin cleavage site according to the invention is given in SEQ ID NO: 69. An exemplary engineered form of the LH.sub.N/A1-H.sub.CB1 chimera of SEQ ID NO: 69 is given in SEQ ID NO: 70. A clostridial neurotoxin of the invention (e.g. an engineered clostridial neurotoxin) may comprise a BoNT/A L-chain and H.sub.N domain and a BoNT/C1 H.sub.C domain. A clostridial neurotoxin of the invention (e.g. an engineered clostridial neurotoxin) may comprise a BoNT/A L-chain and H.sub.N domain and a BoNT/D H.sub.C domain. A clostridial neurotoxin of the invention (e.g. an engineered clostridial neurotoxin) may comprise a BoNT/A L-chain and H.sub.N domain and a BoNT/E H.sub.C domain. A clostridial neurotoxin of the invention (e.g. an engineered clostridial neurotoxin) may comprise a BoNT/A L-chain and H.sub.N domain and a BoNT/F H.sub.C domain. A clostridial neurotoxin of the invention (e.g. an engineered clostridial neurotoxin) may comprise a BoNT/A L-chain and H.sub.N domain and a BoNT/G H.sub.C domain. A clostridial neurotoxin of the invention (e.g. an engineered clostridial neurotoxin) may comprise a BoNT/A L-chain and H.sub.N domain and a BoNT/X H.sub.C domain. A clostridial neurotoxin of the invention (e.g. an engineered clostridial neurotoxin) may comprise a BoNT/A L-chain and H.sub.N domain and a TeNT H.sub.C domain.
[0235] For example, a clostridial neurotoxin of the invention (e.g. an engineered clostridial [0236] i. A BONT/B L-chain and a non-BoNT/B H.sub.N and H.sub.C domain; [0237] ii. A BONT/B H.sub.N domain and a non-BoNT/B L-chain and H.sub.C domain [0238] iii. A BONT/B H.sub.C domain and a non-BoNT/B L-chain and H.sub.N domain; [0239] iv. A BONT/B L-chain and H.sub.N domain and a non-BoNT/B H.sub.C domain [0240] v. A BONT/B L-chain and H.sub.C domain and a non-BoNT/B H.sub.N domain; or [0241] vi. A BONT/B H.sub.N domain and H.sub.C domain and a non-BoNT/B L-chain. For example, a clostridial neurotoxin of the invention (e.g. an engineered clostridial neurotoxin comprising a furin cleavage site) may comprise: [0242] i. A BoNT/C1 L-chain and a non-BoNT/C1 H.sub.N and H.sub.C domain; [0243] ii. A BONT/C1 H.sub.N domain and a non-BoNT/C1 L-chain and H.sub.C domain [0244] iii. A BONT/C1 H.sub.C domain and a non-BoNT/C1 L-chain and H.sub.N domain; [0245] iv. A BONT/C1 L-chain and H.sub.N domain and a non-BoNT/C1 H.sub.C domain [0246] v. A BONT/C1 L-chain and H.sub.C domain and a non-BoNT/C1 H.sub.N domain; or [0247] vi. A BONT/C1 H.sub.N domain and H.sub.C domain and a non-BoNT/C1 L-chain.
[0248] Non-limiting examples include BoNT/C1 chimeras where the non-BoNT/C1 element is from a BoNT/D (i.e. BoNT/CD chimeras).
[0249] For example, a clostridial neurotoxin of the invention (e.g. an engineered clostridial neurotoxin comprising a furin cleavage site) may comprise: [0250] i. A BONT/D L-chain and a non-BoNT/D H.sub.N and H.sub.C domain; [0251] ii. A BONT/D H.sub.N domain and a non-BoNT/D L-chain and H.sub.C domain [0252] iii. A BONT/D H.sub.C domain and a non-BoNT/D L-chain and H.sub.N domain; [0253] iv. A BONT/D L-chain and H.sub.N domain and a non-BoNT/D H.sub.C domain [0254] v. A BONT/D L-chain and H.sub.C domain and a non-BoNT/D H.sub.N domain; or [0255] vi. A BONT/D H.sub.N domain and H.sub.C domain and a non-BoNT/D L-chain.
[0256] Non-limiting examples include BoNT/D chimeras where the non-BoNT/D element is from BoNT/C1 (i.e. BoNT/DC1 chimeras).
[0257] For example, a clostridial neurotoxin of the invention (e.g. an engineered clostridial neurotoxin comprising a furin cleavage site) may comprise: [0258] i. A BONT/E L-chain and a non-BoNT/E H.sub.N and H.sub.C domain; [0259] ii. A BONT/E H.sub.N domain and a non-BoNT/E L-chain and H.sub.C domain [0260] iii. A BONT/E H.sub.C domain and a non-BoNT/E L-chain and H.sub.N domain; [0261] iv. A BONT/E L-chain and H.sub.N domain and a non-BoNT/E H.sub.C domain [0262] v. A BONT/E L-chain and H.sub.C domain and a non-BoNT/E H.sub.N domain; or [0263] vi. A BONT/E H.sub.N domain and H.sub.C domain and a non-BoNT/E L-chain.
[0264] For example, a clostridial neurotoxin of the invention (e.g. an engineered clostridial [0265] i. A BONT/F L-chain and a non-BoNT/F H.sub.N and H.sub.C domain; [0266] ii. A BONT/F H.sub.N domain and a non-BoNT/F L-chain and H.sub.C domain [0267] iii. A BoNT/F H.sub.C domain and a non-BoNT/F L-chain and H.sub.N domain; [0268] iv. A BONT/F L-chain and H.sub.N domain and a non-BoNT/F H.sub.C domain [0269] v. A BONT/F L-chain and H.sub.C domain and a non-BoNT/F H.sub.N domain; or [0270] vi. A BONT/F H.sub.N domain and H.sub.C domain and a non-BoNT/F L-chain.
[0271] For example, a clostridial neurotoxin of the invention (e.g. an engineered clostridial neurotoxin comprising a furin cleavage site) may comprise: [0272] i. A BONT/G L-chain and a non-BoNT/G H.sub.N and H.sub.C domain; [0273] ii. A BONT/G H.sub.N domain and a non-BoNT/G L-chain and H.sub.C domain [0274] iii. A BoNT/G H.sub.C domain and a non-BoNT/G L-chain and H.sub.N domain; [0275] iv. A BONT/G L-chain and H.sub.N domain and a non-BoNT/G H.sub.C domain [0276] v. A BoNT/G L-chain and H.sub.C domain and a non-BoNT/G H.sub.N domain; or [0277] vi. A BONT/G H.sub.N domain and H.sub.C domain and a non-BoNT/G L-chain.
[0278] For example, a clostridial neurotoxin of the invention (e.g. an engineered clostridial neurotoxin comprising a furin cleavage site) may comprise: [0279] i. A BONT/X L-chain and a non-BoNT/X H.sub.N and H.sub.C domain; [0280] ii. A BONT/X H.sub.N domain and a non-BoNT/X L-chain and H.sub.C domain [0281] iii. A BONT/X H.sub.C domain and a non-BoNT/X L-chain and H.sub.N domain; [0282] iv. A BONT/X L-chain and H.sub.N domain and a non-BoNT/X H.sub.C domain [0283] v. A BONT/X L-chain and H.sub.C domain and a non-BoNT/X H.sub.N domain; or [0284] vi. A BONT/X H.sub.N domain and H.sub.C domain and a non-BoNT/X L-chain.
[0285] For example, a clostridial neurotoxin of the invention (e.g. an engineered clostridial neurotoxin comprising a furin cleavage site) may comprise: [0286] i. A TeNT L-chain and a non-TeNT H.sub.N and H.sub.C domain; [0287] ii. A TeNT H.sub.N domain and a non-TeNT L-chain and H.sub.C domain [0288] iii. A TeNT H.sub.C domain and a non-TeNT L-chain and H.sub.N domain; [0289] iv. A TeNT L-chain and H.sub.N domain and a non-TeNT H.sub.C domain [0290] v. A TeNT L-chain and H.sub.C domain and a non-TeNT H.sub.N domain; or [0291] vi. A TeNT H.sub.N domain and H.sub.C domain and a non-TeNT L-chain.
[0292] The term clostridial neurotoxin may also embrace newly discovered botulinum neurotoxin and botulinum neurotoxin-like protein family members expressed by non-clostridial microorganisms, such as the Enterococcus encoded toxin which has closest sequence identity to BoNT/X, the Weissella oryzae encoded toxin called BoNT/Wo (NCBI Ref Seq: WP_027699549.1), which cleaves VAMP2 at W89-W90, the Enterococcus faecium encoded toxin (GenBank: OTO22244.1), which cleaves VAMP2 and SNAP25, the Chryseobacterium pipero encoded toxin (NCBI Ref. Seq: WP_034687872.1) and the mosquito BoNT-like protein PMP1 (NCBI Ref. Seq: QEZ70852.1).
[0293] The term clostridial neurotoxin is intended to embrace re-targeted clostridial neurotoxins. In a re-targeted clostridial neurotoxin, the clostridial neurotoxin is modified to include an exogenous ligand (i.e. not derived from a clostridial neurotoxin) known as a Targeting Moiety (TM). The TM is selected to provide binding specificity for a desired target cell, and as part of the re-targeting process the native binding portion of the clostridial neurotoxin (e.g. the H.sub.C domain, or the H.sub.CC domain) may be removed. Re-targeting technology is described, for example, in: EP-B-0689459; WO 1994/021300; EP-B-0939818; U.S. Pat. Nos. 6,461,617; 7,192,596; WO 1998/007864; EP-B-0826051; U.S. Pat. Nos. 5,989,545; 6,395,513; 6,962,703; WO 1996/033273; EP-B-0996468; U.S. Pat. No. 7,052,702; WO 1999/017806; EP-B-1107794; U.S. Pat. No. 6,632,440; WO 2000/010598; WO 2001/21213; WO 2006/059093; WO 2000/62814; WO 2000/04926; WO 1993/15766; WO 2000/61192; and WO 1999/58571; all of which are hereby incorporated by reference in their entirety. Thus, a clostridial neurotoxin of the invention may be a re-targeted clostridial neurotoxin. In particular, an engineered clostridial neurotoxin of the invention may be an engineered re-targeted clostridial neurotoxin. The engineered re-targeted clostridial neurotoxins of the invention may comprise TM that are presented at the N- or C-terminus of the single-chain neurotoxin, or the TM may be presented centrally within the single-chain neurotoxin. In some preferred embodiments, the engineered re-targeted clostridial neurotoxins of the invention may comprise TM that are presented at the N- or C-terminus of the single-chain neurotoxin.
[0294] Engineering re-targeted clostridial neurotoxins may allow for the use of TM that are susceptible to cleavage by proteases conventionally used to activate recombinantly produced re-targeted clostridial neurotoxins, such as trypsin, Lys-C and/or BoNT hydrolase. Thus, engineering re-targeted clostridial neurotoxins to include a furin activation site according to the invention may allow for improvements in stability compared to a corresponding re-targeted clostridial neurotoxins which is activated by a conventional activating protease such as Lys-C, trypsin and/or BoNT hydrolase.
[0295] The clostridial neurotoxin of the present invention (e.g. an engineered clostridial neurotoxin) may lack a functional H.sub.C domain of a clostridial neurotoxin and also lack any functionally equivalent TM. Accordingly, said polypeptides lack the natural binding function of a clostridial neurotoxin and are not able to bind rat synaptosomal membranes (via a clostridial H.sub.C component, or via any functionally equivalent TM) in binding assays as described in Shone et al. (1985) Eur. J. Biochem. 151, 75-82. Preferably the TM is not a Wheat Germ Agglutinin (WGA) peptide. Thus, in some preferred embodiments the clostridial neurotoxin is a re-targeted clostridial neurotoxin in which an endogenous H.sub.C or H.sub.CC of a clostridial neurotoxin is replaced by an exogenous TM. Particularly preferred are embodiments in which the engineered clostridial neurotoxin is a re-targeted clostridial neurotoxin in which an endogenous H.sub.C or H.sub.CC of a clostridial neurotoxin is replaced by an exogenous TM.
[0296] A clostridial neurotoxin of the invention (e.g. an engineered clostridial neurotoxin) may comprise an LH.sub.N polypeptide (e.g. an engineered LH.sub.N polypeptide), i.e. a polypeptide comprising or consisting of a clostridial L-chain and a clostridial H.sub.N domain, as defined herein.
[0297] A clostridial neurotoxin (e.g. an engineered clostridial neurotoxin) may comprise an LH.sub.N polypeptide (e.g. an engineered LH.sub.N polypeptide) and a targeting moiety (TM).
[0298] The present invention also embraces clostridial neurotoxins that have an additional non-native protease cleavage site. Such a site will require an exogenous protease for cleavage, which allows for improved control over the timing and location of cleavage events. Non-native protease cleavage sites that may be employed in clostridial neurotoxins include:
TABLE-US-00003 TEV(TobaccoEtchvirus) (SEQIDNO:65) (ENLYFQ?G) Thrombin (SEQIDNO:66) (LVPR?GS) PreScission (SEQIDNO:67) (LEVLFQ?GP).
[0299] Additional protease cleavage sites include recognition sequences that are cleaved by a non-cytotoxic protease, for example by the light chain of a clostridial neurotoxin. These include the SNARE (e.g. SNAP-25, syntaxin, VAMP) protein recognition sequences that are cleaved by non-cytotoxic proteases such as the light chain of a clostridial neurotoxin. Clostridial neurotoxins comprising non-native protease cleavage sites are described in U.S. Pat. No. 7,132,259, EP 1206554-B2 and US 2007/0166332, all of which are hereby incorporated by reference in their entirety. Also embraced by the term protease cleavage site is an intein, which is a self-cleaving sequence. The self-splicing reaction is controllable, for example by varying the concentration of reducing agent present.
[0300] The present invention also embraces clostridial neurotoxins comprising a destructive cleavage site. In said clostridial neurotoxins, a non-native protease cleavage site is incorporated into the clostridial neurotoxin, at a location chosen such that cleavage at said site will decrease the activity of, or inactivate, the clostridial neurotoxin. The destructive protease cleavage site can be susceptible to cleavage by a local protease, in the event that the clostridial neurotoxin, following administration, migrates to a non-target location. Suitable non-native protease cleavage sites include those described above. Clostridial neurotoxins comprising a destructive cleavage site are described in WO 2010/094905 and WO 2002/044199, both of which are hereby incorporated by reference in their entirety.
[0301] The clostridial neurotoxins (e.g. engineered clostridial neurotoxins) of the present invention, especially the light chain component thereof, may be PEGylatedthis may help to increase stability, for example duration of action of the light chain component. PEGylation is particularly preferred when the light chain comprises a BoNT/A, B or C1 protease. PEGylation preferably includes the addition of PEG to the N-terminus of the light chain component. By way of example, the N-terminus of a light chain may be extended with one or more amino acid (e.g. cysteine) residues, which may be the same or different. One or more of said amino acid residues may have its own PEG molecule attached (e.g. covalently attached) thereto. An example of this technology is described in WO2007/104567, which is hereby incorporated by reference in its entirety.
[0302] The clostridial neurotoxins (e.g. engineered clostridial neurotoxins) of the present invention may be free from the complexing proteins that are present in a naturally occurring clostridial neurotoxin complex.
[0303] The clostridial neurotoxins (e.g. engineered clostridial neurotoxins) of the present invention can be produced using recombinant nucleic acid technologies. Thus, in an engineered clostridial neurotoxin (as described above) may be a recombinant engineered clostridial neurotoxin. A single-chain clostridial neurotoxin (as described herein) may be a recombinant single-chain neurotoxin.
[0304] Tolerance to an engineered clostridial neurotoxin of the invention may be increased compared with the tolerance to the corresponding (pre-engineering) clostridial neurotoxin. In particular, tolerance to an engineered clostridial neurotoxin of the invention may be increased compared with the tolerance to the corresponding (pre-engineering) clostridial neurotoxin when the pre-engineering clostridial neurotoxin is administered (e.g. in di-chain form).
[0305] An engineered clostridial neurotoxin of the invention may have equivalent or increased potency compared with the potency of the corresponding (pre-engineering) clostridial neurotoxin. In particular, potency of an engineered clostridial neurotoxin of the invention may be equivalent to or increased compared with the potency of the corresponding (pre-engineering) clostridial neurotoxin when the pre-engineering clostridial neurotoxin is administered in di-chain form. The term equivalent potency as used herein means that an engineered clostridial neurotoxin has a potency of at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, up to about 100% of the potency of the corresponding (pre-engineering) clostridial neurotoxin. Preferably equivalent potency as used herein means that an engineered clostridial neurotoxin has a potency of at least about 95%, at least about 99%, at least about 100%, at least about 101%, up to about 105% of the potency of the corresponding (pre-engineering) clostridial neurotoxin. The term increased potency as used herein means that an engineered clostridial neurotoxin has a potency of at least about 10%, at least about 15%, at least about 20%, at least about 25% greater potency compared with the potency of the corresponding (pre-engineering) clostridial neurotoxin. Potency may be measured using any appropriate assay, conventional examples of which are described herein.
[0306] An engineered clostridial neurotoxin of the invention typically has an improved safety profile and/or therapeutic window compared with the safety profile and/or therapeutic window of the corresponding (pre-engineering) clostridial neurotoxin. Without being bound by theory, this may be by virtue of its improved tolerance and/or equivalent or increased potency. In particular, an engineered clostridial neurotoxin of the invention may have an improved safety profile and/or therapeutic window compared with the safety profile and/or therapeutic window of the corresponding (pre-engineering) clostridial neurotoxin when the pre-engineering clostridial neurotoxin is administered (e.g. in di-chain form).
[0307] One way in which these advantageous properties (which represent an increase in the therapeutic index) may be defined is in terms of the Safety Ratio (for clinical applications) or Tolerance Index (TI, in animal models) of the engineered clostridial toxin. In this regard, undesired effects of a clostridial neurotoxin (such as those caused by diffusion of the neurotoxin away from the site of administration) can be assessed experimentally by measuring percentage bodyweight loss in a relevant animal model (e.g. a mouse, where loss of bodyweight is detected within seven days of administration). Desired on-target effects of a clostridial toxin can be assessed experimentally by any appropriate technique, depending on the target cell of interest. Suitable assays are known in the art and it would be routine for one of ordinary skill to select an appropriate assay for a given target cell type. For clostridial neurotoxins of the invention which target motor neurons, a Digital Abduction Score (DAS) assay, a measurement of muscle paralysis, may be used. The DAS assay may be performed by injection of 20 ?l of (engineered) clostridial toxin, formulated in Gelatin Phosphate Buffer, into the mouse gastrocnemius/soleus complex, followed by assessment of Digital Abduction Score using the method of Aoki (Aoki KR, Toxicon 39:1815-1820; 2001). In the DAS assay, mice are suspended briefly by the tail in order to elicit a characteristic startle response in which the mouse extends its hind limbs and abducts its hind digits. Following clostridial toxin injection, the varying degrees of digit abduction are scored on a five-point scale (0=normal to 4=maximal reduction in digit abduction and leg extension). For clostridial neurotoxins of the invention which target other subtypes of neurones, any appropriate assay known in the art may be used. SNARE cleavage assays may also be used to assess the activity of engineered clostridial neurotoxins of the invention, examples of which are well-described in the art (e.g. Western blot). Assays to detect and/or quantify the effect of an engineered clostridial neurotoxin on the release of a maker signalling molecule may also be used. The specific marker signally molecule may be selected depending on the cell type(s) targeted by the engineered clostridial neurotoxins. For example, the signalling molecule may be a hormone, substance P, CGRP, glutamate, glycine, depending on whether cells involved with hormone secretion or pain-sensing neurons are targeted. For the treatment of pain, animal studies may be used to assess if there is a greater tolerance to a noxious stimulus. Typical in vivo assays will measure different types of pain (e.g., mechanical, cold, heat) and the readout could be behavioural (e.g., licking/biting the treated site or withdrawal from the noxious stimulus) or may involve the use of the Von Frey test. Any appropriate nociception test may be used, and examples of such tests are well-known in the art.
[0308] The Safety Ratio or TI of a clostridial neurotoxin may then be expressed as the ratio between the amount of toxin required for a 10% drop in a bodyweight (measured at peak effect within the first seven days after dosing in a mouse) and the amount of toxin required for a DAS score of 2. High Safety Ratio or TI scores are therefore desired, and indicate a toxin that is able to effectively paralyse a target muscle with little undesired off-target effects. An engineered toxin of the present invention may have a Safety Ratio and/or TI that is higher than the Safety Ratio and/or TI of an equivalent unmodified (pre-engineering) single-chain clostridial neurotoxin. The calculation for TI may vary depending on the experimental model used.
[0309] For example, in a DAS mouse model, an engineered clostridial toxin of the present invention has a TI of at least 8 (for example, at least 8, 9, 10, 15, 20, 25, 30, 35, 40, 45 or 50), wherein TI is calculated as: dose of toxin required for ?10% bodyweight change (pg/mouse) divided by DAS ED.sub.50 (pg/mouse) [ED.sub.50=dose required to produce a DAS score of 2].
[0310] For clinical use a Safety Ratio may be calculated.
[0311] The invention provides a nucleic acid (for example, a DNA or RNA) comprising a nucleic acid sequence encoding a clostridial neurotoxin (e.g. an engineered clostridial neurotoxin) as described herein. The nucleic acid sequence may be prepared as part of an expression vector in which the nucleic acid is operably linked to a promoter. Preferably, the nucleic acid may be prepared as part of a DNA expression vector comprising a promoter and a terminator.
[0312] Preferably the vector has a promoter selected from:
TABLE-US-00004 Promoter Induction Agent Typical Induction Condition Tac (hybrid) IPTG 0.2 mM (0.05-2.0 mM) AraBAD L-arabinose 0.2% (0.002-0.4%) T7-lac operator IPTG 0.2 mM (0.05-2.0 mM)
[0313] Alternatively, a promoter may preferably be selected from:
TABLE-US-00005 Promoter Induction Agent Typical Induction Condition Tac (hybrid) IPTG 0.2 mM (0.05-2.0 mM) AraBAD L-arabinose 0.2% (0.002-0.4%) T7-lac operator IPTG 0.2 mM (0.05-2.0 mM) T5-lac operator IPTG 0.2 mM (0.05-2.0 mM)
[0314] The nucleic acid molecules of the invention may be made using any suitable process known in the art. Thus, the nucleic acid molecules may be made using chemical synthesis techniques. Alternatively, the nucleic acid molecules of the invention may be made using molecular biology techniques.
[0315] The nucleic acid molecules and expression vectors of the present invention may be preferably designed in silico, and then synthesised by conventional synthesis techniques, including conventional DNA synthesis techniques.
[0316] The above-mentioned nucleic acid sequence information is optionally modified for codon-biasing according to the ultimate host cell (e.g. E. coli) expression system that is to be employed.
[0317] The present invention provides a nucleotide sequence encoding an engineered clostridial neurotoxin of the present invention. The nucleotide sequence of the invention encodes a polypeptide comprising a furin cleavage site of SEQ ID NO: 1.
[0318] The nucleotide sequence may comprise a sequence having at least 70% sequence identity to SEQ ID NO: 23. The nucleotide sequence may comprise a sequence having at least 80% or 90% sequence identity to SEQ ID NO: 23. Preferably the nucleotide sequence comprises (more preferably consists of) SEQ ID NO: 23. The nucleotide sequence may encode an engineered clostridial neurotoxin having at least 70% sequence identity to one or more of SEQ ID NOs: 24 or 70 to 78. The nucleotide sequence may encode an engineered clostridial neurotoxin having at least 80% or 90% sequence identity to one or more of SEQ ID NOs: 24 or 70 to 78. Preferably the nucleotide sequence encode an engineered clostridial neurotoxin comprising (more preferably consisting of) any one of SEQ ID NOs: 24 or 70 to 78.
[0319] The terms nucleotide sequence and nucleic acid and polynucleotide are used synonymously herein. Preferably the nucleotide sequence is a DNA sequence.
[0320] The invention provides a method of producing a single-chain (engineered) clostridial neurotoxin protein having a light chain and a heavy chain, the method comprising expressing a polynucleotide or expression vector described herein in a suitable host cell, and recovering the expressed engineered clostridial neurotoxin. Recovering the expressed engineered clostridial neurotoxin may comprise lysing the host cell to provide a host cell homogenate containing the single-chain (engineered) clostridial neurotoxin protein, and/or isolating the single-chain (engineered) clostridial neurotoxin protein. Said method may further comprise a step of introducing the polynucleotide or expression vector described herein into the host cell. Suitable host cells include bacterial cell lines used for the recombinant production of clostridial neurotoxins, particularly Escherichia coli cells.
[0321] The present invention provides a method for proteolytically processing an (engineered) clostridial neurotoxin of the present invention into a corresponding di-chain clostridial neurotoxin, the method comprising contacting the (engineered) clostridial neurotoxin with furin thereby producing a di-chain clostridial neurotoxin (e.g. wherein the light chain and heavy chain are joined together by a disulphide bond).
[0322] The present invention therefore provides a di-chain clostridial neurotoxin obtainable by a method of the invention.
[0323] The term obtainable as used herein also encompasses the term obtained. Preferably the term obtainable means obtained.
Activation of an Engineered Clostridial Neurotoxin
[0324] The invention provides a method for proteolytically processing an engineered clostridial neurotoxin of the invention into a corresponding di-chain clostridial neurotoxin, the method comprising contacting the engineered clostridial neurotoxin with furin, thereby producing a di-chain clostridial neurotoxin. Said contacting may be in vitro, ex vivo, or in vivo, preferably in vivo. As such, the therapeutic methods and uses of the invention may comprise the in vivo activation of an engineered clostridial neurotoxin of the invention by cleavage at the furin activation site by furin expression on or by target cells.
[0325] Thus, a method of the invention may further comprise contacting an engineered clostridial neurotoxin with furin thereby producing a corresponding di-chain engineered clostridial neurotoxin. Preferably said contacting occurs in vivo.
[0326] The invention also provides a method for proteolytically processing a single-chain clostridial neurotoxin into a corresponding di-chain clostridial neurotoxin, the method comprising: (a) providing a single-chain clostridial neurotoxin; and (b) contacting the single-chain clostridial neurotoxin with furin; wherein the single-chain clostridial neurotoxin has an activation loop comprising or consisting of a furin cleavage site as described herein (e.g. SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 or SEQ ID NO: 5); and wherein furin hydrolyses a peptide bond of the activation loop thereby producing a di-chain clostridial neurotoxin. Preferably said contacting occurs in vivo.
[0327] The present invention encompasses contacting a single-chain clostridial neurotoxin (e.g. an engineered clostridial neurotoxin of the invention) with furin, wherein furin is capable of hydrolysing a peptide bond in an activation loop of the single-chain clostridial neurotoxin thereby producing a di-chain clostridial neurotoxin. Preferably said contacting occurs in vivo.
[0328] Furin is a proprotein convertase with specificity for a range of motifs, cleaving near paired arginine residues that are separated by two amino acids. The term furin encompasses furin described herein, as well as any protease having structural and/or functional similarity (preferably structural and functional similarity) that is capable of hydrolysing a peptide bond of SEQ ID NO: 1. A suitable furin is human furin, which has UniProt Accession No. P09958 (version 2 of the sequence, deposited 1 Apr. 1990). Human furin commercially available from Merck (#F2677 and #SRP6274). For in vitro and ex vivo uses, it is within the routine practice of one of ordinary skill in the art to determine the appropriate concentration/unit amount of furin to activate an engineered clostridial neurotoxin of the invention under standard/desired conditions.
[0329] In the context of the invention, the term furin encompasses a polypeptide sequence having at least 70% sequence identity to SEQ ID NO: 59. Thus, furin may comprise a polypeptide sequence having at least 80% or 90% sequence identity to SEQ ID NO: 59. Preferably a furin comprises (more preferably consists of) SEQ ID NO: 59.
[0330] The contacting can occur under any suitable conditions that result in the production of greater than 30%, 40%, 50% or 60% (preferably greater than 70%) of single-chain clostridial neurotoxin being proteolytically processed into the corresponding di-chain clostridial neurotoxin without, or without substantial, hydrolysis of a peptide bond outside of the activation loop of said clostridial neurotoxin. Without substantial hydrolysis may mean less than 5%, 4%, 3%, 2% or 1% of the clostridial neurotoxins contacted contain a peptide bond outside of the activation loop that has been hydrolysed by furin in a method of the invention.
[0331] The skilled person can select appropriate reaction times, temperatures, buffers, and molar ratios of protease to single-chain clostridial neurotoxin to achieve the above. Optimisation of such conditions can be determined empirically using routine techniques, such as SDS-PAGE (e.g. stained with Coomassie or a dye of similar sensitivity) visual analysis of the reaction products following said contacting or spectrometric techniques (e.g. mass spectrometry).
[0332] When assessed by SDS-PAGE (e.g. stained with Coomassie or a dye of similar sensitivity), a method of the invention preferably results in the production of a clostridial neurotoxin L-chain and H-chain only.
[0333] The proteolytic processing by furin in a method of the invention typically results in the production of less than 5 degradation products of a clostridial neurotoxin L-chain or H-chain, more preferably less than 4, 3, 2 or 1 degradation products. Preferably, the L-chain and H-chain produced by a method of the invention are full-length L-chain and H-chain.
[0334] Preferably, processing by furin in a method of the invention hydrolyses only the peptide bond immediately C-terminal to the C-terminal Arg of SEQ ID NO: 1.
[0335] For in vitro furin-mediated activation of engineered clostridial neurotoxins of the invention, any appropriate conditions for activation may be used. It is within the routine practice of one of ordinary skill in the art to determine suitable conditions. By way of non-limiting example, 15 Units of furin may be used per 1 mg of engineered clostridial neurotoxin, with activation carried out overnight at a temperature of about 25? C.
[0336] Many cells endogenously express furin, in particular in the Golgi apparatus and nucleoplasm. Furin expressed by cells is typically also present on the cell surface. Therefore, the step of contacting a clostridial neurotoxin with furin according to the invention may occur at or in the vicinity of the surface of a cell treated with the clostridial neurotoxin. In other words, contacting a clostridial neurotoxin with furin according to the invention may involve furin endogenously present at the cell surface. Accordingly, contacting a clostridial neurotoxin with furin according to the invention may occur in vivo following administration of the clostridial neurotoxin to an individual. When the contacting step occurs in vivo, it typically involves furin endogenously present at the surface of one or more cells present in a tissue or organ to be treated according to the invention.
[0337] The invention also provides a di-chain clostridial neurotoxin that is obtainable by a method of the invention. As activation to the di-chain form occurs by cleavage at a furin cleavage site as described herein, the resulting C- and N-terminal cleaved ends of the di-chain clostridial neurotoxin will differ in sequence compared with the corresponding (pre-engineering) clostridial neurotoxin. By way of non-limiting example, proteolytic processing of the engineered single-chain BoNT/A1 of SEQ ID NO: 24 by furin will result in a di-chain having a LC with a C-terminus ending with the sequence KKR, and a HC with an N-terminus beginning STS. In contrast, conventional trypsin cleavage of the (pre-engineering) BoNT/A will result in a di-chain having a LC with a C-terminus ending with the sequence TSK, and a HC with an N-terminus beginning ALNDLC. These di-chain clostridial neurotoxins may be used in therapy as described herein. All disclosure herein in relation to therapeutic indications and formulations in the context of engineered or single-chain clostridial neurotoxins of the invention applies equally and without reservation to di-chain clostridial neurotoxin that is obtainable by a method of the invention unless otherwise stated.
Single-Chain Clostridial Neurotoxins
[0338] The consensus in the field of clostridial neurotoxin therapeutics is that clostridial neurotoxins must be activated to their di-chain form prior to administration to patients. Activation may be via a conventional activating protease with the necessary cleavage specificity, such as Lys-C, trypsin and/or BoNT hydrolase. In line with this established prejudice in the art, to-date, single-chain clostridial neurotoxins have not used in therapy.
[0339] The inventors have also shown that, although single-chain BoNT/A1 has lower activity in vivo than native di-chain BoNT/A1, it is still capable of eliciting a therapeutic effect (as evidence by the DAS score elicited using single-chain BoNT/A1 in the Examples herein). This is surprising, as conventional wisdom in the field is that clostridial neurotoxins need to be administered in the active di-chain form to be clinically efficacious. Based on these data, the inventors are the first to appreciate that single-chain clostridial neurotoxins, such as single-chain BoNT/A1, have therapeutic potential, without requiring activation to di-chain form prior to administration.
[0340] Accordingly, the present invention provides a clostridial neurotoxin for use in a method of preventing or treating a disease or disorder for which a therapy with a botulinum neurotoxin is indicated, wherein the clostridial neurotoxin is administered to a subject in single-chain form.
[0341] The invention also provides a pharmaceutical composition comprising a clostridial neurotoxin for use in a method of preventing or treating a disease or disorder for which a therapy with a botulinum neurotoxin is indicated, wherein the clostridial neurotoxin within the pharmaceutical composition administered to a subject is in single-chain form.
[0342] Typically the single-chain clostridial neurotoxin for use in such methods, or the pharmaceutical composition comprising said single-chain clostridial neurotoxin for use in such methods, is substantially free of a di-chain form of the clostridial neurotoxin. As used herein, the term substantially free may be defined as the clostridial neurotoxin or pharmaceutical composition comprising less than 400 pg di-chain clostridial neurotoxin per 100 ng single-chain clostridial neurotoxin, or less than 300 pg di-chain clostridial neurotoxin per 100 ng single-chain clostridial neurotoxin, or less than 200 pg di-chain clostridial neurotoxin per 100 ng single-chain clostridial neurotoxin, or less than 100 pg di-chain clostridial neurotoxin per 100 ng single-chain clostridial neurotoxin, or less than 50 pg di-chain clostridial neurotoxin per 100 ng single-chain clostridial neurotoxin. A pharmaceutical composition of the invention that is substantially free of di-chain clostridial neurotoxin may comprises less than 0.5%, less than 0.4%, less than 0.3%, less than 0.2%, less than 0.1% or less than 0.05% di-chain clostridial neurotoxin, preferably less than 0.1% di-chain clostridial neurotoxin.
[0343] As demonstrated in the Examples herein, single-chain clostridial neurotoxins are typically less potent than the di-chain form of the corresponding clostridial neurotoxin (as the di-chain is the active form). By way of non-limiting example, a clostridial neurotoxin in single-chain form may have potency of at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or more compared with the corresponding di-chain clostridial neurotoxin (particularly when single-chain and di-chain forms are administered at the same dose). By way of further non-limiting example, a clostridial neurotoxin in single-chain form may be five-fold, ten-fold or 20-fold less potent compared with the corresponding di-chain clostridial neurotoxin (particularly when single-chain and di-chain forms are administered at the same dose). By way of further non-limiting example, a clostridial neurotoxin in single-chain form may have a time to reach half-maximal paralysis that is at least 25%, at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% longer or more compared with the corresponding di-chain clostridial neurotoxin (particularly when single-chain and di-chain forms are administered at the same dose). Potency may be measured using any appropriate assay, conventional examples of which are described herein.
[0344] Regardless of any difference in potency between single-chain and di-chain forms of the same clostridial neurotoxin, the same therapeutic effect may potentially be achieved using a single-chain clostridial neurotoxin at an increased dose, relative to the therapeutic dose of the di-chain form of the same clostridial neurotoxin. The single-chain clostridial neurotoxin may be used at a dose of at least 2 times (2?), at least 3?, at least 4?, at least 5?, at least 10?, at least 15?, at least 20? the dose of the corresponding di-chain clostridial neurotoxin.
[0345] Use of a single-chain form of a clostridial neurotoxin offers several potential advantages over the use of the corresponding di-chain clostridial neurotoxin. Administration of a clostridial neurotoxin in single-chain form give rise to fewer and/or less severe side-effects compared with administration of the corresponding di-chain clostridial neurotoxin, particularly if administered at the same dose.
[0346] Another potential advantage of using single-chain clostridial neurotoxins is that GMP production of single-chain clostridial neurotoxins to produce clinically acceptable pharmaceutical/cosmetic compositions would be easier and cheaper. This is because the protease conventionally used to cleave single-chain clostridial neurotoxins into active di-chain form during the production process and prior to administration is a significant reagent cost, and removing the need for said protease would therefore reduce manufacturing costs. In addition, conventional manufacturing protocols necessarily involve one or more additional purification steps to purify di-chain clostridial neurotoxin from the activating protease. If there is no need for activation prior to administration, and hence no need to use a protease in the manufacturing process, these additional purification steps may also be omitted, further reducing cost, complexity of the manufacturing process and production time.
[0347] The invention also provides the use of a cosmetic composition comprising a single-chain clostridial neurotoxin, and a cosmetically acceptable carrier, excipient, diluent, adjuvant, propellant and/or salt, for preventing or alleviating a cosmetic indication for which the application of a botulinum neurotoxin is indicated, wherein the single-chain clostridial neurotoxin is administered to a subject in single-chain form.
[0348] The single-chain clostridial neurotoxin for use according to the invention are typically cleaved to produce active di-chain clostridial neurotoxin by endogenous protease(s) present within the subject. Typically the target cells of the subject express endogenous protease(s) which activates the single-chain clostridial neurotoxin into di-chain form. Accordingly, activation of a single-chain clostridial neurotoxin administered to a subject according to the invention typically occurs in vivo following administration of the single-chain clostridial neurotoxin to the subject. The protease(s) is typically endogenously present in one or more cells present in a tissue or organ to be treated according to the invention.
[0349] Any and all disclosure herein in relation to clostridial neurotoxins applies equally and without reservation to aspects of the invention relating to treatment of subjects with single-chain clostridial neurotoxin, unless expressly stated to the contrary. By way of non-limiting example, the invention relates to the treatment of subjects with a single-chain clostridial neurotoxin which is a single-chain form of any BoNT serotype, particularly BoNT/A, preferably BONT/A1. Exemplary BONT sequences, particularly BoNT/A and even more particularly BONT/A1 are described herein. By way of further non-limiting example, the invention relates to the treatment of subjects with a single-chain clostridial neurotoxin which is a single-chain form of a re-targeted clostridial neurotoxins, a chimeric clostridial neurotoxin, a hybrid clostridial neurotoxin or any fragment or variant thereof as described herein.
Therapy and Formulations
[0350] A clostridial neurotoxin of the present invention suitably finds utility in medicine and/or in cosmetics. In use, as the engineered clostridial neurotoxin of the invention may be cleaved in vivo by furin as described herein, the clostridial neurotoxin is preferably in a single-chain form for administration. Alternatively, the engineered clostridial neurotoxin of the invention may be for administration in di-chain form (e.g. having been obtained by a method of the invention).
[0351] The (engineered) clostridial neurotoxins of the invention may be used to prevent or treat certain medical or cosmetic diseases and conditions. Thus, in a further aspect, the present invention provides an (engineered) clostridial neurotoxin as described above, for use in medicine. In addition, as described herein, the invention relates to single-chain clostridial neurotoxins for use to prevent or treat certain medical or cosmetic diseases and conditions, wherein the single-chain clostridial neurotoxin is administered to a subject. In addition, as described herein, the invention relates to a di-chain clostridial neurotoxin that is obtainable by a method of the invention for use to prevent or treat certain medical or cosmetic diseases and conditions, wherein the di-chain clostridial neurotoxin that is obtainable by a method of the invention is administered to a subject. Thus, in a further aspect, the present invention provides an (engineered) clostridial neurotoxin as described above, for use in medicine.
[0352] Accordingly, the present invention provides a clostridial neurotoxin (e.g. an engineered clostridial neurotoxin) as described above, for use in the prevention or treatment of a disease or condition selected from: a condition associated with unwanted immune secretion, strabismus, blepharospasm, squint, dystonia (e.g. spasmodic dystonia, oromandibular dystonia, focal dystonia, tardive dystonia, laryngeal dystonia, limb dystonia, cervical dystonia), torticollis (e.g. spasmodic torticollis), beauty therapy (cosmetic) applications benefiting from cell/muscle incapacitation (via SNARE down-regulation or inactivation), neuromuscular disorder or condition of ocular motility (e.g. concomitant strabismus, vertical strabismus, lateral rectus palsy, nystagmus, dysthyroid myopathy), writer's cramp, bruxism, Wilson's disease, tremor, tics, segmental myoclonus, spasms, spasticity due to chronic multiple sclerosis, spasticity resulting in abnormal bladder control, animus, back spasm, charley horse, levator pelvic syndrome, spina bifida, tardive dyskinesia, Parkinson's disease, stuttering, hemifacial spasm, eyelid disorder, cerebral palsy, focal spasticity, spasmodic colitis, neurogenic bladder, anismus, limb spasticity, tics, tremors, bruxism, anal fissure, achalasia, dysphagia, lacrimation, hyperhydrosis, excessive salivation, excessive gastrointestinal secretions, muscle pain (e.g. pain from muscle spasms), headache pain (e.g. tension headache or migraine), phantom pain (e.g. phantom limb pain), brow furrows, skin wrinkles, cancer, uterine disorders, uro-genital disorders, urogenital-neurological disorders, bladder pain syndrome, interstitial cystitis, chronic neurogenic inflammation, and a smooth muscle disorder. In some instances, the condition may be selected from phantom pain (e.g. phantom limb pain) and bladder pain syndrome. Similarly, the invention also relates to single-chain clostridial neurotoxins and di-chain clostridial neurotoxins that are obtainable by a method of the invention for use in the treatment or prevention of the above-mentioned diseases or conditions.
[0353] Where a clostridial neurotoxin of the invention (e.g. an engineered clostridial neurotoxin) comprises a BoNT/X sequence (or portion thereof) said clostridial neurotoxin may be able to target other types of secretory cells other than neurons, due to its ability to cleave VAMP4, VAMP5 and/or Ykt6. In some embodiments, the secretory cell targeted is a secretory immune cell. A secretory immune cell as used herein, refers to immune cells that secrets cytokines, chemokines, or antibodies. Such secretory immune cells may be innate immune cells including, without limitation, natural killer cells, mast cells, eosinophils, basophils, macrophages, neutrophils, and dendritic cells. Secretory immune cells that secret antibodies (e.g. white blood cells) may also be targeted by the clostridial neurotoxins of the present disclosure. Non-limiting examples of antibody secreting cells include, without limitation, plasma B cells, plasmocytes, plasmacytes, and effector B cells. In some embodiments, the clostridial neurotoxin may modulate an immune response. Thus, further contemplated herein are therapeutic use of a clostridial neurotoxin of the invention to treat a condition associated with unwanted secretion, preferably unwanted immune secretion. Conditions associated with unwanted immune secretion include, without limitation: inflammation, psoriasis, allergy, haemophagocytic lymphohistiocytosis, and alcoholic pancreatic disease.
[0354] The invention also provides the use of a clostridial neurotoxin (e.g. an engineered clostridial neurotoxin, a single-chain clostridial neurotoxin, or a di-chain clostridial neurotoxin that is obtainable by a method of the invention) as described above, in the manufacture of a medicament for use in a method for preventing or treating a disease or disorder as described herein.
[0355] The invention also provides a method of treating a disease or disorder as described herein, said method comprising administering a therapeutically effective amount of an clostridial neurotoxin (e.g. an engineered clostridial neurotoxin, a single-chain clostridial neurotoxin, or a di-chain clostridial neurotoxin that is obtainable by a method of the invention) as described above to a subject in need thereof.
[0356] The invention provides a pharmaceutical composition comprising an (engineered) clostridial neurotoxin or a di-chain clostridial neurotoxin of the invention and a pharmaceutically acceptable carrier, excipient, adjuvant, propellant and/or salt. Preferably the (engineered) clostridial neurotoxin is in single-chain form (e.g. engineered to comprise a furin cleavage site).
[0357] The invention also provides a cosmetic composition comprising an (engineered) clostridial neurotoxin of the invention or a di-chain clostridial neurotoxins of the invention and a cosmetically acceptable carrier, excipient, diluent, adjuvant, propellant and/or salt. The invention also provides the use of a cosmetic composition comprising a clostridial neurotoxin (e.g. an engineered clostridial neurotoxin, a single-chain clostridial neurotoxin, or a di-chain clostridial neurotoxin that is obtainable by a method of the invention) for preventing or alleviating a cosmetic indication for which the application of a botulinum neurotoxin is indicated. The invention also provides the use of a cosmetic composition comprising a clostridial neurotoxin (e.g. an engineered clostridial neurotoxin, a single-chain clostridial neurotoxin, or a di-chain clostridial neurotoxin that is obtainable by a method of the invention) for preventing or alleviating a cosmetic indication for which the application of a botulinum neurotoxin is indicated. Preferably the (engineered) clostridial neurotoxin is in single-chain form (e.g. engineered to comprise a furin cleavage site).
[0358] The clostridial neurotoxins of the present invention (e.g. an engineered clostridial neurotoxin) may be formulated for oral, parenteral, continuous infusion, inhalation or topical application. Compositions suitable for injection may be in the form of solutions, suspensions or emulsions, or dry powders which are dissolved or suspended in a suitable vehicle prior to use.
[0359] In the case of a clostridial neurotoxin (e.g. an engineered clostridial neurotoxin) that is to be delivered locally, the clostridial neurotoxin (e.g. an engineered clostridial neurotoxin) may be formulated as a cream (e.g. for topical application), or for sub-dermal injection.
[0360] Local delivery means may include an aerosol, or other spray (e.g. a nebuliser). In this regard, an aerosol formulation of a clostridial neurotoxin (e.g. an engineered clostridial neurotoxin) enables delivery to the lungs and/or other nasal and/or bronchial or airway passages.
[0361] Clostridial neurotoxins of the invention (e.g. an engineered clostridial neurotoxin) may be administered to a patient by intrathecal or epidural injection in the spinal column at the level of the spinal segment involved in the innervation of an affected organ.
[0362] A preferred route of administration is via laproscopic and/or localised, particularly intramuscular, injection.
[0363] The dosage ranges for administration of the (engineered) clostridial neurotoxins of the present invention are those to produce the desired therapeutic effect. It will be appreciated that the dosage range required depends on the precise nature of the (engineered) clostridial neurotoxin or composition, the route of administration, the nature of the formulation, the age of the patient, the nature, extent or severity of the patient's condition, contraindications, if any, and the judgement of the attending physician. Variations in these dosage levels can be adjusted using standard empirical routines for optimisation.
[0364] Suitable daily dosages (per kg weight of patient) are in the range 0.0001-1 ng/kg, preferably 0.0001-0.5 ng/kg, more preferably 0.002-0.5 ng/kg, and particularly preferably 0.004-0.5 ng/kg. The unit dosage can vary from less than 1 picogram to 30 ng, but typically will be in the region of 0.01 to 1 ng per dose, which may be administered daily or preferably less frequently, such as weekly, monthly or every six months.
[0365] A particularly preferred dosing regimen is based on 0.05 ng of (engineered) clostridial neurotoxin as the 1X dose. In this regard, preferred dosages are in the range 1X-100X (i.e. 0.05-5 ng).
[0366] Fluid dosage forms are typically prepared utilising the clostridial neurotoxin (e.g. an engineered clostridial neurotoxin) and a pyrogen-free sterile vehicle. The clostridial neurotoxin (e.g. an engineered clostridial neurotoxin), depending on the vehicle and concentration used, can be either dissolved or suspended in the vehicle. In preparing solutions the clostridial neurotoxin (e.g. an engineered clostridial neurotoxin) can be dissolved in the vehicle, the solution being made isotonic if necessary by addition of sodium chloride and sterilised by filtration through a sterile filter using aseptic techniques before filling into suitable sterile vials or ampoules and sealing. Alternatively, if solution stability is adequate, the solution in its sealed containers may be sterilised by autoclaving. Advantageously additives such as buffering, solubilising, stabilising, preservative or bactericidal, suspending or emulsifying agents and or local anaesthetic agents may be dissolved in the vehicle.
[0367] Dry powders, which are dissolved or suspended in a suitable vehicle prior to use, may be prepared by filling pre-sterilised ingredients into a sterile container using aseptic technique in a sterile area. Alternatively the ingredients may be dissolved into suitable containers using aseptic technique in a sterile area. The product is then freeze dried and the containers are sealed aseptically.
[0368] Parenteral suspensions, suitable for intramuscular, subcutaneous or intradermal injection, are prepared in substantially the same manner, except that the sterile components are suspended in the sterile vehicle, instead of being dissolved and sterilisation cannot be accomplished by filtration. The components may be isolated in a sterile state or alternatively it may be sterilised after isolation, e.g. by gamma irradiation.
[0369] Advantageously, a suspending agent for example polyvinylpyrrolidone is included in the composition(s) to facilitate uniform distribution of the components.
[0370] Administration in accordance with the present invention may take advantage of a variety of delivery technologies including microparticle encapsulation, viral delivery systems or high-pressure aerosol impingement.
[0371] Disclosure related to the various methods of the invention are intended to be applied equally to other methods, the clostridial neurotoxins, e.g. engineered clostridial neurotoxins (whether in single-chain or di-chain forms), uses or pharmaceutical compositions, as well as medical uses of single-chain clostridial neurotoxins and vice versa.
Sequence Homology
[0372] Any of a variety of sequence alignment methods can be used to determine percent identity, including, without limitation, global methods, local methods and hybrid methods, such as, e.g., segment approach methods. Protocols to determine percent identity are routine procedures within the scope of one skilled in the art. Global methods align sequences from the beginning to the end of the molecule and determine the best alignment by adding up scores of individual residue pairs and by imposing gap penalties. Non-limiting methods include, e.g., CLUSTAL W, see, e.g., Julie D. Thompson et al., CLUSTAL W: Improving the Sensitivity of Progressive Multiple Sequence Alignment Through Sequence Weighting, Position-Specific Gap Penalties and Weight Matrix Choice, 22(22) Nucleic Acids Research 4673-4680 (1994); and iterative refinement, see, e.g., Osamu Gotoh, Significant Improvement in Accuracy of Multiple Protein. Sequence Alignments by Iterative Refinement as Assessed by Reference to Structural Alignments, 264(4) J. Mol. Biol. 823-838 (1996). Local methods align sequences by identifying one or more conserved motifs shared by all of the input sequences. Non-limiting methods include, e.g., Match-box, see, e.g., Eric Depiereux and Ernest Feytmans, Match-Box: A Fundamentally New Algorithm for the Simultaneous Alignment of Several Protein Sequences, 8(5) CABIOS 501-509 (1992); Gibbs sampling, see, e.g., C. E. Lawrence et al., Detecting Subtle Sequence Signals: A Gibbs Sampling Strategy for Multiple Alignment, 262(5131) Science 208-214 (1993); Align-M, see, e.g., Ivo Van Walle et al., Align-MA New Algorithm for Multiple Alignment of Highly Divergent Sequences, 20(9) Bioinformatics: 1428-1435 (2004).
[0373] Thus, percent sequence identity is determined by conventional methods. See, for example, Altschul et al., Bull. Math. Bio. 48:603-16, 1986 and Henikoff and Henikoff, Proc. Natl. Acad. Sci. USA 89:10915-19, 1992. Briefly, two amino acid sequences are aligned to optimize the alignment scores using a gap opening penalty of 10, a gap extension penalty of 1, and the blosum 62 scoring matrix of Henikoff and Henikoff (ibid.) as shown below (amino acids are indicated by the standard one-letter codes).
[0374] The percent sequence identity between two or more nucleic acid or amino acid sequences is a function of the number of identical positions shared by the sequences. Thus, % identity may be calculated as the number of identical nucleotides/amino acids divided by the total number of nucleotides/amino acids, multiplied by 100. Calculations of % sequence identity may also take into account the number of gaps, and the length of each gap that needs to be introduced to optimize alignment of two or more sequences. Sequence comparisons and the determination of percent identity between two or more sequences can be carried out using specific mathematical algorithms, such as BLAST, which will be familiar to a skilled person.
TABLE-US-00006 ALIGNMENT SCORES FOR DETERMINING SEQUENCE IDENTITY A R N D C Q E G H I L K M F P S T W Y V A 4 R ?1 5 N ?2 0 6 D ?2 ?2 1 6 C 0 ?3 ?3 ?3 9 Q ?1 1 0 0 ?3 5 E ?1 0 0 2 ?4 2 5 G 0 ?2 0 ?1 ?3 ?2 ?2 6 H ?2 0 1 ?1 ?3 0 0 ?2 8 I ?1 ?3 ?3 ?3 ?1 ?3 ?3 ?4 ?3 4 L ?1 ?2 ?3 ?4 ?1 ?2 ?3 ?4 ?3 2 4 K ?1 2 0 ?1 ?3 1 1 ?2 ?1 ?3 ?2 5 M ?1 ?1 ?2 ?3 ?1 0 ?2 ?3 ?2 1 2 ?1 5 F ?2 ?3 ?3 ?3 ?2 ?3 ?3 ?3 ?1 0 0 ?3 0 6 P ?1 ?2 ?2 ?1 ?3 ?1 ?1 ?2 ?2 ?3 ?3 ?1 ?2 ?4 7 S 1 ?1 1 0 ?1 0 0 0 ?1 ?2 ?2 0 ?1 ?2 ?1 4 T 0 ?1 0 ?1 ?1 ?1 ?1 ?2 ?2 ?1 ?1 ?1 ?1 ?2 ?1 1 5 W ?3 ?3 ?4 ?4 ?2 ?2 ?3 ?2 ?2 ?3 ?2 ?3 ?1 1 ?4 ?3 ?2 11 Y ?2 ?2 ?2 ?3 ?2 ?1 ?2 ?3 2 ?1 ?1 ?2 ?1 3 ?3 ?2 ?2 2 7 V 0 ?3 ?3 ?3 ?1 ?2 ?2 ?3 ?3 3 1 ?2 1 ?1 ?2 ?2 0 ?3 ?1 4
[0375] The percent identity is then calculated as:
[0376] Substantially homologous polypeptides are characterized as having one or more amino acid substitutions, deletions or additions. These changes are preferably of a minor nature, that is conservative amino acid substitutions (see below) and other substitutions that do not significantly affect the folding or activity of the polypeptide; small deletions, typically of one to about 30 amino acids; and small amino- or carboxyl-terminal extensions, such as an amino-terminal methionine residue, a small linker peptide of up to about 20-25 residues, or an affinity tag.
Conservative Amino Acid Substitutions
[0377]
TABLE-US-00007 Basic: arginine lysine histidine Acidic: glutamic acid aspartic acid Polar: glutamine asparagine Hydrophobic: leucine isoleucine valine Aromatic: phenylalanine tryptophan tyrosine Small: glycine alanine serine threonine methionine
[0378] In addition to the 20 standard amino acids, non-standard amino acids (such as 4-hydroxyproline, 6-N-methyl lysine, 2-aminoisobutyric acid, isovaline and ?-methyl serine) may be substituted for amino acid residues of the polypeptides of the present invention. A limited number of non-conservative amino acids, amino acids that are not encoded by the genetic code, and unnatural amino acids may be substituted for polypeptide amino acid residues. The polypeptides of the present invention can also comprise non-naturally occurring amino acid residues.
[0379] Non-naturally occurring amino acids include, without limitation, trans-3-methylproline, 2,4-methano-proline, cis-4-hydroxyproline, trans-4-hydroxy-proline, N-methylglycine, allo-threonine, methyl-threonine, hydroxy-ethylcysteine, hydroxyethylhomo-cysteine, nitro-glutamine, homoglutamine, pipecolic acid, tert-leucine, norvaline, 2-azaphenylalanine, 3-azaphenyl-alanine, 4-azaphenyl-alanine, and 4-fluorophenylalanine. Several methods are known in the art for incorporating non-naturally occurring amino acid residues into proteins. For example, an in vitro system can be employed wherein nonsense mutations are suppressed using chemically aminoacylated suppressor tRNAs. Methods for synthesizing amino acids and aminoacylating tRNA are known in the art. Transcription and translation of plasmids containing nonsense mutations is carried out in a cell free system comprising an E. coli S30 extract and commercially available enzymes and other reagents. Proteins are purified by chromatography. See, for example, Robertson et al., J. Am. Chem. Soc. 113:2722, 1991; Ellman et al., Methods Enzymol. 202:301, 1991; Chung et al., Science 259:806-9, 1993; and Chung et al., Proc. Natl. Acad. Sci. USA 90:10145-9, 1993). In a second method, translation is carried out in Xenopus oocytes by microinjection of mutated mRNA and chemically aminoacylated suppressor tRNAs (Turcatti et al., J. Biol. Chem. 271:19991-8, 1996). Within a third method, E. coli cells are cultured in the absence of a natural amino acid that is to be replaced (e.g., phenylalanine) and in the presence of the desired non-naturally occurring amino acid(s) (e.g., 2-azaphenylalanine, 3-azaphenylalanine, 4-azaphenylalanine, or 4-fluorophenylalanine). The non-naturally occurring amino acid is incorporated into the polypeptide in place of its natural counterpart. See, Koide et al., Biochem. 33:7470-6, 1994. Naturally occurring amino acid residues can be converted to non-naturally occurring species by in vitro chemical modification. Chemical modification can be combined with site-directed mutagenesis to further expand the range of substitutions (Wynn and Richards, Protein Sci. 2:395-403, 1993).
[0380] A limited number of non-conservative amino acids, amino acids that are not encoded by the genetic code, non-naturally occurring amino acids, and unnatural amino acids may be substituted for amino acid residues of polypeptides of the present invention.
[0381] Essential amino acids in the polypeptides of the present invention can be identified according to procedures known in the art, such as site-directed mutagenesis or alanine-scanning mutagenesis (Cunningham and Wells, Science 244:1081-5, 1989). Sites of biological interaction can also be determined by physical analysis of structure, as determined by such techniques as nuclear magnetic resonance, crystallography, electron diffraction or photoaffinity labeling, in conjunction with mutation of putative contact site amino acids. See, for example, de Vos et al., Science 255:306-12, 1992; Smith et al., J. Mol. Biol. 224:899-904, 1992; Wlodaver et al., FEBS Lett. 309:59-64, 1992. The identities of essential amino acids can also be inferred from analysis of homologies with related components (e.g. the translocation or protease components) of the polypeptides of the present invention.
[0382] Multiple amino acid substitutions can be made and tested using known methods of mutagenesis and screening, such as those disclosed by Reidhaar-Olson and Sauer (Science 241:53-7, 1988) or Bowie and Sauer (Proc. Natl. Acad. Sci. USA 86:2152-6, 1989). Briefly, these authors disclose methods for simultaneously randomizing two or more positions in a polypeptide, selecting for functional polypeptide, and then sequencing the mutagenized polypeptides to determine the spectrum of allowable substitutions at each position. Other methods that can be used include phage display (e.g., Lowman et al., Biochem. 30:10832-7, 1991; Ladner et al., U.S. Patent No. 5,223,409; Huse, WIPO Publication WO 92/06204) and region-directed mutagenesis (Derbyshire et al., Gene 46:145, 1986; Ner et al., DNA 7:127, 1988).
Sequence Information
[0383] Where an initial Met amino acid residue or a corresponding initial codon is indicated in any of the following SEQ ID NOs, said residue/codon is optional.
TABLE-US-00008 SEQIDNO:1(furincleavagesiteconsensussequence) Arg-Xaa-Yaa-Arg SEQIDNO:2(furincleavagesiteconsensussequence) Arg-Xaa-Lys-Arg SEQIDNO:3(furincleavagesiteconsensussequence) Arg-Xaa-Arg-Arg SEQIDNO:4(furincleavagesite) Arg-Lys-Lys-Arg SEQIDNO:5(furincleavagesite) KQKSSNSRKKR SEQIDNO:6(furincleavagesite) SRKKRS SEQIDNO:7(furincleavagesite) SRKRRS SEQIDNO:8(furincleavagesite) SKRKKRS SEQIDNO:9(furincleavagesite) SKRKRRS SEQIDNO:10(furincleavagesite) TSSKSRRRKKRSTS SEQIDNO:11(furincleavagesite) AGLITGGRRTRRSI SEQIDNO:12(furincleavagesite) KVADSLSTRKQKR SEQIDNO:13(furincleavagesite) LATGLRNTSQRSRRRKKRGL SEQIDNO:14(exogenousactivationloopbasedonBoNT/A1activationloopwithfurin cleavagesite) CVRGIITSKTKSLSRKKRSALNDLC SEQIDNO:15(exogenousactivationloopbasedonBoNT/A1activationloopwithfurin cleavagesite) CVRGIITSKTKSLSRKRRSALNDLC SEQIDNO:16(exogenousactivationloopbasedonBoNT/A1activationloopwithfurin cleavagesite) CVRGIITSKTKSSKRKKRSALNDLC SEQIDNO:17(exogenousactivationloopbasedonBoNT/A1activationloopwithfurin cleavagesite) CVRGIITSKTKSSKRKRRSALNDLC SEQIDNO:18(exogenousactivationloopbasedonBoNT/A1activationloopwithfurin cleavagesite) CVRGITSSKSRRRKKRSTSALNDLC SEQIDNO:19(exogenousactivationloopbasedonBoNT/A1activationloopwithfurin cleavagesite) CVRGIAGLITGGRRTRRSIALNDLC SEQIDNO:20(exogenousactivationloopbasedonBoNT/A1activationloopwithfurin cleavagesite) CVRGIIKVADSLSTRKQKRALNDLC SEQIDNO:21(exogenousactivationloopbasedonBoNT/A1activationloopwithfurin cleavagesite) CVRGILATGLRNTSQRSRRRKKRGLALNDLC SEQIDNO:22(exogenousactivationloopbasedonBoNT/A1activationloopwithfurin cleavagesite) CVRGIKQKSSNSRKKRSTSALNDLC SEQIDNO:23(nucleicacidsequenceofBoNT/A1withafurincleavagesite) ATGCCGTTTGTGAACAAACAGTTCAACTATAAAGATCCGGTGAACGGTGTTGATATCGC CTATATCAAAATTCCGAATGCAGGTCAGATGCAGCCGGTTAAAGCCTTTAAAATCCATAA CAAAATTTGGGTGATTCCGGAACGTGATACCTTTACCAATCCGGAAGAAGGTGATCTGA ATCCGCCTCCGGAAGCAAAACAGGTTCCGGTTAGCTATTATGATAGCACCTATCTGAGC ACCGATAACGAGAAAGATAACTATCTGAAAGGTGTGACCAAACTGTTTGAACGCATTTA TAGTACCGATCTGGGTCGTATGCTGCTGACCAGCATTGTTCGTGGTATTCCGTTTTGGG GTGGTAGCACCATTGATACCGAACTGAAAGTTATTGACACCAACTGCATTAATGTGATT CAGCCGGATGGTAGCTATCGTAGCGAAGAACTGAATCTGGTTATTATTGGTCCGAGCG CAGATATCATTCAGTTTGAATGTAAATCCTTTGGCCACGAAGTTCTGAATCTGACCCGTA ATGGTTATGGTAGTACCCAGTATATTCGTTTCAGTCCGGATTTTACCTTTGGCTTTGAAG AAAGCCTGGAAGTTGATACAAATCCGCTGTTAGGTGCAGGTAAATTTGCAACCGATCCG GCAGTTACCCTGGCACATGAACTGATTCATGCCGGTCATCGTCTGTATGGTATTGCAAT TAATCCGAACCGTGTGTTCAAAGTGAATACCAACGCATATTATGAAATGAGCGGTCTGG AAGTGTCATTTGAAGAACTGCGTACCTTTGGTGGTCATGATGCCAAATTTATCGATAGC CTGCAAGAAAATGAATTTCGCCTGTACTACTATAACAAATTCAAGGATATTGCGAGCACC CTGAATAAAGCCAAAAGCATTGTTGGCACCACCGCAAGCCTGCAGTATATGAAAAATGT GTTTAAAGAAAAATATCTGCTGAGCGAAGATACCAGCGGTAAATTTAGCGTTGACAAAC TGAAATTCGATAAACTGTACAAGATGCTGACCGAGATTTATACCGAAGATAACTTCGTGA AGTTTTTCAAAGTGCTGAACCGCAAAACCTACCTGAACTTTGATAAAGCCGTGTTCAAAA TCAACATCGTGCCGAAAGTGAACTATACCATCTATGATGGTTTTAACCTGCGCAATACC AATCTGGCAGCAAACTTTAATGGTCAGAACACCGAAATCAACAACATGAACTTTACCAAA CTGAAGAACTTCACCGGTCTGTTCGAATTTTACAAACTGCTGTGTGTTCGTGGCATTAAA CAAAAATCTTCGAACTCAAGAAAAAAGCGAAGTACAAGTGCCCTGAATGACCTGTGCAT TAAAGTGAATAATTGGGACCTGTTTTTTAGCCCGAGCGAAGATAACTTTACCAACGATCT GAATAAAGGCGAAGAAATTACCAGCGATACCAATATTGAAGCAGCCGAAGAAAACATTA GCCTGGATCTGATTCAGCAGTATTATCTGACCTTCAACTTTGATAACGAGCCGGAAAAT ATCAGCATTGAAAATCTGAGCAGCGATATTATTGGTCAGCTGGAACTGATGCCGAATAT TGAACGTTTTCCGAACGGCAAAAAATACGAGCTGGATAAATACACCATGTTCCATTATCT GCGTGCCCAAGAATTTGAACATGGTAAAAGCCGTATTGCCCTGACCAATTCAGTTAATG AAGCACTGCTGAACCCGAGCCGTGTTTATACCTTTTTTAGCAGCGATTACGTGAAAAAG GTGAACAAAGCAACCGAAGCAGCAATGTTTTTAGGTTGGGTTGAACAGCTGGTGTATGA TTTCACCGATGAAACCAGCGAAGTTAGCACCACCGATAAAATTGCAGATATCACCATTA TCATCCCGTATATTGGTCCGGCACTGAATATTGGCAATATGCTGTATAAAGATGATTTCG TGGGTGCCCTGATTTTTAGCGGTGCAGTTATTCTGCTGGAATTTATTCCGGAAATTGCC ATTCCGGTTCTGGGCACCTTTGCACTGGTTAGCTATATTGCAAATAAAGTTCTGACCGT GCAGACCATTGATAATGCACTGAGCAAACGTAACGAGAAATGGGATGAAGTGTACAAAT ATATCGTGACCAATTGGCTGGCCAAAGTTAATACCCAGATTGATCTGATCCGCAAAAAA ATGAAAGAAGCCCTGGAAAATCAGGCAGAAGCAACCAAAGCCATTATCAACTATCAGTA TAACCAGTACACCGAAGAAGAGAAAAACAACATCAACTTCAACATCGATGACCTGAGCA GCAAACTGAATGAAAGCATCAATAAGGCCATGATTAACATCAACAAATTTCTGAATCAGT GCAGCGTGAGCTATCTGATGAATAGCATGATTCCGTATGGTGTGAAACGCCTGGAAGA TTTTGATGCAAGCCTGAAAGATGCGCTGCTGAAATATATCTATGATAATCGTGGCACCC TGATTGGCCAGGTTGATCGTCTGAAAGATAAAGTTAACAATACCCTGAGTACCGACATT CCGTTTCAGCTGAGCAAATATGTTGATAATCAGCGTCTGCTGAGCACCTTTACCGAATA TATCAAGAACATCATCAACACCAGCATTCTGAATCTGCGCTATGAAAGCAATCATCTGAT CGATCTGAGCCGTTATGCAAGCAAAATCAACATTGGTAGCAAAGTGAACTTCGACCCGA TTGATAAAAACCAGATTCAGCTGTTTAATCTGGAAAGCAGCAAAATCGAAGTGATCCTG AAAAACGCCATTGTGTATAACAGCATGTATGAGAATTTCTCGACCAGCTTTTGGATTCGC ATTCCGAAATACTTTAATAGCATCAGCCTGAACAACGAGTACACCATTATTAACTGCATG GAAAACAATAGCGGTTGGAAAGTGAGCCTGAATTATGGTGAAATTATCTGGACCCTGCA GGATACCCAAGAAATCAAACAGCGTGTTGTGTTCAAATACAGCCAGATGATTAATATCA GCGACTATATCAACCGCTGGATCTTTGTTACCATTACCAATAATCGCCTGAATAACAGCA AGATCTATATTAACGGTCGCCTGATTGATCAGAAACCGATTAGCAATCTGGGCAATATT CATGCGAGCAACAACATTATGTTTAAACTGGATGGTTGCCGTGATACCCATCGTTATATT TGGATCAAATACTTCAACCTGTTTGATAAAGAACTGAACGAAAAAGAAATTAAAGACCTG TACGACAACCAGAGCAATTCCGGTATTCTGAAAGACTTTTGGGGAGATTATCTGCAGTA TGACAAACCGTATTATATGCTGAACCTGTATGACCCGAACAAATATGTGGATGTGAACA ATGTTGGTATCCGTGGCTATATGTATCTGAAAGGTCCGCGTGGTAGCGTTATGACCACC AACATTTATCTGAATAGCAGCCTGTATCGCGGTACGAAATTTATCATTAAAAAGTATGCC AGCGGCAACAAGGATAATATTGTGCGTAATAATGATCGCGTGTACATTAACGTTGTGGT GAAGAATAAAGAATATCGCCTGGCAACCAATGCAAGCCAGGCAGGCGTTGAAAAAATT CTGAGCGCACTGGAAATTCCGGATGTTGGTAATCTGAGCCAGGTTGTTGTTATGAAAAG CAAAAATGATCAGGGCATCACCAACAAGTGCAAAATGAATCTGCAGGACAATAACGGCA ACGATATTGGTTTTATTGGCTTCCACCAGTTCAACAATATTGCGAAACTGGTTGCAAGCA ATTGGTATAATCGTCAGATTGAACGTAGCAGTCGTACCCTGGGTTGTAGCTGGGAATTT ATCCCTGTGGATGATGGTTGGGGTGAACGTCCGCTG SEQIDNO:24(aminoacidsequenceofBoNT/A1withafurincleavagesite) MPFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLNPP PEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGGSTIDT ELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHEVLNLTRNGYGSTQYIRFSP DFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPNRVFKVNTNAYYE MSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKAKSIVGTTASLQYMK NVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKVLNRKTYLNFDKAVFKINI VPKVNYTIYDGFNLRNTNLAANFNGQNTEINNMNFTKLKNFTGLFEFYKLLCVRGIKQKSSN SRKKRSTSALNDLCIKVNNWDLFFSPSEDNFTNDLNKGEEITSDTNIEAAEENISLDLIQQYY LTFNFDNEPENISIENLSSDIIGQLELMPNIERFPNGKKYELDKYTMFHYLRAQEFEHGKSRIA LTNSVNEALLNPSRVYTFFSSDYVKKVNKATEAAMFLGWVEQLVYDFTDETSEVSTTDKIAD ITIIIPYIGPALNIGNMLYKDDFVGALIFSGAVILLEFIPEIAIPVLGTFALVSYIANKVLTVQTIDNA LSKRNEKWDEVYKYIVTNWLAKVNTQIDLIRKKMKEALENQAEATKAIINYQYNQYTEEEKN NINFNIDDLSSKLNESINKAMININKFLNQCSVSYLMNSMIPYGVKRLEDFDASLKDALLKYIY DNRGTLIGQVDRLKDKVNNTLSTDIPFQLSKYVDNQRLLSTFTEYIKNIINTSILNLRYESNHLI DLSRYASKINIGSKVNFDPIDKNQIQLFNLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYFN SISLNNEYTIINCMENNSGWKVSLNYGEIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTI TNNRLNNSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDTHRYIWIKYFNLFDKELNEKEI KDLYDNQSNSGILKDFWGDYLQYDKPYYMLNLYDPNKYVDVNNVGIRGYMYLKGPRGSVM TTNIYLNSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSA LEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFHQFNNIAKLVASNWYNR QIERSSRTLGCSWEFIPVDDGWGERPL Theexogenousfurincleavagesite(underlined)replacespartoftheendogenousBoNT/A1 activationloop(bold). SEQIDNO:25(BONT/A-UniProtP10845) MPFVNKQFNYKDPVNGVDIAYIKIPNVGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLN PPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGG STIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHEVLNLTRNGY GSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPN RVFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKA KSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKV LNRKTYLNFDKAVFKINIVPKVNYTIYDGENLRNTNLAANENGQNTEINNMNFTKLKNFT GLFEFYKLLCVRGIITSKTKSLDKGYNKALNDLCIKVNNWDLFFSPSEDNETNDLNKGEE ITSDTNIEAAEENISLDLIQQYYLTENEDNEPENISIENLSSDIIGQLELMPNIEREPNG KKYELDKYTMFHYLRAQEFEHGKSRIALTNSVNEALLNPSRVYTFFSSDYVKKVNKATEA AMFLGWVEQLVYDFTDETSEVSTTDKIADITIIIPYIGPALNIGNMLYKDDFVGALIFSG AVILLEFIPEIAIPVLGTFALVSYIANKVLTVQTIDNALSKRNEKWDEVYKYIVTNWLAK VNTQIDLIRKKMKEALENQAEATKAIINYQYNQYTEEEKNNINENIDDLSSKLNESINKA MININKFLNQCSVSYLMNSMIPYGVKRLEDFDASLKDALLKYIYDNRGTLIGQVDRLKDK VNNTLSTDIPFQLSKYVDNQRLLSTFTEYIKNIINTSILNLRYESNHLIDLSRYASKINI GSKVNFDPIDKNQIQLENLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYENSISLNN EYTIINCMENNSGWKVSLNYGEIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTIT NNRLNNSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDTHRYIWIKYENLEDKELN EKEIKDLYDNQSNSGILKDFWGDYLQYDKPYYMLNLYDPNKYVDVNNVGIRGYMYLKGPR GSVMTTNIYLNSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQA GVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFHQFNNIAK LVASNWYNRQIERSSRTLGCSWEFIPVDDGWGERPL Insomeembodiments,valine27maybesubstitutedwithalanine,asshowninSEQIDNO:68 SEQIDNO:26(BoNT/B-UniProtP10844) MPVTINNENYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERYTFGYKPEDEN KSSGIFNRDVCEYYDPDYLNTNDKKNIFLQTMIKLENRIKSKPLGEKLLEMIINGIPYLG DRRVPLEEFNTNIASVTVNKLISNPGEVERKKGIFANLIIFGPGPVLNENETIDIGIQNH FASREGFGGIMQMKFCPEYVSVENNVQENKGASIFNRRGYFSDPALILMHELIHVLHGLY GIKVDDLPIVPNEKKFFMQSTDAIQAEELYTFGGQDPSIITPSTDKSIYDKVLQNERGIV DRLNKVLVCISDPNININIYKNKFKDKYKFVEDSEGKYSIDVESFDKLYKSLMFGFTETN IAENYKIKTRASYFSDSLPPVKIKNLLDNEIYTIEEGFNISDKDMEKEYRGQNKAINKQA YEEISKEHLAVYKIQMCKSVKAPGICIDVDNEDLFFIADKNSESDDLSKNERIEYNTQSN YIENDFPINELILDTDLISKIELPSENTESLTDENVDVPVYEKQPAIKKIFTDENTIFQY LYSQTFPLDIRDISLTSSEDDALLFSNKVYSFFSMDYIKTANKVVEAGLFAGWVKQIVND FVIEANKSNTMDKIADISLIVPYIGLALNVGNETAKGNFENAFEIAGASILLEFIPELLI PVVGAFLLESYIDNKNKIIKTIDNALTKRNEKWSDMYGLIVAQWLSTVNTQFYTIKEGMY KALNYQAQALEEIIKYRYNIYSEKEKSNINIDENDINSKLNEGINQAIDNINNFINGCSV SYLMKKMIPLAVEKLLDFDNTLKKNLLNYIDENKLYLIGSAEYEKSKVNKYLKTIMPEDL SIYTNDTILIEMENKYNSEILNNIILNLRYKDNNLIDLSGYGAKVEVYDGVELNDKNQFK LTSSANSKIRVTQNQNIIFNSVELDFSVSFWIRIPKYKNDGIQNYIHNEYTIINCMKNNS GWKISIRGNRIIWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTITNNLNNAKIYING KLESNTDIKDIREVIANGEIIFKLDGDIDRTQFIWMKYFSIFNTELSQSNIEERYKIQSY SEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKLKKDSPVGEILTRSKYNQNSKYINYRDLY IGEKFIIRRKSNSQSINDDIVRKEDYIYLDFENLNQEWRVYTYKYFKKEEEKLFLAPISD SDEFYNTIQIKEYDEQPTYSCQLLFKKDEESTDEIGLIGIHRFYESGIVFEEYKDYFCIS KWYLKEVKRKPYNLKLGCNWQFIPKDEGWTE SEQIDNO:27(BoNT/C-UniProtP18640) MPITINNFNYSDPVDNKNILYLDTHLNTLANEPEKAFRITGNIWVIPDRFSRNSNPNLNK PPRVTSPKSGYYDPNYLSTDSDKDPFLKEIIKLFKRINSREIGEELIYRLSTDIPFPGNN NTPINTFDFDVDENSVDVKTRQGNNWVKTGSINPSVIITGPRENIIDPETSTEKLINNTE AAQEGFGALSIISISPREMLTYSNATNDVGEGRFSKSEFCMDPILILMHELNHAMHNLYG IAIPNDQTISSVTSNIFYSQYNVKLEYAEIYAFGGPTIDLIPKSARKYFEEKALDYYRSI AKRLNSITTANPSSENKYIGEYKQKLIRKYRFVVESSGEVTVNRNKFVELYNELTQIFTE FNYAKIYNVQNRKIYLSNVYTPVTANILDDNVYDIQNGENIPKSNLNVLFMGQNLSRNPA LRKVNPENMLYLFTKFCHKAIDGRSLYNKTLDCRELLVKNTDLPFIGDISDVKTDIFLRK DINEETEVIYYPDNVSVDQVILSKNTSEHGQLDLLYPSIDSESEILPGENQVFYDNRTQN VDYLNSYYYLESQKLSDNVEDFTFTRSIEEALDNSAKVYTYFPTLANKVNAGVQGGLFLM WANDVVEDFTTNILRKDTLDKISDVSAIIPYIGPALNISNSVRRGNFTEAFAVTGVTILL EAFPEFTIPALGAFVIYSKVQERNEIIKTIDNCLEQRIKRWKDSYEWMMGTWLSRIITQF NNISYQMYDSLNYQAGAIKAKIDLEYKKYSGSDKENIKSQVENLKNSLDVKISEAMNNIN KFIRECSVTYLFKNMLPKVIDELNEFDRNTKAKLINLIDSHNIILVGEVDKLKAKVNNSF QNTIPFNIFSYTNNSLLKDIINEYENNINDSKILSLQNRKNTLVDTSGYNAEVSEEGDVQ LNPIFPFDEKLGSSGEDRGKVIVTQNENIVYNSMYESFSISFWIRINKWVSNLPGYTIID SVKNNSGWSIGIISNFLVFTLKQNEDSEQSINFSYDISNNAPGYNKWFFVTVTNNMMGNM KIYINGKLIDTIKVKELTGINFSKTITFEINKIPDTGLITSDSDNINMWIRDFYIFAKEL DGKDINILFNSLQYTNVVKDYWGNDLRYNKEYYMVNIDYLNRYMYANSRQIVENTRRNNN DFNEGYKIIIKRIRGNTNDTRVRGGDILYFDMTINNKAYNLFMKNETMYADNHSTEDIYA IGLREQTKDINDNIIFQIQPMNNTYYYASQIFKSNENGENISGICSIGTYRFRLGGDWYR HNYLVPTVKQGNYASLLESTSTHWGFVPVSE SEQIDNO:28(BoNT/D-UniProtP19321) MTWPVKDFNYSDPVNDNDILYLRIPQNKLITTPVKAFMITQNIWVIPERFSSDTNPSLSK PPRPTSKYQSYYDPSYLSTDEQKDTFLKGIIKLFKRINERDIGKKLINYLVVGSPFMGDS STPEDTFDFTRHTTNIAVEKFENGSWKVTNIITPSVLIFGPLPNILDYTASLTLQGQQSN PSFEGFGTLSILKVAPEFLLTFSDVTSNQSSAVLGKSIFCMDPVIALMHELTHSLHQLYG INIPSDKRIRPQVSEGFFSQDGPNVQFEELYTFGGLDVEIIPQIERSQLREKALGHYKDI AKRLNNINKTIPSSWISNIDKYKKIFSEKYNEDKDNTGNFVVNIDKENSLYSDLTNVMSE VVYSSQYNVKNRTHYFSRHYLPVFANILDDNIYTIRDGENLINKGENIENSGQNIERNPA LQKLSSESVVDLFTKVCLRLTKNSRDDSTCIKVKNNRLPYVADKDSISQEIFENKIITDE TNVQNYSDKFSLDESILDGQVPINPEIVDPLLPNVNMEPLNLPGEEIVFYDDITKYVDYL NSYYYLESQKLSNNVENITLTTSVEEALGYSNKIYTFLPSLAEKVNKGVQAGLFLNWANE VVEDFTTNIMKKDTLDKISDVSVIIPYIGPALNIGNSALRGNENQAFATAGVAFLLEGFP EFTIPALGVFTFYSSIQEREKIIKTIENCLEQRVKRWKDSYQWMVSNWLSRITTQFNHIN YQMYDSLSYQADAIKAKIDLEYKKYSGSDKENIKSQVENLKNSLDVKISEAMNNINKFIR ECSVTYLFKNMLPKVIDELNKEDLRTKTELINLIDSHNIILVGEVDRLKAKVNESFENTM PFNIFSYTNNSLLKDIINEYENSINDSKILSLQNKKNALVDTSGYNAEVRVGDNVQLNTI YTNDFKLSSSGDKIIVNLNNNILYSAIYENSSVSFWIKISKDLINSHNEYTIINSIEQNS GWKLCIRNGNIEWILQDVNRKYKSLIFDYSESLSHTGYTNKWFFVTITNNIMGYMKLYIN GELKQSQKIEDLDEVKLDKTIVEGIDENIDENQMLWIRDENIFSKELSNEDINIVYEGQI LRNVIKDYWGNPLKFDTEYYIINDNYIDRYIAPESNVLVLVQYPDRSKLYTGNPITIKSV SDKNPYSRILNGDNIILHMLYNSRKYMIIRDTDTIYATQGGECSQNCVYALKLQSNLGNY GIGIFSIKNIVSKNKYCSQIFSSFRENTMLLADIYKPWRFSFKNAYTPVAVTNYETKLLS TSSFWKFISRDPGWVE SEQIDNO:29(BONT/E-UniProtQ00496) MPKINSFNYNDPVNDRTILYIKPGGCQEFYKSENIMKNIWIIPERNVIGTTPQDFHPPTS LKNGDSSYYDPNYLQSDEEKDRFLKIVTKIFNRINNNLSGGILLEELSKANPYLGNDNTP DNQFHIGDASAVEIKFSNGSQDILLPNVIIMGAEPDLFETNSSNISLRNNYMPSNHRFGS IAIVTESPEYSFRENDNCMNEFIQDPALTLMHELIHSLHGLYGAKGITTKYTITQKQNPL ITNIRGTNIEEFLTFGGTDLNIITSAQSNDIYTNLLADYKKIASKLSKVQVSNPLLNPYK DVFEAKYGLDKDASGIYSVNINKENDIFKKLYSFTEFDLRTKFQVKCRQTYIGQYKYFKL SNLLNDSIYNISEGYNINNLKVNERGQNANLNPRIITPITGRGLVKKIIRFCKNIVSVKG IRKSICIEINNGELFFVASENSYNDDNINTPKEIDDTVTSNNNYENDLDQVILNENSESA PGLSDEKLNLTIQNDAYIPKYDSNGTSDIEQHDVNELNVEFYLDAQKVPEGENNVNLTSS IDTALLEQPKIYTFFSSEFINNVNKPVQAALFVSWIQQVLVDETTEANQKSTVDKIADIS IVVPYIGLALNIGNEAQKGNEKDALELLGAGILLEFEPELLIPTILVFTIKSFLGSSDNK NKVIKAINNALKERDEKWKEVYSFIVSNWMTKINTQFNKRKEQMYQALQNQVNAIKTIIE SKYNSYTLEEKNELTNKYDIKQIENELNQKVSIAMNNIDRELTESSISYLMKIINEVKIN KLREYDENVKTYLLNYIIQHGSILGESQQELNSMVTDTLNNSIPFKLSSYTDDKILISYF NKFFKRIKSSSVLNMRYKNDKYVDTSGYDSNININGDVYKYPTNKNQFGIYNDKLSEVNI SQNDYIIYDNKYKNESISFWVRIPNYDNKIVNVNNEYTIINCMRDNNSGWKVSLNHNEII WTFEDNRGINQKLAFNYGNANGISDYINKWIFVTITNDRLGDSKLYINGNLIDQKSILNL GNIHVSDNILFKIVNCSYTRYIGIRYFNIFDKELDETEIQTLYSNEPNTNILKDFWGNYL LYDKEYYLLNVLKPNNFIDRRKDSTLSINNIRSTILLANRLYSGIKVKIQRVNNSSTNDN LVRKNDQVYINFVASKTHLFPLYADTATTNKEKTIKISSSGNRENQVVVMNSVGNCTMNF KNNNGNNIGLLGFKADTVVASTWYYTHMRDHTNSNGCFWNFISEEHGWQEK SEQIDNO:30(BONT/F-UniProtA7GBG3) MPVVINSFNYNDPVNDDTILYMQIPYEEKSKKYYKAFEIMRNVWIIPERNTIGTDPSDED PPASLENGSSAYYDPNYLTTDAEKDRYLKTTIKLFKRINSNPAGEVLLQEISYAKPYLGN EHTPINEFHPVTRTTSVNIKSSTNVKSSIILNLLVLGAGPDIFENSSYPVRKLMDSGGVY DPSNDGFGSINIVTFSPEYEYTENDISGGYNSSTESFIADPAISLAHELIHALHGLYGAR GVTYKETIKVKQAPLMIAEKPIRLEEFLTFGGQDLNIITSAMKEKIYNNLLANYEKIATR LSRVNSAPPEYDINEYKDYFQWKYGLDKNADGSYTVNENKFNEIYKKLYSFTEIDLANKF KVKCRNTYFIKYGFLKVPNLLDDDIYTVSEGFNIGNLAVNNRGQNIKLNPKIIDSIPDKG LVEKIVKFCKSVIPRKGTKAPPRLCIRVNNRELFFVASESSYNENDINTPKEIDDTTNLN NNYRNNLDEVILDYNSETIPQISNQTLNTLVQDDSYVPRYDSNGTSEIEEHNVVDLNVFF YLHAQKVPEGETNISLTSSIDTALSEESQVYTFFSSEFINTINKPVHAALFISWINQVIR DFTTEATQKSTFDKIADISLVVPYVGLALNIGNEVQKENFKEAFELLGAGILLEFVPELL IPTILVFTIKSFIGSSENKNKIIKAINNSLMERETKWKEIYSWIVSNWLTRINTQFNKRK EQMYQALQNQVDAIKTVIEYKYNNYTSDERNRLESEYNINNIREELNKKVSLAMENIERF ITESSIFYLMKLINEAKVSKLREYDEGVKEYLLDYISEHRSILGNSVQELNDLVTSTLNN SIPFELSSYTNDKILILYFNKLYKKIKDNSILDMRYENNKFIDISGYGSNISINGDVYIY STNRNQFGIYSSKPSEVNIAQNNDIIYNGRYQNFSISFWVRIPKYFNKVNLNNEYTIIDC IRNNNSGWKISLNYNKIIWTLQDTAGNNQKLVENYTQMISISDYINKWIFVTITNNRLGN SRIYINGNLIDEKSISNLGDIHVSDNILFKIVGCNDTRYVGIRYFKVEDTELGKTEIETL YSDEPDPSILKDFWGNYLLYNKRYYLLNLLRTDKSITQNSNFLNINQQRGVYQKPNIFSN TRLYTGVEVIIRKNGSTDISNTDNFVRKNDLAYINVVDRDVEYRLYADISIAKPEKIIKL IRTSNSNNSLGQIIVMDSIGNNCTMNFQNNNGGNIGLLGFHSNNLVASSWYYNNIRKNTS SNGCFWSFISKEHGWQEN SEQIDNO:31(BoNT/G-UniProtQ60393) MPVNIKXFNYNDPINNDDIIMMEPENDPGPGTYYKAFRIIDRIWIVPERFTYGFQPDQEN ASTGVFSKDVYEYYDPTYLKTDAEKDKFLKTMIKLFNRINSKPSGQRLLDMIVDAIPYLG NASTPPDKFAANVANVSINKKIIQPGAEDQIKGLMTNLIIFGPGPVLSDNFTDSMIMNGH SPISEGFGARMMIRFCPSCLNVENNVQENKDTSIFSRRAYFADPALTLMHELIHVLHGLY GIKISNLPITPNTKEFFMQHSDPVQAEELYTFGGHDPSVISPSTDMNIYNKALQNFQDIA NRLNIVSSAQGSGIDISLYKQIYKNKYDFVEDPNGKYSVDKDKEDKLYKALMFGFTETNL AGEYGIKTRYSYFSEYLPPIKTEKLLDNTIYTQNEGENIASKNLKTEENGQNKAVNKEAY EEISLEHLVIYRIAMCKPVMYKNTGKSEQCIIVNNEDLFFIANKDSFSKDLAKAETIAYN TQNNTIENNFSIDQLILDNDLSSGIDLPNENTEPFTNEDDIDIPVYIKQSALKKIFVDGD SLFEYLHAQTFPSNIENLQLTNSLNDALRNNNKVYTFFSTNLVEKANTVVGASLFVNWVK GVIDDFTSESTQKSTIDKVSDVSIIIPYIGPALNVGNETAKENEKNAFEIGGAAILMEFI PELIVPIVGFFTLESYVGNKGHIIMTISNALKKRDQKWTDMYGLIVSQWLSTVNTQFYTI KERMYNALNNQSQAIEKIIEDQYNRYSEEDKMNINIDENDIDFKLNQSINLAINNIDDFI NQCSISYLMNRMIPLAVKKLKDFDDNLKRDLLEYIDTNELYLLDEVNILKSKVNRHLKDS IPFDLSLYTKDTILIQVENNYISNISSNAILSLSYRGGRLIDSSGYGATMNVGSDVIEND IGNGQFKLNNSENSNITAHQSKFVVYDSMFDNESINFWVRTPKYNNNDIQTYLQNEYTII SCIKNDSGWKVSIKGNRIIWTLIDVNAKSKSIFFEYSIKDNISDYINKWFSITITNDRLG NANIYINGSLKKSEKILNLDRINSSNDIDEKLINCTDTTKFVWIKDENIFGRELNATEVS SLYWIQSSTNTLKDFWGNPLRYDTQYYLENQGMQNIYIKYFSKASMGETAPRTNENNAAI NYQNLYLGLRFIIKKASNSRNINNDNIVREGDYIYLNIDNISDESYRVYVLVNSKEIQTQ LFLAPINDDPTFYDVLQIKKYYEKTTYNCQILCEKDTKTFGLFGIGKFVKDYGYVWDTYD NYFCISQWYLRRISENINKLRLGCNWQFIPVDEGWTE SEQIDNO:32(PolypeptideSequenceofBoNT/X) MKLEINKFNYNDPIDGINVITMRPPRHSDKINKGKGPFKAFQVIKNIWIVPERYNFTNNT NDLNIPSEPIMEADAIYNPNYLNTPSEKDEFLQGVIKVLERIKSKPEGEKLLELISSSIP LPLVSNGALTLSDNETIAYQENNNIVSNLQANLVIYGPGPDIANNATYGLYSTPISNGEG TLSEVSFSPFYLKPFDESYGNYRSLVNIVNKFVKREFAPDPASTLMHELVHVTHNLYGIS NRNFYYNEDTGKIETSRQQNSLIFEELLTFGGIDSKAISSLIIKKIIETAKNNYTTLISE RLNTVTVENDLLKYIKNKIPVQGRLGNFKLDTAEFEKKLNTILFVLNESNLAQRFSILVR KHYLKERPIDPIYVNILDDNSYSTLEGENISSQGSNDFQGQLLESSYFEKIESNALRAFI KICPRNGLLYNAIYRNSKNYLNNIDLEDKKTTSKTNVSYPCSLLNGCIEVENKDLFLISN KDSLNDINLSEEKIKPETTVFFKDKLPPQDITLSNYDFTEANSIPSISQQNILERNEELY EPIRNSLFEIKTIYVDKLTTFHFLEAQNIDESIDSSKIRVELTDSVDEALSNPNKVYSPF KNMSNTINSIETGITSTYIFYQWLRSIVKDESDETGKIDVIDKSSDTLAIVPYIGPLLNI GNDIRHGDFVGAIELAGITALLEYVPEFTIPILVGLEVIGGELAREQVEAIVNNALDKRD QKWAEVYNITKAQWWGTIHLQINTRLAHTYKALSRQANAIKMNMEFQLANYKGNIDDKAK IKNAISETEILLNKSVEQAMKNTEKEMIKLSNSYLTKEMIPKVQDNLKNEDLETKKTLDK FIKEKEDILGTNLSSSLRRKVSIRLNKNIAFDINDIPESEFDDLINQYKNEIEDYEVLNL GAEDGKIKDLSGTTSDINIGSDIELADGRENKAIKIKGSENSTIKIAMNKYLRFSATDNF SISFWIKHPKPTNLLNNGIEYTLVENENQRGWKISIQDSKLIWYLRDHNNSIKIVTPDYI AFNGWNLITITNNRSKGSIVYVNGSKIEEKDISSIWNTEVDDPIIFRLKNNRDTQAFTLL DQFSIYRKELNQNEVVKLYNYYFNSNYIRDIWGNPLQYNKKYYLQTQDKPGKGLIREYWS SFGYDYVILSDSKTITFPNNIRYGALYNGSKVLIKNSKKLDGLVRNKDFIQLEIDGYNMG ISADRFNEDTNYIGTTYGTTHDLTTDFEIIQRQEKYRNYCQLKTPYNIFHKSGLMSTETS KPTFHDYRDWVYSSAWYFQNYENLNLRKHTKTNWYFIPKDEGWDED SEQIDNO:33(TeNT-UniProtP04958) MPITINNFRYSDPVNNDTIIMMEPPYCKGLDIYYKAFKITDRIWIVPERYEFGTKPEDEN PPSSLIEGASEYYDPNYLRTDSDKDRFLQTMVKLFNRIKNNVAGEALLDKIINAIPYLGN SYSLLDKFDTNSNSVSFNLLEQDPSGATTKSAMLTNLIIFGPGPVLNKNEVRGIVLRVDN KNYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLH GLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYK AIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTE IELGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGENIESKDLKSEYKGQNMRVNT NAFRNVDGSGLVSKLIGLCKKIIPPTNIRENLYNRTASLTDLGGELCIKIKNEDLTFIAE KNSFSEEPFQDEIVSYNTKNKPLNFNYSLDKIIVDYNLQSKITLPNDRTTPVTKGIPYAP EYKSNAASTIEIHNIDDNTIYQYLYAQKSPTTLQRITMTNSVDDALINSTKIYSYFPSVI SKVNQGAQGILFLQWVRDIIDDFTNESSQKTTIDKISDVSTIVPYIGPALNIVKQGYEGN FIGALETTGVVLLLEYIPEITLPVIAALSIAESSTQKEKIIKTIDNFLEKRYEKWIEVYK LVKAKWLGTVNTQFQKRSYQMYRSLEYQVDAIKKIIDYEYKIYSGPDKEQIADEINNLKN KLEEKANKAMININIFMRESSRSFLVNQMINEAKKQLLEFDTQSKNILMQYIKANSKFIG ITELKKLESKINKVESTPIPFSYSKNLDCWVDNEEDIDVILKKSTILNLDINNDIISDIS GENSSVITYPDAQLVPGINGKAIHLVNNESSEVIVHKAMDIEYNDMENNFTVSFWLRVPK VSASHLEQYGTNEYSIISSMKKHSLSIGSGWSVSLKGNNLIWTLKDSAGEVRQITFRDLP DKFNAYLANKWVFITITNDRLSSANLYINGVLMGSAEITGLGAIREDNNITLKLDRCNNN NQYVSIDKFRIFCKALNPKEIEKLYTSYLSITFLRDFWGNPLRYDTEYYLIPVASSSKDV QLKNITDYMYLTNAPSYTNGKLNIYYRRLYNGLKFIIKRYTPNNEIDSFVKSGDFIKLYV SYNNNEHIVGYPKDGNAFNNLDRILRVGYNAPGIPLYKKMEAVKLRDLKTYSVQLKLYDD KNASLGLVGTHNGQIGNDPNRDILIASNWYFNHLKDKILGCDWYFVPTDEGWTND SEQIDNO:34(BONT/DActivationLoop) CLRLTKNSRDDSTC SEQIDNO:35(BoNT/DCActivationLoop) CLRLTRNSRDDSTC SEQIDNO:36(BoNT/C1andCDActivationLoop) CHKAIDGRSLYNKTLDC SEQIDNO:37(BoNT/A4ActivationLoop) CVRGIITSKTKSLDEGYNKALNELC SEQIDNO:38(BoNT/A5andA7ActivationLoop) CVRGIITSKTKSLDEGYNKALNDLC SEQIDNO:39(BoNT/A1andA6ActivationLoop) CVRGIITSKTKSLDKGYNKALNDLC SEQIDNO:40(BoNT/A3ActivationLoop) CVRGIIPFKTKSLDEGYNKALNYLC SEQIDNO:41(BoNT/A2andA8ActivationLoop) CVRGIIPFKTKSLDEGYNKALNDLC SEQIDNO:42(BoNT/HActivationLoop) CSNSNTKNSLC SEQIDNO:43(BoNT/E1toE5,E9andE12ActivationLoop) CKNIVSVKGIRKSIC SEQIDNO:44(BoNT/E11ActivationLoop) CTNIFSPKGIRKSIC SEQIDNO:45(BoNT/E7,E8andE10ActivationLoop) CKNIVFSKGITKSIC SEQIDNO:46(BoNT/E6ActivationLoop) CKNIVFSKGIRKSIC SEQIDNO:47(BoNT/F7ActivationLoop) CKSIVSKKGTKNSLC SEQIDNO:48(BONT/F5ActivationLoop) CLNSSFKKNTKKPLC SEQIDNO:49(BoNT/F1andF6ActivationLoop) CKSVIPRKGTKAPPRLC SEQIDNO:50(BONT/F4ActivationLoop) CKSIIPRKGTKAPPRLC SEQIDNO:51(BoNT/F2andF3ActivationLoop) CKSIIPRKGTKQSPSLC SEQIDNO:52(TeNTActivationLoop) CKKIIPPTNIRENLYNRTASLTDLGGELC SEQIDNO:53(BoNT/GActivationLoop) CKPVMYKNTGKSEQC SEQIDNO:54(BoNT/B4ActivationLoop) CKSVKVPGIC SEQIDNO:55(BoNT/B2,B3,B6andB8ActivationLoop) CKSVRAPGIC SEQIDNO:56(BoNT/B1,B5andB7ActivationLoop) CKSVKAPGIC SEQIDNO:57(BoNT/XActivationLoop) CPRNGLLYNAIYRNSKNYLNNIDLEDKKTTSKTNVSYPCSLLNGC SEQIDNO:58metalcoordinatingSNAREcleavagemotif HEXXH SEQIDNO:59(aminoacidsequenceofhumanfurin) MELRPWLLWVVAATGTLVLLAADAQGQKVFTNTWAVRIPGGPAVANSVARKHGFLNLGQI FGDYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFP QQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQD PDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEA RSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGG REHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQ KCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRK VSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHIT RLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDED PSGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCEEGF SLHQKSCVQHCPPGFAPQVLDTHYSTENDVETIRASVCAPCHASCATCQGPALTDCLSCP SHASLDPVEQTCSRQSQSSRESPPQQQPPRLPPEVEAGQRLRAGLLPSHLPEVVAGLSCA FIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEGRGER TAFIKDQSAL SEQIDNO:60(additionalproteasecleavagesite) xDxxxLL xisanyaminoacid SEQIDNO:61(additionalproteasecleavagesite) xExxxLL xisanyaminoacid SEQIDNO:62(additionalproteasecleavagesite) xExxxIL xisanyaminoacid SEQIDNO:63(additionalproteasecleavagesite) xExxxLM xisanyaminoacid SEQIDNO:64(additionalproteasecleavagesite) Y-x-x-Hy xisanyaminoacid;Hyisahydrophobicaminoacid SEQIDNO:65(TEVcleavagesite) ENLYFQG SEQIDNO:66(Thrombincleavagesite) LVPRGS SEQIDNO:67(PreScissioncleavagesite) LEVLFQGP SEQIDNO:68(BoNT/A) MPFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLN PPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGG STIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHEVLNLTRNGY GSTQYIRESPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPN RVFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKA KSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKV LNRKTYLNFDKAVFKINIVPKVNYTIYDGENLRNTNLAANENGQNTEINNMNFTKLKNET GLFEFYKLLCVRGIITSKTKSLDKGYNKALNDLCIKVNNWDLFFSPSEDNETNDLNKGEE ITSDTNIEAAEENISLDLIQQYYLTENEDNEPENISIENLSSDIIGQLELMPNIEREPNG KKYELDKYTMFHYLRAQEFEHGKSRIALTNSVNEALLNPSRVYTFFSSDYVKKVNKATEA AMFLGWVEQLVYDFTDETSEVSTTDKIADITIIIPYIGPALNIGNMLYKDDEVGALIFSG AVILLEFIPEIAIPVLGTFALVSYIANKVLTVQTIDNALSKRNEKWDEVYKYIVTNWLAK VNTQIDLIRKKMKEALENQAEATKAIINYQYNQYTEEEKNNINENIDDLSSKLNESINKA MININKFLNQCSVSYLMNSMIPYGVKRLEDFDASLKDALLKYIYDNRGTLIGQVDRLKDK VNNTLSTDIPFQLSKYVDNQRLLSTFTEYIKNIINTSILNLRYESNHLIDLSRYASKINI GSKVNFDPIDKNQIQLENLESSKIEVILKNAIVYNSMYENESTSFWIRIPKYENSISLNN EYTIINCMENNSGWKVSLNYGEIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTIT NNRLNNSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDTHRYIWIKYENLEDKELN EKEIKDLYDNQSNSGILKDFWGDYLQYDKPYYMLNLYDPNKYVDVNNVGIRGYMYLKGPR GSVMTTNIYLNSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQA GVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFHQFNNIAK LVASNWYNRQIERSSRTLGCSWEFIPVDDGWGERPL SEQIDNO:69:non-engineeredBoNT/ABchimera MPFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLNPPPEAKQVPVSYYDS TYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGGSTIDTELKVIDTNCINVIQPDGSYRSEELN LVIIGPSADIIQFECKSFGHEVLNLTRNGYGSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHEL IHAGHRLYGIAINPNRVFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKA KSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKVLNRKTYLNFDKAVFK INIVPKVNYTIYDGFNLRNTNLAANFNGQNTEINNMNFTKLKNFTGLFEFYKLLCVRGIITSKTKSLDKGYNKAL NDLCIKVNNWDLFFSPSEDNFTNDLNKGEEITSDTNIEAAEENISLDLIQQYYLTFNFDNEPENISIENLSSDII GQLELMPNIERFPNGKKYELDKYTMFHYLRAQEFEHGKSRIALTNSVNEALLNPSRVYTFFSSDYVKKVNKATEA AMFLGWVEQLVYDFTDETSEVSTTDKIADITIIIPYIGPALNIGNMLYKDDFVGALIFSGAVILLEFIPEIAIPV LGTFALVSYIANKVLTVQTIDNALSKRNEKWDEVYKYIVTNWLAKVNTQIDLIRKKMKEALENQAEATKAIINYQ YNQYTEEEKNNINFNIDDLSSKLNESINKAMININKFLNQCSVSYLMNSMIPYGVKRLEDFDASLKDALLKYIYD NRGTLIGQVDRLKDKVNNTLSTDIPFQLSKYVDNQRLLSTFTEYIKNILNNIILNLRYKDNNLIDLSGYGAKVEV YDGVELNDKNQFKLTSSANSKIRVTQNQNIIFNSVFLDFSVSFWIRIPKYKNDGIQNYIHNEYTIINCMKNNSGW KISIRGNRIIWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTITNNLNNAKIYINGKLESNTDIKDIREVIAN GEIIFKLDGDIDRTQFIWMKYFSIFNTELSQSNIEERYKIQSYSEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKL KKDSPVGEILTRSKYNQNSKYINYRDLYIGEKFIIRRKSNSQSINDDIVRKEDYIYLDFFNLNQEWRVYTYKYFK KEEMKLFLAPIYDSDEFYNTIQIKEYDEQPTYSCQLLFKKDEESTDEIGLIGIHRFYESGIVFEEYKDYFCISKW YLKEVKRKPYNLKLGCNWQFIPKDEGWTE SytII-bindingmutationsE1191MandS1199Yareboldandunderlined. Theendogenousactivationloopisdash-underlined. SEQIDNO:70:engineeredBoNT/ABchimera MPFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLNPPPEAKQVPVSYYDS TYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGGSTIDTELKVIDTNCINVIQPDGSYRSEELN LVIIGPSADIIQFECKSFGHEVLNLTRNGYGSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHEL IHAGHRLYGIAINPNRVFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTINKA KSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKVLNRKTYLNFDKAVEK INIVPKVNYTIYDGFNLRNTNLAANFNGQNTEINNMNFTKLKNFTGLFEFYKLLCVRGIKQKSSNSRKKRSTSAL NDLCIKVNNWDLFFSPSEDNFTNDLNKGEEITSDTNIEAAEENISLDLIQQYYLTFNFDNEPENISIENLSSDII GQLELMPNIERFPNGKKYELDKYTMFHYLRAQEFEHGKSRIALTNSVNEALLNPSRVYTFFSSDYVKKVNKATEA AMFLGWVEQLVYDFTDETSEVSTTDKIADITIIIPYIGPALNIGNMLYKDDFVGALIFSGAVILLEFIPEIAIPV LGTFALVSYIANKVLTVQTIDNALSKRNEKWDEVYKYIVTNWLAKVNTQIDLIRKKMKEALENQAEATKAIINYQ YNQYTEEEKNNINFNIDDLSSKLNESINKAMININKFLNQCSVSYLMNSMIPYGVKRLEDFDASLKDALLKYIYD NRGTLIGQVDRLKDKVNNTLSTDIPFQLSKYVDNQRLLSTFTEYIKNILNNIILNLRYKDNNLIDLSGYGAKVEV YDGVELNDKNQFKLTSSANSKIRVTQNQNIIFNSVELDFSVSFWIRIPKYKNDGIQNYIHNEYTIINCMKNNSGW KISIRGNRIIWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTITNNLNNAKIYINGKLESNTDIKDIREVIAN GEIIFKLDGDIDRTQFIWMKYFSIFNTELSQSNIEERYKIQSYSEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKL KKDSPVGEILTRSKYNQNSKYINYRDLYIGEKFIIRRKSNSQSINDDIVRKEDYIYLDFFNLNQEWRVYTYKYFK KEEMKLFLAPIYDSDEFYNTIQIKEYDEQPTYSCQLLFKKDEESTDEIGLIGIHRFYESGIVFEEYKDYFCISKW YLKEVKRKPYNLKLGCNWQFIPKDEGWTE SytII-bindingmutationsE1191MandS1199Yareboldandunderlined. Theexogenousfurincleavagesite(underlined)replacespartoftheendogenousBoNT/A1 activationloop(bold). SEQIDNO:71engineeredBoNT/BderivedfromSEQIDNO:26 MPVTINNENYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERYTFGYKPEDENKSSGIFNR DVCEYYDPDYLNTNDKKNIFLQTMIKLENRIKSKPLGEKLLEMIINGIPYLGDRRVPLEEFNTNIASV TVNKLISNPGEVERKKGIFANLIIFGPGPVLNENETIDIGIQNHFASREGEGGIMQMKFCPEYVSVEN NVQENKGASIFNRRGYFSDPALILMHELIHVLHGLYGIKVDDLPIVPNEKKFFMQSTDAIQAEELYTE GGQDPSIITPSTDKSIYDKVLQNERGIVDRLNKVLVCISDPNININIYKNKFKDKYKFVEDSEGKYSI DVESFDKLYKSLMFGFTETNIAENYKIKTRASYFSDSLPPVKIKNLLDNEIYTIEEGENISDKDMEKE YRGQNKAINKQAYEEISKEHLAVYKIQMCKSVKQKSSNSRKKRSTSGICIDVDNEDLFFIADKNSES DDLSKNERIEYNTQSNYIENDEPINELILDTDLISKIELPSENTESLTDFNVDVPVYEKQPAIKKIFT DENTIFQYLYSQTFPLDIRDISLTSSEDDALLESNKVYSFFSMDYIKTANKVVEAGLFAGWVKQIVND FVIEANKSNTMDKIADISLIVPYIGLALNVGNETAKGNFENAFEIAGASILLEFIPELLIPVVGAFLL ESYIDNKNKIIKTIDNALTKRNEKWSDMYGLIVAQWLSTVNTQFYTIKEGMYKALNYQAQALEEIIKY RYNIYSEKEKSNINIDENDINSKLNEGINQAIDNINNFINGCSVSYLMKKMIPLAVEKLLDEDNTLKK NLLNYIDENKLYLIGSAEYEKSKVNKYLKTIMPFDLSIYINDTILIEMENKYNSEILNNIILNLRYKD NNLIDLSGYGAKVEVYDGVELNDKNQFKLTSSANSKIRVTQNQNIIENSVELDESVSFWIRIPKYKND GIQNYIHNEYTIINCMKNNSGWKISIRGNRIIWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTIT NNLNNAKIYINGKLESNTDIKDIREVIANGEIIFKLDGDIDRTQFIWMKYFSIFNTELSQSNIEERYK IQSYSEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKLKKDSPVGEILTRSKYNQNSKYINYRDLYIGEK FIIRRKSNSQSINDDIVRKEDYIYLDFFNLNQEWRVYTYKYFKKEEEKLFLAPISDSDEFYNTIQIKE YDEQPTYSCQLLFKKDEESTDEIGLIGIHRFYESGIVFEEYKDYFCISKWYLKEVKRKPYNLKLGCNW QFIPKDEGWTE Theexogenousfurincleavagesite(underlined)replacespartoftheendogenousBoNT/B activationloop(bold). SEQIDNO:72engineeredBoNT/CderivedfromSEQIDNO:27 MPITINNFNYSDPVDNKNILYLDTHLNTLANEPEKAFRITGNIWVIPDRFSRNSNPNLNKPPRVTSPK SGYYDPNYLSTDSDKDPFLKEIIKLFKRINSREIGEELIYRLSTDIPFPGNNNTPINTEDEDVDENSV DVKTRQGNNWVKTGSINPSVIITGPRENIIDPETSTFKLTNNTFAAQEGFGALSIISISPREMLTYSN ATNDVGEGRFSKSEFCMDPILILMHELNHAMHNLYGIAIPNDQTISSVTSNIFYSQYNVKLEYAEIYA FGGPTIDLIPKSARKYFEEKALDYYRSIAKRLNSITTANPSSENKYIGEYKQKLIRKYRFVVESSGEV TVNRNKEVELYNELTQIFTEFNYAKIYNVQNRKIYLSNVYTPVTANILDDNVYDIQNGFNIPKSNLNV LFMGQNLSRNPALRKVNPENMLYLFTKFCHKAIKQKSSNSRKKRSTSTLDCRELLVKNTDLPFIGDI SDVKTDIFLRKDINEETEVIYYPDNVSVDQVILSKNTSEHGQLDLLYPSIDSESEILPGENQVFYDNR TQNVDYLNSYYYLESQKLSDNVEDFTFTRSIEEALDNSAKVYTYFPTLANKVNAGVQGGLELMWANDV VEDFTTNILRKDTLDKISDVSAIIPYIGPALNISNSVRRGNFTEAFAVTGVTILLEAFPEFTIPALGA FVIYSKVQERNEIIKTIDNCLEQRIKRWKDSYEWMMGTWLSRIITQFNNISYQMYDSLNYQAGAIKAK IDLEYKKYSGSDKENIKSQVENLKNSLDVKISEAMNNINKFIRECSVTYLFKNMLPKVIDELNEEDRN TKAKLINLIDSHNIILVGEVDKLKAKVNNSFQNTIPFNIFSYTNNSLLKDIINEYENNINDSKILSLQ NRKNTLVDTSGYNAEVSEEGDVQLNPIFPEDEKLGSSGEDRGKVIVTQNENIVYNSMYESFSISEWIR INKWVSNLPGYTIIDSVKNNSGWSIGIISNELVETLKQNEDSEQSINFSYDISNNAPGYNKWFFVTVT NNMMGNMKIYINGKLIDTIKVKELTGINFSKTITFEINKIPDTGLITSDSDNINMWIRDFYIFAKELD GKDINILENSLQYTNVVKDYWGNDLRYNKEYYMVNIDYLNRYMYANSRQIVENTRRNNNDENEGYKII IKRIRGNTNDTRVRGGDILYFDMTINNKAYNLFMKNETMYADNHSTEDIYAIGLREQTKDINDNIIFQ IQPMNNTYYYASQIFKSNENGENISGICSIGTYRFRLGGDWYRHNYLVPTVKQGNYASLLESTSTHWG FVPVSE Theexogenousfurincleavagesite(underlined)replacespartoftheendogenousBoNT/C activationloop(bold). SEQIDNO:73engineeredBoNT/DderivedfromSEQIDNO:28 MTWPVKDENYSDPVNDNDILYLRIPQNKLITTPVKAFMITQNIWVIPERFSSDTNPSLSKPPRPTSKY QSYYDPSYLSTDEQKDTFLKGIIKLFKRINERDIGKKLINYLVVGSPFMGDSSTPEDTFDFTRHTTNI AVEKFENGSWKVTNIITPSVLIFGPLPNILDYTASLTLQGQQSNPSFEGFGTLSILKVAPEFLLTESD VTSNQSSAVLGKSIFCMDPVIALMHELTHSLHQLYGINIPSDKRIRPQVSEGFFSQDGPNVQFEELYT FGGLDVEIIPQIERSQLREKALGHYKDIAKRLNNINKTIPSSWISNIDKYKKIFSEKYNFDKDNTGNF VVNIDKFNSLYSDLTNVMSEVVYSSQYNVKNRTHYFSRHYLPVFANILDDNIYTIRDGENLINKGENI ENSGQNIERNPALQKLSSESVVDLFTKVCLRLKQKSSNSRKKRSTSDSTCIKVKNNRLPYVADKDSI SQEIFENKIITDETNVQNYSDKFSLDESILDGQVPINPEIVDPLLPNVNMEPLNLPGEEIVFYDDITK YVDYLNSYYYLESQKLSNNVENITLTTSVEEALGYSNKIYTELPSLAEKVNKGVQAGLELNWANEVVE DFTTNIMKKDTLDKISDVSVIIPYIGPALNIGNSALRGNENQAFATAGVAFLLEGFPEFTIPALGVET FYSSIQEREKIIKTIENCLEQRVKRWKDSYQWMVSNWLSRITTQFNHINYQMYDSLSYQADAIKAKID LEYKKYSGSDKENIKSQVENLKNSLDVKISEAMNNINKFIRECSVTYLFKNMLPKVIDELNKFDLRTK TELINLIDSHNIILVGEVDRLKAKVNESFENTMPFNIFSYTNNSLLKDIINEYENSINDSKILSLQNK KNALVDTSGYNAEVRVGDNVQLNTIYTNDEKLSSSGDKIIVNLNNNILYSAIYENSSVSFWIKISKDL TNSHNEYTIINSIEQNSGWKLCIRNGNIEWILQDVNRKYKSLIFDYSESLSHTGYTNKWFFVTITNNI MGYMKLYINGELKQSQKIEDLDEVKLDKTIVEGIDENIDENQMLWIRDENIFSKELSNEDINIVYEGQ ILRNVIKDYWGNPLKEDTEYYIINDNYIDRYIAPESNVLVLVQYPDRSKLYTGNPITIKSVSDKNPYS RILNGDNIILHMLYNSRKYMIIRDTDTIYATQGGECSQNCVYALKLQSNLGNYGIGIFSIKNIVSKNK YCSQIFSSFRENTMLLADIYKPWRFSFKNAYTPVAVTNYETKLLSTSSFWKFISRDPGWVE Theexogenousfurincleavagesite(underlined)replacespartoftheendogenousBoNT/D activationloop(bold). SEQIDNO:74engineeredBoNT/EderivedfromSEQIDNO:29 MPKINSFNYNDPVNDRTILYIKPGGCQEFYKSENIMKNIWIIPERNVIGTTPQDFHPPTSLKNGDSSY YDPNYLQSDEEKDRELKIVTKIFNRINNNLSGGILLEELSKANPYLGNDNTPDNQFHIGDASAVEIKE SNGSQDILLPNVIIMGAEPDLFETNSSNISLRNNYMPSNHRFGSIAIVTFSPEYSFRENDNCMNEFIQ DPALTLMHELIHSLHGLYGAKGITTKYTITQKQNPLITNIRGTNIEEFLTFGGTDLNIITSAQSNDIY TNLLADYKKIASKLSKVQVSNPLLNPYKDVFEAKYGLDKDASGIYSVNINKENDIFKKLYSFTEFDLR TKFQVKCRQTYIGQYKYFKLSNLLNDSIYNISEGYNINNLKVNFRGQNANLNPRIITPITGRGLVKKI IRFCKNIKQKSSNSRKKRSTSSICIEINNGELFFVASENSYNDDNINTPKEIDDTVTSNNNYENDLD QVILNENSESAPGLSDEKLNLTIQNDAYIPKYDSNGTSDIEQHDVNELNVFFYLDAQKVPEGENNVNL TSSIDTALLEQPKIYTFFSSEFINNVNKPVQAALFVSWIQQVLVDETTEANQKSTVDKIADISIVVPY IGLALNIGNEAQKGNEKDALELLGAGILLEFEPELLIPTILVFTIKSFLGSSDNKNKVIKAINNALKE RDEKWKEVYSFIVSNWMTKINTQFNKRKEQMYQALQNQVNAIKTIIESKYNSYTLEEKNELTNKYDIK QIENELNQKVSIAMNNIDRELTESSISYLMKIINEVKINKLREYDENVKTYLLNYIIQHGSILGESQQ ELNSMVTDTLNNSIPFKLSSYTDDKILISYENKFFKRIKSSSVLNMRYKNDKYVDTSGYDSNININGD VYKYPTNKNQFGIYNDKLSEVNISQNDYIIYDNKYKNFSISFWVRIPNYDNKIVNVNNEYTIINCMRD NNSGWKVSLNHNEIIWTFEDNRGINQKLAFNYGNANGISDYINKWIFVTITNDRLGDSKLYINGNLID QKSILNLGNIHVSDNILFKIVNCSYTRYIGIRYFNIFDKELDETEIQTLYSNEPNTNILKDEWGNYL LYDKEYYLLNVLKPNNFIDRRKDSTLSINNIRSTILLANRLYSGIKVKIQRVNNSSTNDNLVRKNDQV YINFVASKTHLFPLYADTATTNKEKTIKISSSGNRFNQVVVMNSVGNCTMNFKNNNGNNIGLLGEKAD TVVASTWYYTHMRDHTNSNGCFWNFISEEHGWQEK Theexogenousfurincleavagesite(underlined)replacespartoftheendogenousBoNT/E activationloop(bold). SEQIDNO:75engineeredBoNT/FderivedfromSEQIDNO:30 MPVVINSFNYNDPVNDDTILYMQIPYEEKSKKYYKAFEIMRNVWIIPERNTIGTDPSDFDPPASLENGSSAYYDP NYLTTDAEKDRYLKTTIKLFKRINSNPAGEVLLQEISYAKPYLGNEHTPINEFHPVTRTTSVNIKSSTNVKSSII LNLLVLGAGPDIFENSSYPVRKLMDSGGVYDPSNDGFGSINIVTFSPEYEYTENDISGGYNSSTESFIADPAISL AHELIHALHGLYGARGVTYKETIKVKQAPLMIAEKPIRLEEFLTFGGQDLNIITSAMKEKIYNNLLANYEKIATR LSRVNSAPPEYDINEYKDYFQWKYGLDKNADGSYTVNENKFNEIYKKLYSFTEIDLANKFKVKCRNTYFIKYGFL KVPNLLDDDIYTVSEGENIGNLAVNNRGQNIKLNPKIIDSIPDKGLVEKIVKFCKSVIKQKSSNSRKKRSTSR LCIRVNNRELFFVASESSYNENDINTPKEIDDTTNLNNNYRNNLDEVILDYNSETIPQISNQTLNTLVQDDSYVP RYDSNGTSEIEEHNVVDLNVFFYLHAQKVPEGETNISLTSSIDTALSEESQVYTFFSSEFINTINKPVHAALFIS WINQVIRDFTTEATQKSTEDKIADISLVVPYVGLALNIGNEVQKENFKEAFELLGAGILLEFVPELLIPTILVFT IKSFIGSSENKNKIIKAINNSLMERETKWKEIYSWIVSNWLTRINTQFNKRKEQMYQALQNQVDAIKTVIEYKYN NYTSDERNRLESEYNINNIREELNKKVSLAMENIERFITESSIFYLMKLINEAKVSKLREYDEGVKEYLLDYISE HRSILGNSVQELNDLVTSTLNNSIPFELSSYTNDKILILYFNKLYKKIKDNSILDMRYENNKFIDISGYGSNISI NGDVYIYSTNRNQFGIYSSKPSEVNIAQNNDIIYNGRYQNFSISFWVRIPKYFNKVNLNNEYTIIDCIRNNNSGW KISLNYNKIIWTLQDTAGNNQKLVENYTQMISISDYINKWIFVTITNNRLGNSRIYINGNLIDEKSISNLGDIHV SDNILFKIVGCNDTRYVGIRYFKVEDTELGKTEIETLYSDEPDPSILKDFWGNYLLYNKRYYLLNLLRTDKSITQ NSNFLNINQQRGVYQKPNIFSNTRLYTGVEVIIRKNGSTDISNTDNFVRKNDLAYINVVDRDVEYRLYADISIAK PEKIIKLIRTSNSNNSLGQIIVMDSIGNNCTMNFQNNNGGNIGLLGFHSNNLVASSWYYNNIRKNTSSNGCFWSF ISKEHGWQEN Theexogenousfurincleavagesite(underlined)replacespartoftheendogenousBoNT/F activationloop(bold). SEQIDNO:76engineeredBoNT/GderivedfromSEQIDNO:31 MPVNIKXFNYNDPINNDDIIMMEPENDPGPGTYYKAFRIIDRIWIVPERFTYGFQPDQFNASTGVESK DVYEYYDPTYLKTDAEKDKFLKTMIKLENRINSKPSGQRLLDMIVDAIPYLGNASTPPDKFAANVANV SINKKIIQPGAEDQIKGLMTNLIIFGPGPVLSDNFTDSMIMNGHSPISEGFGARMMIRFCPSCLNVEN NVQENKDTSIFSRRAYFADPALTLMHELIHVLHGLYGIKISNLPITPNTKEFFMQHSDPVQAEELYTE GGHDPSVISPSTDMNIYNKALQNFQDIANRLNIVSSAQGSGIDISLYKQIYKNKYDFVEDPNGKYSVD KDKFDKLYKALMFGFTETNLAGEYGIKTRYSYFSEYLPPIKTEKLLDNTIYTQNEGENIASKNLKTEF NGQNKAVNKEAYEEISLEHLVIYRIAMCKPVKQKSSNSRKKRSTSSEQCIIVNNEDLFFIANKDSES KDLAKAETIAYNTQNNTIENNESIDQLILDNDLSSGIDLPNENTEPFTNEDDIDIPVYIKQSALKKIF VDGDSLFEYLHAQTFPSNIENLQLTNSLNDALRNNNKVYTFFSTNLVEKANTVVGASLFVNWVKGVID DFTSESTQKSTIDKVSDVSIIIPYIGPALNVGNETAKENEKNAFEIGGAAILMEFIPELIVPIVGFFT LESYVGNKGHIIMTISNALKKRDQKWTDMYGLIVSQWLSTVNTQFYTIKERMYNALNNQSQAIEKIIE DQYNRYSEEDKMNINIDENDIDFKLNQSINLAINNIDDFINQCSISYLMNRMIPLAVKKLKDEDDNLK RDLLEYIDTNELYLLDEVNILKSKVNRHLKDSIPFDLSLYTKDTILIQVENNYISNISSNAILSLSYR GGRLIDSSGYGATMNVGSDVIENDIGNGQFKLNNSENSNITAHQSKFVVYDSMEDNESINFWVRTPKY NNNDIQTYLQNEYTIISCIKNDSGWKVSIKGNRIIWTLIDVNAKSKSIFFEYSIKDNISDYINKWFSI TITNDRLGNANIYINGSLKKSEKILNLDRINSSNDIDEKLINCTDTTKFVWIKDENIFGRELNATEVS SLYWIQSSTNTLKDFWGNPLRYDTQYYLENQGMQNIYIKYFSKASMGETAPRTNENNAAINYQNLYLG LRFIIKKASNSRNINNDNIVREGDYIYLNIDNISDESYRVYVLVNSKEIQTQLFLAPINDDPTFYDVL QIKKYYEKTTYNCQILCEKDTKTFGLFGIGKFVKDYGYVWDTYDNYFCISQWYLRRISENINKLRLGC NWQFIPVDEGWTE Theexogenousfurincleavagesite(underlined)replacespartoftheendogenousBoNT/G activationloop(bold). SEQIDNO:77engineeredBoNT/XderivedfromSEQIDNO:32 MKLEINKFNYNDPIDGINVITMRPPRHSDKINKGKGPFKAFQVIKNIWIVPERYNFTNNTNDLNIPSE PIMEADAIYNPNYLNTPSEKDEFLQGVIKVLERIKSKPEGEKLLELISSSIPLPLVSNGALTLSDNET IAYQENNNIVSNLQANLVIYGPGPDIANNATYGLYSTPISNGEGTLSEVSFSPFYLKPFDESYGNYRS LVNIVNKFVKREFAPDPASTLMHELVHVTHNLYGISNRNFYYNEDTGKIETSRQQNSLIFEELLTEGG IDSKAISSLIIKKIIETAKNNYTTLISERLNTVTVENDLLKYIKNKIPVQGRLGNEKLDTAEFEKKLN TILFVLNESNLAQRFSILVRKHYLKERPIDPIYVNILDDNSYSTLEGENISSQGSNDFQGQLLESSYF EKIESNALRAFIKICPRNGLKQKSSNSRKKRSTSCSLLNGCIEVENKDLFLISNKDSLNDINLSEE KIKPETTVFFKDKLPPQDITLSNYDFTEANSIPSISQQNILERNEELYEPIRNSLFEIKTIYVDKLTT FHFLEAQNIDESIDSSKIRVELTDSVDEALSNPNKVYSPEKNMSNTINSIETGITSTYIFYQWLRSIV KDFSDETGKIDVIDKSSDTLAIVPYIGPLLNIGNDIRHGDFVGAIELAGITALLEYVPEFTIPILVGL EVIGGELAREQVEAIVNNALDKRDQKWAEVYNITKAQWWGTIHLQINTRLAHTYKALSRQANAIKMNM EFQLANYKGNIDDKAKIKNAISETEILLNKSVEQAMKNTEKFMIKLSNSYLTKEMIPKVQDNLKNEDL ETKKTLDKFIKEKEDILGTNLSSSLRRKVSIRLNKNIAFDINDIPFSEFDDLINQYKNEIEDYEVLNL GAEDGKIKDLSGTTSDINIGSDIELADGRENKAIKIKGSENSTIKIAMNKYLRFSATDNESISFWIKH PKPTNLLNNGIEYTLVENENQRGWKISIQDSKLIWYLRDHNNSIKIVTPDYIAFNGWNLITITNNRSK GSIVYVNGSKIEEKDISSIWNTEVDDPIIFRLKNNRDTQAFTLLDQFSIYRKELNQNEVVKLYNYYEN SNYIRDIWGNPLQYNKKYYLQTQDKPGKGLIREYWSSFGYDYVILSDSKTITFPNNIRYGALYNGSKV LIKNSKKLDGLVRNKDFIQLEIDGYNMGISADRENEDTNYIGTTYGTTHDLTTDFEIIQRQEKYRNYC QLKTPYNIFHKSGLMSTETSKPTFHDYRDWVYSSAWYFQNYENLNLRKHTKINWYFIPKDEGWDED Theexogenousfurincleavagesite(underlined)replacespartoftheendogenousBoNT/X activationloop(bold). SEQIDNO:78engineeredBoNT/XderivedfromSEQIDNO:32 MKLEINKFNYNDPIDGINVITMRPPRHSDKINKGKGPFKAFQVIKNIWIVPERYNFTNNTNDLNIPSE PIMEADAIYNPNYLNTPSEKDEFLQGVIKVLERIKSKPEGEKLLELISSSIPLPLVSNGALTLSDNET IAYQENNNIVSNLQANLVIYGPGPDIANNATYGLYSTPISNGEGTLSEVSFSPFYLKPFDESYGNYRS LVNIVNKFVKREFAPDPASTLMHELVHVTHNLYGISNRNFYYNEDTGKIETSRQQNSLIFEELLTEGG IDSKAISSLIIKKIIETAKNNYTTLISERLNTVTVENDLLKYIKNKIPVQGRLGNEKLDTAEFEKKLN TILFVLNESNLAQRFSILVRKHYLKERPIDPIYVNILDDNSYSTLEGFNISSQGSNDFQGQLLESSYF EKIESNALRAFIKICPRNGLLYNAIYRNSKQKSSNSRKKRSTSTNVSYPCSLLNGCIEVENKDLEL ISNKDSLNDINLSEEKIKPETTVFFKDKLPPQDITLSNYDFTEANSIPSISQQNILERNEELYEPIRN SLFEIKTIYVDKLTTFHFLEAQNIDESIDSSKIRVELTDSVDEALSNPNKVYSPEKNMSNTINSIETG ITSTYIFYQWLRSIVKDESDETGKIDVIDKSSDTLAIVPYIGPLLNIGNDIRHGDFVGAIELAGITAL LEYVPEFTIPILVGLEVIGGELAREQVEAIVNNALDKRDQKWAEVYNITKAQWWGTIHLQINTRLAHT YKALSRQANAIKMNMEFQLANYKGNIDDKAKIKNAISETEILLNKSVEQAMKNTEKEMIKLSNSYLTK EMIPKVQDNLKNEDLETKKTLDKFIKEKEDILGTNLSSSLRRKVSIRLNKNIAFDINDIPFSEEDDLI NQYKNEIEDYEVLNLGAEDGKIKDLSGTTSDINIGSDIELADGRENKAIKIKGSENSTIKIAMNKYLR FSATDNESISFWIKHPKPTNLLNNGIEYTLVENFNQRGWKISIQDSKLIWYLRDHNNSIKIVTPDYI AFNGWNLITITNNRSKGSIVYVNGSKIEEKDISSIWNTEVDDPIIFRLKNNRDTQAFTLLDQFSIYRK ELNQNEVVKLYNYYFNSNYIRDIWGNPLQYNKKYYLQTQDKPGKGLIREYWSSFGYDYVILSDSKTIT FPNNIRYGALYNGSKVLIKNSKKLDGLVRNKDFIQLEIDGYNMGISADRENEDTNYIGTTYGTTHDLT TDFEIIQRQEKYRNYCQLKTPYNIFHKSGLMSTETSKPTFHDYRDWVYSSAWYFQNYENLNLRKHTKT NWYFIPKDEGWDED Theexogenousfurincleavagesite(underlined)replacespartoftheendogenousBoNT/X activationloop(bold). EXAMPLES
[0384] The invention will be further clarified by the following examples, which are intended to be purely exemplary of the invention and are in no way limiting.
Example 1Design and Production of BoNT/A1 with the Endogenous Activation Loop Replaced by a Furin Cleavage Site
[0385] The BoNT/A1 of SEQ ID NO: 68 was modified to replace a portion of the activation loop (amino acid residues 435-448 of SEQ ID NO: 25) by a furin cleavage site (SEQ ID NO: 5) creating engineered BoNT/A.sub.1-furin protein SEQ ID NO: 24 (SXN104539). The DNA construct encoding SEQ ID NO: 24 was created by using pair of oligonucleotides to replace codons in the activation loop in the plasmid encoding SEQ ID NO: 25, with the desired furin sequence by regular substitution mutagenesis. The target protein (SXN104539) was expressed in E. coli BL21 DE3 cells and purified using classical chromatography techniques after lysis. This involved an initial capture step by hydrophobic interaction chromatography followed by anionic-exchange chromatography and buffer exchange into PBS pH 7.2.
[0386] 1.2 ?g SXN104539 was incubated with 1 ?g furin in 24 ?L for 48 h at 25? C. and samples in the presence or absence of DTT (reduced or non-reduced, respectively) were resolved by SDS-PAGE (
Example 2Comparison of the Potency of BoNT/A.SUB.1-furin .with Native BoNT/A.SUB.1 .and Recombinant BoNT/A.SUB.1
[0387] The ability of the engineered BoNT/A.sub.1-furin (SXN104539) to enter neurons and cleave SNAP-25 (the target of BoNT/A.sub.1) was assessed using rat embryonic spinal cord neurons (eSCN).
TABLE-US-00009 rBoNT/A rBoNT/A(furin) single-chain single-chain nBoNT/A LIST SXN104445 SXN104539 pEC.sub.50 12.3 ? 0.1 10.8 ? 0.2 12.1 ? 0.1 n = 8 n = 2 n = 3
[0388] Thus, these results show that SXN104539 retained the same ability to enter the neuron and cleave SNAP-25 as native BoNT/A.sub.1 and had improved potency compared with single-chain BoNT/A.sub.1 (scSXN104445).
[0389] Potency of SXN104539 was further assessed using the mouse phrenic nerve hemi-diaphragm assay (mPNHD).
TABLE-US-00010 t.sub.50 (mean ? sem), n = 3 rBoNT/A scSXN104445 77 ? 3 min rBoNT/A(furin) sc SXN104539 40 ? 1 min rBoNT/A dcSXN102342 42 ? 2 min
[0390] These potency result demonstrate that replacement of a clostridial neurotoxin endogenous activation loop with a furin cleavage site is a successful strategy for in vivo activation of clostridial neurotoxin.
Example 3Comparison of Tolerance to BoNT/A.SUB.1-furin., Native BoNT/A.SUB.1., Recombinant Di-Chain BoNT/A.SUB.1 .and Recombinant Single-Chain BoNT/A.SUB.1
[0391] The in vivo mouse Digital Abduction Score (DAS) assay was used to assess potency as well as safety relative to native BoNT/A.sub.1 and rBoNT/A.sub.1.
[0392] There was an observable decrease in body weight (BW) from 5 pg/mouse i.m. (
[0393] In a second experiment over a longer period, single-chain rBoNT/A with furin loop (SXN104539) elicited a smaller effect on BW compared with recombinant BoNT/A1 di-chain (
[0394] DAS 4 was not reached over a four-day time course t for scSXN104445 or with nBoNT/A1 at 5 pg/mouse (which dose of nBoNT/A1 induced BW loss). The DAS score by order of magnitude were SXN104539>nBoNT/A1>scSXN104445 (
[0395] Duration of action was also assessed. A lower dose (4 pg/mouse) was tested and DAS scores determined. DAS 4 was achieved for both dc rBoNT/A1 and SXN104539.
[0396] All publications mentioned in the above specification are herein incorporated by reference. Various modifications and variations of the described methods and system of the present invention will be apparent to those skilled in the art without departing from the scope and spirit of the present invention. Although the present invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention which are obvious to those skilled in biochemistry and biotechnology or related fields are intended to be within the scope of the following claims.