Recombinant IgG4 monovalent antibodies
10351629 ยท 2019-07-16
Assignee
Inventors
- Janine Schuurman (Diemen, NL)
- Tom Vink (Alphen aan den Rijn, NL)
- Jan Van De Winkel (Zeist, NL)
- Aran Frank Labrijn (Nigtevecht, NL)
- Paul Parren (Odijk, NL)
- Willem Karel Bleeker (Amsterdam, NL)
- Frank Beurskens (Culemborg, NL)
- Patrick Van Berkel (Utrecht, NL)
Cpc classification
C07K16/283
CHEMISTRY; METALLURGY
C07K16/2863
CHEMISTRY; METALLURGY
C07K2317/90
CHEMISTRY; METALLURGY
A01K2267/01
HUMAN NECESSITIES
C12N15/8509
CHEMISTRY; METALLURGY
C07K16/00
CHEMISTRY; METALLURGY
International classification
C07K16/00
CHEMISTRY; METALLURGY
A61K39/00
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
Abstract
The invention relates to novel non-human transgenic animals, which upon antigenic stimulation are capable of producing monovalent antibodies binding to a selected antigen, modified heavy chain transgenes, methods for producing the non-human transgenic animals, methods for immunizing the non-human transgenic animals for as well as monovalent antibodies obtainable by such immunization methods.
Claims
1. A monovalent IgG4 antibody that binds to a selected antigen, which monovalent antibody comprises: a heavy chain, which heavy chain comprises: (i) a human V.sub.H region, and (ii) a human C.sub.H region, wherein the C.sub.H region has been modified such that the region corresponding to the hinge region does not comprise any amino acid residues which are capable of forming disulfide bonds with an identical C.sub.H region, and wherein the C.sub.H3 region has the sequence as set forth in SEQ ID NO: 16, but wherein the C.sub.H3 region has been modified so that one or more of the following amino acid substitutions have been made: Leu (L) in position 236 has been replaced by Ala (A); Leu (L) in position 236 has been replaced by Val (V); Leu (L) in position 236 has been replaced by Glu (E); Leu (L) in position 236 has been replaced by Gly (G); Phe (F) in position 273 has been replaced by Thr (T); Phe (F) in position 273 has been replace by Asp (D); Tyr (Y) in position 275 has been replaced by Ala (A); and Tyr (Y) in position 275 has been replaced by Glu (E) and a light chain, which light chain comprises: (i) a human V.sub.L region, and (ii) a human C.sub.L region.
2. The monovalent antibody according to claim 1, wherein the monovalent antibody comprises the CH3 region as set forth in SEQ ID NO: 16, with the exception of the specified amino acid substitutions.
3. The monovalent antibody according to claim 2, but wherein Leu (L) in position 236 has been replaced by Ala (A).
4. The monovalent antibody according to claim 2, but wherein Leu (L) in position 236 has been replaced by Val (V).
5. The monovalent antibody according to claim 2, but wherein Leu (L) in position 236 has been replaced by Glu (E).
6. The monovalent antibody according to claim 2, but wherein Leu (L) in position 236 has been replaced by Gly (G).
7. The monovalent antibody according to claim 2, but wherein Phe (F) in position 273 has been replaced by Thr (T) and/or Tyr (Y) in position 275 has been replaced by Glu (E).
8. The monovalent antibody according to claim 2, but wherein Tyr (Y) in position 275 has been replaced by Ala (A).
9. The monovalent antibody according to claim 2, wherein the monovalent antibody further comprises the CH2 region as set forth in SEQ ID NO: 16, but wherein Thr (T) in position 118 has been replaced by Gln (Q) and/or Met (M) in position 296 has been replaced by Leu (L).
10. The monovalent antibody according to claim 2, wherein the monovalent antibody further comprises the CH2 region as set forth in SEQ ID NO: 16, but wherein one, two or all three of the following substitutions have been made: Met (M) in position 120 has been replaced by Tyr (Y); Ser (S) in position 122 has been replaced by Thr (T); and Thr (T) in position 124 has been replaced by Glu (E).
11. The monovalent antibody according to claim 2, wherein the monovalent antibody further comprises the CH2 region as set forth in SEQ ID NO: 16, but wherein Asn (N) in position 302 has been replaced by Ala (A).
12. The monovalent antibody according to claim 2, wherein the monovalent antibody further comprises the CH2 region as set forth in SEQ ID NO: 16, but wherein Asn (N) in position 302 has been replaced by Ala (A) and Thr (T) in position 175 has been replaced by Ala (A) and Glu (E) in position 248 has been replaced by Ala (A).
13. The monovalent antibody according to claim 2, wherein the antigen is selected from VEGF, c-Met, CD20, CD38, IL-8, CD25, CD74, FcalphaRI, FcepsilonRI, acetyl choline receptor, fas, fasL, TRAIL, hepatitis virus, hepatitis C virus, envelope E2 of hepatitis C virus, tissue factor, a complex of tissue factor and Factor VII, EGFr, CD4, and CD28.
14. The monovalent antibody according to claim 2, wherein the C.sub.H3 region has been modified so that Phe (F) in position 273 has been replaced by Thr (T).
15. The monovalent antibody according to claim 2, wherein the C.sub.H3 region has been modified so that Phe (F) in position 273 has been replaced by Asp (D).
16. The monovalent antibody according to claim 2, wherein the C.sub.H3 region has been modified so that Tyr (Y) in position 275 has been replaced by Glu (E).
17. The monovalent antibody according to claim 1, wherein the C.sub.H3 region has been modified so that Phe (F) in position 273 has been replaced by Thr (T).
18. The monovalent antibody according to claim 1, wherein the C.sub.H3 region has been modified so that Phe (F) in position 273 has been replaced by Asp (D).
19. The monovalent antibody according to claim 1, wherein the C.sub.H3 region has been modified so that Tyr (Y) in position 275 has been replaced by Glu (E).
20. The monovalent antibody according to claim 1, wherein the C.sub.H3 region has been modified so that Tyr (Y) in position 275 has been replaced by Ala (A).
21. The monovalent antibody according to claim 1, wherein the C.sub.H3 region has been modified so Leu (L) in position 236 has been replaced by Ala (A), Val (V), Leu (L) or Gly (G).
22. The monovalent antibody according to claim 7, but wherein Phe (F) in position 273 has been replaced by Thr (T) and Tyr (Y) in position 275 has been replaced by Glu (E).
23. The monovalent antibody according to claim 2, but wherein Phe (F) in position 273 has been replaced by Asp (D) and/or Tyr (Y) in position 275 has been replaced by Glu (E).
24. The monovalent antibody according to claim 23, but wherein Phe (F) in position 273 has been replaced by Asp (D) and Tyr (Y) in position 275 has been replaced by Glu (E).
Description
DESCRIPTION OF FIGURES
(1)
(2) Lane 1: Marker SeuBlue plus2 prestained (Invitrogen By, The Netherlands), Lane 2: internal control, Lane 3: 7D8-IgG1, Lane 4: 7D8-IgG4, and Lane 5: 7D8-HG.
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11) Lane 1: Marker SeaBlue plus2 prestained (Invitrogen By, The Netherlands), lane 2: internal control, lane 3: BetV1-HG, lane 4: IgG1 control.
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19) This experiment indicates that the Fc-part has a favorable effect on the plasma residence time in mice having a normal immune system and provides an indication of a functional interaction with the neonatal Fc receptor (FcRn) also in the presence of endogenous IgG.
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
(37)
(38)
(39)
(40)
DETAILED DESCRIPTION OF THE SEQUENCE LISTINGS
(41) SEQ ID No: 1: The nucleic acid sequence of C.sub.L kappa of human Ig SEQ ID No: 2: The amino acid sequence of the kappa light chain of human Ig SEQ ID No: 3: The nucleic acid sequence of C.sub.L lambda of human Ig SEQ ID No: 4: The amino acid sequence of the lambda light chain of human Ig SEQ ID No: 5: The nucleic acid sequence of the V.sub.H region of HuMab-7D8 SEQ ID No: 6: The amino acid sequence of the V.sub.H region of HuMab-7D8 SEQ ID No: 7: The nucleic acid sequence of the V.sub.H region of mouse anti-Betv-1 SEQ ID No: 8: The amino acid sequence for the V.sub.H region of mouse anti-Betv-1 SEQ ID No: 9: The nucleic acid sequence of the V.sub.L region of HuMab-7D8 SEQ ID No: 10: The amino acid sequence of the V.sub.L region of HuMab-7D8 SEQ ID No: 11: The nucleic acid sequence of the V.sub.L region of mouse anti-Betv1 SEQ ID No: 12: The amino acid sequence of the V.sub.L region of mouse anti-Betv1 SEQ ID No: 13: The nucleic acid sequence of the wildtype C.sub.H region of human IgG4 SEQ ID No: 14: The amino acid sequence of the wildtype CH region of human IgG4.
(42) Sequences in italics represent the CH1 region, highlighted sequences represent the hinge region, regular sequences represent the CH2 region and underlined sequences represent the CH3 region. SEQ ID No: 15: The nucleic acid sequence of the CH region of human IgG4 (SEQ ID No: 13) mutated in positions 714 and 722 SEQ ID No: 16: The amino acid sequence of the hingeless CH region of a human IgG4 SEQ ID NO: 17: The amino acid sequence of the lambda chain constant human (accession number S25751) SEQ ID NO: 18: The amino acid sequence of the kappa chain constant human (accession number P01834) SEQ ID NO: 19: The amino acid sequence of IgG1 constant region (accession number P01857). Sequences in italics represent the CH1 region, highlighted sequences represent the hinge region, regular sequences represent the CH2 region and underlined sequences represent the CH3 region SEQ ID NO: 20: The amino acid sequence of the IgG2 constant region (accession number P01859). Sequences in italics represent the CH1 region, highlighted sequences represent the hinge region, regular sequences represent the CH2 region and underlined sequences represent the CH3 region SEQ ID NO: 21: The amino acid sequence of the IgG3 constant region (accession number A23511). Sequences in italics represent the CH1 region, highlighted sequences represent the hinge region, regular sequences represent the CH2 region and underlined sequences represent the CH3 region SEQ ID NOs: 22 to 53 show oligonucleotide primers used for preparation of DNA constructs SEQ ID NO: 54: A peptide of a hingeless IgG4 SEQ ID NO: 55: A portion of the constant region of IgG4 SEQ ID NO: 56: A portion of the constant region of a hingeless IgG4
DETAILED DESCRIPTION OF THE INVENTION
(43) The term antibody as referred to herein includes whole antibody molecules, antigen binding fragments, monovalent antibodies, and single chains thereof. Antibody molecules belong to a family of plasma proteins called immunoglobulins, whose basic building block, the immunoglobulin fold or domain, is used in various forms in many molecules of the immune system and other biological recognition systems. Native antibodies and immunoglobulins are usually heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies between the heavy chains of different immunoglobulin isotypes. Each heavy and light chain may also have regularly spaced intrachain disulfide bridges. Each light chain is comprised of a light chain variable region (abbreviated herein as V.sub.L) and a light chain constant region (abbreviated herein as C.sub.L). Each heavy chain is comprised of a heavy chain variable region (V.sub.H) and a heavy chain constant region (C.sub.H) consisting of three domains, C.sub.H1, C.sub.H2 and C.sub.H3, and the hinge region). The constant domain of the light chain is aligned with the first constant domain (C.sub.H1) of the heavy chain, and the light chain variable domain is aligned with the variable domain of the heavy chain forming what is known as the Fab fragment. C.sub.H1 and C.sub.H2 of the heavy chain are separated form each other by the so-called hinge region, which allows the Fab arms of the antibody molecule to swing to some degree. The hinge region normally comprises one or more cysteine residues, which are capable of forming disulphide bridges with the cysteine residues of the hinge region of the other heavy chain in the antibody molecule. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (for instance effector cells) and the first component (C1q) of the classical complement system
(44) Depending on the amino acid sequences of the constant domain of their heavy chains, immunoglobulins can be assigned to different classes. There are at least five (5) major classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, and several of these may be further divided into subclasses (isotypes), for instance IgG1, IgG2, IgG3 and IgG4; IgA1 and IgA2. The genes for the heavy chains constant domains that correspond to the different classes of immunoglobulins are called alpha (), delta (), epsilon (), gamma () and mu (), respectively. Immunoglobulin subclasses are encoded by different genes such as 1, 2, 3 and 4. The genes for the light chains of antibodies are assigned to one of two clearly distinct types, called kappa () and lambda (), based on the amino sequences of their constant domain. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known. Distinct allotypes of immunoglobulins exist within the human population such as G1m(a), G1m(x), G1m(f) and G1m(z) for IgG1 heavy chain and Km1, Km1,2 and Km3 for the kappa light chain. These allotypes differ at distinct amino acids in their region encoding the constant regions.
(45) The term human antibody, as used herein, is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences. The human antibodies of the invention may include amino acid residues not encoded by human germline immunoglobulin sequences (for instance mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo). However, the term human antibody, as used herein, is not intended to include antibodies in which CDR1 or CDR2 sequences derived from the germline of another mammalian species, such as a mouse, or the CDR3 region derived from an antibody from another species, such as mouse, have been grafted onto human framework sequences.
(46) The term K.sub.D (M), as used herein, refers to the dissociation equilibrium constant of a particular antibody-antigen interaction.
(47) The terms monoclonal antibody or monoclonal antibody composition as used herein refer to a preparation of antibody molecules of single molecular composition. A monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope. Accordingly, the term human monoclonal antibody refers to antibodies displaying a single binding specificity which have variable and constant regions derived from human germline immunoglobulin sequences.
(48) The term nucleic acid, nucleic acid construct or nucleic acid molecule, as used herein, is intended to include DNA molecules and RNA molecules. A nucleic acid molecule may be single-stranded or double-stranded.
(49) A nucleic acid is operably linked when it is placed into a functional relationship with another nucleic acid sequence. For instance, a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence. For switch sequences, operably linked indicates that the sequences are capable of effecting switch recombination.
(50) When reference is made to physiological condition it is meant a condition that exists in vivo, within the organism, or an in vivo condition which is recreated by fully or partially mimicking said in vivo condition, for example a water solution with an equivalent osmotic value as the blood.
(51) The term recombinant human antibody, as used herein, includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as for instance (a) antibodies isolated from an animal (for instance a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom, (b) antibodies isolated from a host cell transformed to express the antibody, for instance from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial human antibody library, and (d) antibodies prepared, expressed, created or isolated by any other means that involve splicing of human immunoglobulin gene sequences to other DNA sequences. Such recombinant human antibodies have variable and constant regions derived from human germline immunoglobulin sequences. Such recombinant human antibodies may be subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the V.sub.H and V.sub.L regions of the recombinant antibodies are sequences that, while derived from and related to human germline V.sub.H and V.sub.L sequences, may not naturally exist within the human antibody germline repertoire in vivo.
(52) As used herein, specific binding refers to the binding of an antibody, or antigen-binding fragment thereof, to a predetermined antigen. Typically, the antibody binds with an affinity corresponding to a K.sub.D of about 10.sup.7 M or less, such as about 10.sup.8 M or less, such as about 10.sup.9 M or less, about 10.sup.10 M or less, or about 10.sup.11M or even less, when measured for instance using sulfon plasmon resonance on BIAcore or as apparent affinities based on IC.sub.50 values in FACS or ELISA, and binds to the predetermined antigen with an affinity corresponding to a K.sub.D that is at least ten-fold lower, such as at least 100 fold lower, for instance at least 1000 fold lower, such as at least 10,000 fold lower, for instance at least 100,000 fold lower than its affinity for binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely-related antigen. The amount with which the affinity is lower is dependent on the K.sub.D of the antigen binding peptide, so that when the K.sub.D of the antigen binding peptide is very low (that is, the antigen binding peptide is highly specific), then the amount with which the affinity for the antigen is lower than the affinity for a non-specific antigen may be at least 10,000 fold.
(53) The terms non-human transgenic animal refers to a non-human animal having a genome comprising one or more human heavy and/or light chain transgenes or transchromosomes and which is capable of expressing human antibodies. For example, a transgenic mouse can have a human light chain transgene and either a human heavy chain transgene or human heavy chain transchromosome, such that the mouse produces human antibodies when immunized with an antigen and/or cells expressing an antigen. The human heavy chain transgene is can be integrated into the chromosomal DNA of the mouse, as is the case for transgenic, for instance HuMAb mice, such as HCo7 or HCo12 mice, or the human heavy chain transgene can be maintained extrachromosomally, as is the case for transchromosomal a KM-Mouse as described in WO 02/43478. Such transgenic and transchromosomal mice are capable of producing multiple isotypes of human monovalent antibodies binding to selected antigens (e.g., IgG, IgA and/or IgE) by undergoing V-D-J recombination and isotype switching.
(54) The KM-Mouse contains a human heavy chain transchromosome and a human kappa light chain transgene. The endogenous mouse heavy and light chain genes also have been disrupted in the KM-Mouse such that immunization of the mice leads to production of human immunoglobulins rather than mouse immunoglobulins.
(55) The HuMAb mouse contains a human immunoglobulin gene miniloci that encodes unrearranged human heavy ( and ) and light chain immunoglobulin sequences, together with targeted mutations that inactivate the endogenous and chain loci (Lonberg, N. et al. (1994) Nature 368 (6474): 856-859). Accordingly, the mice exhibit reduced expression of mouse IgM or and in response to immunization, the introduced human heavy and light chain transgenes, undergo class switching and somatic mutation to generate high affinity human IgG monoclonal antibodies (Lonberg, N. et al. (1994), supra; reviewed in Lonberg, N. (1994) Handbook of Experimental Pharmacology 113:49-101; Lonberg, N. and Huszar, D. (1995) Intern. Rev. Immunol. Vol. 13: 65-93, and Harding, F. and Lonberg, N. (1995) Ann. N.Y. Acad. Sci 764: 536-546). The preparation of HuMAb mice is described in detail in Taylor, L. etal. (1992) Nucleic Acids Research 20:6287-6295; Chen, J. et al. (1993) International Immunology 5: 647-656; Tuaillon etal. (1994) J. Immuno!. 152:2912-2920; Lonberg etal., (1994) Nature 368(6474): 856-859; Lonberg, N. (1994) Handbook of Experimental Pharmacology 113:49-101; Taylor, L. etal. (1994) International Immunology 6:579-591; Lonberg, N. and Huszar, D. (1995) Intern. Rev. Immunol. Vol. 13:65-93; Harding, F. and Lonberg, N. (1995) Ann. N.Y. Acad. Sci 764:536-546; Fishwild, D. et al. (1996) Nature Biotechnology 14:845-851. See further, U.S. Pat. Nos. 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,789,650; 5,877,397; 5,661,016; 5,814,318; 5,874,299; and 5,770,429; all to Lonberg and Kay, as well as U.S. Pat. No. 5,545,807 to Surani etal.; WO 98/24884, WO 94/25585, WO 93/1227, WO 92/22645, WO 92/03918 and WO 01/09187.
(56) XenoMouse Technology comprising transgenic mice capable of making fully human antibodies comprising Kappa light chain is described in U.S. Pat. No. 5,939,598. Abgenix in WO2003047336 (hereby incorporated by reference), presented a further version of their
(57) XenoMouse Technology, which relates to transgenic animals which bear one or more human lambda light chain loci in addition to the kappa light chain loci. These transgenic animals comprise a substantially complete human lambda light chain locus comprising V, J, and constant region genes, or a portion of said human lambda light chain locus, wherein said portion comprises at least 500 kb of said human lambda light chain locus.
(58) Further methods for producing transgenic animals have been described in Animal Transgenesis and Cloning (2003) Louise-Marie Houdebine. John Wiley & Sons, Ltd., and in WO02/12437.
(59) The term valence of an antibody means the maximum number of antigenic determinates with which the antibody can react. For example IgG antibodies contain two Fab regions and can bind two molecules of antigen or two identical sites on the same particle, and thus have a valence of two.
(60) The term monovalent antibody means in the present context that an antibody molecule at most contains one Fab region and normally is capable of binding a single molecule of the antigen only, and thus is not able of antigen crosslinking.
(61) The term vector, as used herein, is intended to refer to a nucleic acid molecule capable of transporting and inducing replication of another nucleic acid to which it has been linked. One type of vector is a plasmid, which refers to a circular double stranded DNA loop into which additional DNA segments may be ligated. Another type of vector is a viral vector, wherein additional DNA or RNA segments may be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (for instance bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (for instance non-episomal mammalian vectors) can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as recombinant expression vectors (or simply, expression vectors). In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, plasmid and vector may be used interchangeably as the plasmid is the most commonly used form of vector. However, the invention is intended to include such other forms of expression vectors, such as viral vectors (for instance replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
(62) Five different classes of immunoglobulins exist, i.e. IgM, IgD, IgG, IgA and IgE, and these classes can be distinguished by their C regions.
(63) Within the IgG class of antibodies several subclasses exist, i.e. in human IgG1, IgG2, IgG3, and IgG4 (Jefferis, R. 1990. Molecular structure of human IgG subclasses. In The human IgG subclasses. F. Shakib, ed. Pergamon Press, Oxford, p. 15). Each IgG heavy chain is composed of structurally related peptide sequences (i.e. variable and constant region domains) that are encoded by distinct gene segments or exons. The hinge region linking the CH1 and CH2 domain is encoded by a separate exon. Each of the four IgG subclass heavy chains may be expressed in combination with either kappa or lambda light chains to give an essentially symmetrical molecule composed of two identical heavy chains and two identical kappa or lambda light chains. Comparison within the heavy chain defines the CH1, CH2 and CH3 homology regions. Comparisons between like homology regions of each of the four subclasses reveals >95% sequence identity (Jefferis, R. 1990. F. Shakib, ed. Pergamon Press, Oxford, p. 15). The sequence between the CH1 and CH2 domains is referred to as the hinge region because it allows molecular flexibility. The CH3 domains are paired and the non-covalent interactions are sufficient for the IgG molecule to maintain its structural integrity following reduction of the inter-heavy chain disulphide bridges under mild conditions. CH3 domain pairing is compact and similar to pairing in the Fab, with a nearly exact dyad between the two domains (Saphire, et al., 2002. J Mol Biol 319:9). This is in contrast to the CH2 domains, which do not associate closely and their contact is primarily mediated by the two carbohydrate chains attached to the Asn297 residues (Saphire, et al., 2002. J Mol Biol 319:9).
(64) The characteristic IgG structure in which two heavy-light chain heterodimers are linked is thus maintained by the inter-heavy chain disulphide bridges of the hinge region and the non-covalent interactions of the CH3 domains.
(65) The interaction in the CH3 region has shown to be important in IgG1. Ig half-molecules, which have a dimeric configuration consisting of only one light chain and only one heavy chain, have been described as the result of rare deletions in human and murine plasmacytomas. Several patients suffering from extramedullary soft-tissue plasmacytoma, Waldenstrm macroglobulinemia, plasma cell leukemia and multiple myeloma, excreted IgG half molecules into their urine. Half-molecules were also found to be present in their serum. Studies on the biochemical nature of these half-molecules showed that they consist of IgG1 molecules in which the heavy chain C.sub.H1, hinge and C.sub.H2 regions appeared normal, whereas deletions were found in the C.sub.H3 region.
(66) We show in this application that removal of the hinge region in IgG4 results in the formation of monovalent antibodies in which the linkage between the two heavy-light chain heterodimers is lost or diminished. Consequently, changes in hinge region disulphide bridges of other IgG subclasses alone or in combination with mutations in the CH3 domain interactions may result in the formation of monovalent antibodies for these other subclasses as well.
(67) The monovalent human antibodies produced by the non-human transgenic animals of the present invention have the advantage of having a long half-life in vivo, leading to a longer therapeutic window, as compared to e.g. a Fab fragment of the same antibody which has a considerably shorter half-life in vivo.
(68) These antibodies are suitable for therapeutic applications, wherein blocking of an antigen-mediated activity requires monovalent antibody binding (absence of cross-linking).
(69) In a first main aspect, the invention relates to a non-human transgenic animal, which upon antigenic stimulation is capable of producing a monovalent antibody binding to a selected antigen, which monovalent antibody comprises a heavy chain, which heavy chain comprises (i) a human V.sub.H region, and (ii) a human C.sub.H region, wherein the C.sub.H region has been modified such that the region corresponding to the hinge region and, optionally other regions of the C.sub.H region, such as the C.sub.H3 region, do not comprise any amino acid residues, which are capable of forming disulfide bonds with an identical C.sub.H region or other covalent or stable non-covalent inter-heavy chain bonds with an identical C.sub.H region in the presence of polyclonal human IgG.
(70) Said optional modification of other regions of the C.sub.H region, such as the C.sub.H3 region is most relevant if the C.sub.H region is of a non-IgG4 isotype, such as an IgG1, IgG2 or IgG3 isotype, because in these other isotypes, inter-heavy chain bonds, in particular non-covalent bonds could potentially keep the antibody in a divalent form, even in the absence of cysteines in the hinge region.
(71) The non-human transgenic animals according to the present invention have not been modified in a way that is likely to cause them suffering without any substantial medical benefit to man or animal.
(72) In one embodiment, the non-human transgenic animal of the invention is capable of producing a monovalent antibody, which further comprises a light chain, which light chain comprises (i) a human V.sub.L region, and (ii) a human C.sub.L region, which optionally has been modified such that the C.sub.L region does not contain any amino acids, which are capable of forming disulfide bonds with an identical C.sub.L region or other covalent bonds with an identical C.sub.L region in the presence of polyclonal human IgG.
(73) Said optional modification of the C.sub.L region is most relevant if the C.sub.H region is of the IgG1 isotype, because in an IgG1, a free cysteine residue of the light chain could potentially keep the antibody in a divalent form, even in the absence of cysteines in the hinge region.
(74) In a further embodiment, the non-human transgenic animal comprises in its genome a heavy chain transgene comprising, in operable linkage, (i) a plurality of human V genes, a plurality of human D genes, a plurality of human J genes, (ii) a plurality of human C.sub.H genes and associated isotype switch sequences, comprising a human C.sub.H gene and at least one modified C.sub.H gene,
wherein the transgene undergoes productive VDJ rearrangement and isotype switching in the lymphocytes of the animal. (modified herein above refers to the hinge and optional other C.sub.H modifications defined above in the main first aspect of the invention).
(75) In an even further embodiment, the non-human transgenic animal comprises a light chain transgene comprising (i) a plurality of human V genes, a plurality of human J genes, and (ii) a human C.sub.L gene, which optionally, in particular if the C.sub.H region is of the IgG1 isotype, contains the modification as defined above.
(76) In an even further embodiment, the non-human transgenic animal comprises a light chain transgene comprising (i) a plurality of human V genes, at least one human J gene, and (ii) at least one human C.sub.L gene, which optionally, in particular if the C.sub.H region is of the IgG1 isotype, contains the modification as defined above.
(77) In a further main aspect, the invention relates to a non-human transgenic animal, which upon antigenic stimulation is capable of producing a monovalent IgG4 antibody binding to a selected antigen, which monovalent antibody comprises a heavy chain, which heavy chain comprises (i) a human V.sub.H region, and (ii) a human C.sub.H region, wherein the C.sub.H region has been modified such that the region corresponding to the hinge region does not comprise any amino acid residues, which are capable of forming disulfide bonds with an identical C.sub.H region, and a light chain, which light chain comprises (i) a human V.sub.L region, and (ii) a human C.sub.L region.
(78) In one embodiment hereof, the animal comprises in its genome, (i) a heavy chain transgene comprising, in operable linkage, a plurality of human V genes, a plurality of human D genes, a plurality of human J genes, and a plurality of human C.sub.H genes and associated isotype switch sequences, comprising a human C.sub.H gene and at least one hinge modified C4 gene, and (iia) a light chain transgene comprising, in operable linkage, a plurality of human V genes, a plurality of human J genes, and a human C.sub.L gene, and/or (iib) a light chain transgene comprising, in operable linkage, a plurality of human V genes, at least one human J gene, and at least one human C.sub.L gene,
wherein the transgene undergoes productive V(D)J rearrangement and isotype switching in the lymphocytes of the animal.
(79) In a further main aspect, the invention relates to a non-human transgenic animal, which upon antigenic stimulation is capable of producing a monovalent IgG4 antibody binding to a selected antigen, which monovalent antibody comprises a heavy chain, which heavy chain comprises (i) a human V.sub.H region, and (ii) a human C.sub.H region, wherein the C.sub.H region has been modified such that the region corresponding to the hinge region does not comprise any amino acid residues which are capable of forming disulfide bonds with an identical C.sub.H region, and wherein the C.sub.H3 region has the sequence as set forth in SEQ ID NO: 16, but wherein the C.sub.H3 region has been modified so that one or more of the following amino acid substitutions have been made: Thr (T) in position 234 has been replaced by Ala (A); Leu (L) in position 236 has been replaced by Ala (A); Leu (L) in position 236 has been replaced by Val (V); Phe (F) in position 273 has been replaced by Ala (A); Phe (F) in position 273 has been replaced by Leu (L); Tyr (Y) in position 275 has been replaced by Ala (A); Arg (R) in position 277 has been replaced by Ala (A), and a light chain, which light chain comprises (i) a human V.sub.L region, and (ii) a human C.sub.L region.
(80) In one embodiment hereof, the animal comprises in its genome, (i) a heavy chain transgene comprising, in operable linkage, a plurality of human V genes, a plurality of human D genes, a plurality of human J genes, and a plurality of human C.sub.H genes and associated isotype switch sequences, comprising a human C.sub.H gene and at least one modified C4 gene, and (iia) a light chain transgene comprising, in operable linkage, a plurality of human V genes, a plurality of human J genes, and a human C.sub.L gene, and/or (iib) a light chain transgene comprising, in operable linkage, a plurality of human V genes, at least one human J gene, and at least one human C.sub.L gene,
wherein the transgene undergoes productive V(D)J rearrangement and isotype switching in the lymphocytes of the animal.
(81) In a further main aspect, the invention relates to a non-human transgenic animal, which upon antigenic stimulation is capable of producing a monovalent IgG1 antibody binding to a selected antigen, which monovalent antibody comprises a heavy chain, which heavy chain comprises (i) a human V.sub.H region, and (ii) a human C.sub.H region, wherein the C.sub.H region has been modified such that the region corresponding to the hinge region and the C.sub.H3 region, do not comprise any amino acid residues, which are capable of forming disulfide bonds with an identical C.sub.H region or other covalent or stable non-covalent inter-heavy chain bonds with an identical C.sub.H region in the presence of polyclonal human IgG, and a light chain, which light chain comprises (i) a human V.sub.L region, and (ii) a human C.sub.L region, which has been modified such that the C.sub.L region does not contain any amino acids, which are capable of forming disulfide bonds with an identical C.sub.L region or other covalent bonds with an identical C.sub.L region in the presence of polyclonal human IgG.
(82) In one embodiment hereof, the animal comprises in its genome, (i) a heavy chain transgene comprising, in operable linkage, a plurality of human V genes, a plurality of human D genes, a plurality of human J genes, and a plurality of human C.sub.H genes and associated isotype switch sequences, comprising a human C.sub.H gene and at least one modified C1 gene, and (iia) a light chain transgene comprising, in operable linkage, a plurality of human V genes, a plurality of human J genes, and a modified human C.sub.L gene, and/or (iib) a light chain transgene comprising, in operable linkage, a plurality of human V genes, at least one human J gene, and at least one modified human C.sub.L gene,
wherein the transgene undergoes productive V(D)J rearrangement and isotype switching in the lymphocytes of the animal.
(83) In a further embodiment hereof, the animal is further capable of producing an IgG4 monovalent antibody as defined herein.
(84) In another embodiment of the non-human transgenic animal according to invention, the endogenous animal immunoglobulin heavy chain gene locus has been inactivated. Alternatively, or in addition, the endogenous animal immunoglobulin light chain gene locus and/or the endogenous animal immunoglobulin light chain gene locus has been
(85) In another embodiment of the non-human transgenic animal according to invention, the human C.sub.H gene is in closer proximity to the human C.sub.H gene than in a naturally occurring human immunoglobulin heavy chain gene locus.
(86) In one embodiment of the non-human transgenic animal according the invention, the heavy chain transgene encodes a C.sub.H region of the IgG1 isotype comprising the C.sub.H3 region as set as set forth in SEQ ID NO: 19, but wherein the C.sub.H3 region has been modified so that one or more of the following amino acid substitutions have been made: Arg (R) in position 238 has been replaced by Gln (Q); Asp (D) in position 239 has been replaced by Glu (E); Thr (T) in position 249 has been replaced by Ala (A); Leu (L) in position 251 has been replaced by Ala (A); Leu (L) in position 251 has been replaced by Val (V); Phe (F) in position 288 has been replaced by Ala (A); Phe (F) in position 288 has been replaced by Leu (L); Tyr (Y) in position 290 has been replaced by Ala (A); Lys (K) in position 292 has been replaced by Arg (R); Lys (K) in position 292 has been replaced by Ala (A); Gln (Q) in position 302 has been replaced by Glu (E); and Pro (P) in position 328 has been replaced by Leu (L).
(87) In a further embodiment hereof, one or more of the following amino acid substitutions have been made: Arg (R) in position 238 has been replaced by Gln (Q); Asp (D) in position 239 has been replaced by Glu (E); Lys (K) in position 292 has been replaced by Arg (R); Gln (Q) in position 302 has been replaced by Glu (E); and Pro (P) in position 328 has been replaced by Leu (L).
(88) In an even further embodiment hereof, (i) Arg (R) in position 238 has been replaced by Gln (Q), (ii) Arg (R) in position 238 has been replaced by Gln (Q), and Pro (P) in position 328 has been replaced by Leu (L), or (iii) all 9 amino acids mentioned above have been substituted.
(89) In another further embodiment, the heavy chain transgene further encodes the C.sub.H1 and/or C.sub.H2 regions as set forth in SEQ ID NO: 19.
(90) In yet another further embodiment, the light chain transgene encodes the kappa C.sub.L region having the amino acid sequence as set forth in SEQ ID NO: 18, but wherein the sequence has been modified so that the terminal cysteine residue in position 106 has been replaced with another amino acid residue or has been deleted.
(91) In a different further embodiment, the light chain transgene encodes the lambda C.sub.L region having the amino acid sequence as set forth in SEQ ID NO: 17, but wherein the sequence has been modified so that the cysteine residue in position 104 has been replaced
(92) In an even further different embodiment, the heavy chain transgene further encodes the C.sub.H1 region as set forth in SEQ ID NO: 19, but wherein the C.sub.H1 region has been modified so that Ser (S) in position 14 has been replaced by a cysteine residue.
(93) In one embodiment of the non-human transgenic animal according the invention, the heavy chain transgene encodes a C.sub.H region of the IgG2 isotype comprising the C.sub.H3 region as set forth in SEQ ID NO: 20, but wherein the C.sub.H3 region has been modified so that one or more of the of the following amino acid substitutions have been made: Arg (R) in position 234 has been replaced by Gln (Q); Thr (T) in position 245 has been replaced by Ala (A); Leu (L) in position 247 has been replaced by Ala (A); Leu (L) in position 247 has been replaced by Val (V); Met (M) in position 276 has been replaced by Val (V); Phe (F) in position 284 has been replaced by Ala (A); Phe (F) in position 284 has been replaced by Leu (L); Tyr (Y) in position 286 has been replaced by Ala (A); Lys (K) in position 288 has been replaced by Arg (R); Lys (K) in position 288 has been replaced by Ala (A); Gln (Q) in position 298 has been replaced by Glu (E); and Pro (P) in position 324 has been replaced by Leu (L).
(94) In a further embodiment hereof, the heavy chain transgene further encodes the C.sub.H1 and/or C.sub.H2 regions as set forth in SEQ ID NO: 20.
(95) In one embodiment of the non-human transgenic animal according the invention, the heavy chain transgene encodes a C.sub.H region of the IgG3 isotype comprising the C.sub.H3 region as set forth in SEQ ID NO: 21, but wherein the C.sub.H3 region has been modified so that one or more of the following amino acid substitutions have been made: Arg (R) in position 285 has been replaced by Gln (Q); Thr (T) in position 296 has been replaced by Ala (A); Leu (L) in position 298 has been replaced by Ala (A); Leu (L) in position 298 has been replaced by Val (V); Ser (S) in position 314 has been replaced by Asn (N); Asn (N) in position 322 has been replaced by Lys (K); Met (M) in position 327 has been replaced by Val (V); Phe (F) in position 335 has been replaced by Ala (A); Phe (F) in position 335 has been replaced by Leu (L); Tyr (Y) in position 337 has been replaced by Ala (A); Lys (K) in position 339 has been replaced by Arg (R); Lys (K) in position 339 has been replaced by Ala (A); Gln (Q) in position 349 has been replaced by Glu (E); Ile (I) in position 352 has been replaced by Val (V); Arg (R) in position 365 has been replaced by His (H); Phe (F) in position 366 has been replaced by Tyr (Y); and Pro (P) in position 375 has been replaced by Leu (L).
(96) In a further embodiment hereof, the heavy chain transgene further encodes the C.sub.H1 and/or C.sub.H2 regions as set forth in SEQ ID NO: 21.
(97) The hinge region is a region of an antibody situated between the C.sub.H1 and C.sub.H2 regions of the constant domain of the heavy chain. The extent of the hinge region is determined by the separate exon, which encodes the hinge region. The hinge region is normally involved in participating in ensuring the correct assembly of the four peptide chains of an antibody into the traditional tetrameric form via the formation of disulphide bonds, or bridges, between one or more cysteine residues in the hinge region of one of the heavy chains and one or more cysteine residues in the hinge region of the other heavy chain. A modification of the hinge region so that none of the amino acid residues in the hinge region are capable of participating in the formation of disulphide bonds may thus for instance comprise the deletion and/or substitution of the cysteine residues present in the unmodified hinge region. A region corresponding to the hinge region should for the purpose of this specification be construed to mean the region between region C.sub.H1 and C.sub.H2 of a heavy chain of an antibody. In the context of the present invention, such a region may also comprise no amino acid residues at all, corresponding to a deletion of the hinge region, resulting in the C.sub.H1 and C.sub.H2 regions being connected to each other without any intervening amino acid residues. Such a region may also comprise only one or a few amino acid residues, which residues need not be the amino acid residues present in the N- or C-terminal of the original hinge region.
(98) In a further embodiment of any of the above mentioned non-human transgenic animals, the heavy chain transgene encodes a C.sub.H region, which has been modified such that the region corresponding to the hinge region of the C.sub.H region does not comprise any cysteine residues.
(99) In another embodiment, the heavy chain transgene encodes a C.sub.H region, which has been modified such that the amino acids corresponding to the amino acids 106 and 109 of the C.sub.H sequence of SEQ ID No: 14 have been deleted.
(100) In another embodiment, the heavy chain transgene encodes a C.sub.H region, which has been modified such that one of the amino acid residues corresponding to amino acids 106 and 109 of the C.sub.H sequence of SEQ ID No: 14 has been substituted with an amino acid residue different from cysteine, and the other of the amino acid residues corresponding to amino acid residues 106 and 109 of the sequence of SEQ ID No: 14 has been deleted.
(101) In another embodiment, the heavy chain transgene encodes a C.sub.H region, which has been modified such that the amino acid residue corresponding to amino acid residue 106 has been substituted with an amino acid residue different from cysteine, and the amino acid residue corresponding to amino acid residue 109 has been deleted.
(102) In another embodiment, the heavy chain transgene encodes a C.sub.H region, which has been modified such that the amino acid residue corresponding to amino acid residue 106 has been deleted, and the amino acid residue corresponding to amino acid residue 109 has been substituted with an amino acid residue different from cysteine.
(103) In another embodiment, the heavy chain transgene encodes a C.sub.H region, which has been modified such that at least the amino acid residues corresponding to amino acid residues 106 to 109 of the C.sub.H sequence of SEQ ID No: 14 have been deleted.
(104) In another embodiment, the heavy chain transgene encodes a C.sub.H region, which has been modified such that at least the amino acid residues corresponding to amino acid residues 99 to 110 of the sequence of SEQ ID No: 14 have been deleted.
(105) In another embodiment, the heavy chain transgene encodes a C.sub.H region as set forth in SEQ ID No: 16.
(106) In another embodiment, the heavy chain transgene encodes a C.sub.H region, which has been modified such that the entire hinge region has been deleted.
(107) In a different embodiment of the invention, the transgenic animal does not comprise a human C4 gene.
(108) In another embodiment of the invention, the transgenic animal does not comprise a human C4 gene, which has been modified to delete the sequence encoding the hinge region.
(109) In a further embodiment of the invention, the animal is capable of producing a monovalent antibody which binds to the selected antigen, such as c-Met, with a dissociation constant (k.sub.d) of 10.sup.7 M or less, such as 10.sup.8 M, 10.sup.9 M, 10.sup.10 M or 10.sup.11 M or less.
(110) In one embodiment, the non-human transgenic animal according to the invention is a mammal, such as a camelidae, for example a llama or camel, or a rodent, for example a mouse, rabbit, guinea pig or a rat.
(111) For example, in one embodiment, the animal is a mouse, such as mouse derived from strain C57BL/6J, CBA/J, DBA/2J, 129/sy or SJL/J.
(112) In a further main aspect, the invention relates to a heavy chain transgene comprising (i) a plurality of human V genes, a plurality of human D genes, a plurality of human J genes, (ii) a plurality of human C.sub.H genes and associated isotype switch sequences, comprising a human C.sub.H gene and at least one modified C.sub.H gene, wherein the human C.sub.H gene is in closer proximity to the human C.sub.H gene than in a naturally occurring human immunoglobulin heavy chain gene locus.
(113) A non-limiting example of an embodiment of the transgene of the invention is shown schematically in
(114) A DNA construct comprising the transgene according to the invention may be prepared synthetically by established standard methods, for instance the phosphoamidine method described by Beaucage et al., Tetrahedron Lett. 22, 1859-1869 (1981), or the method described by Matthes et al., EMBO J. 3, 801-805 (1984). According to the phosphoamidine method, oligonucleotides are synthesised, for instance in an automatic DNA synthesizer, purified, annealed, ligated and cloned in suitable vectors.
(115) A DNA sequence encoding the may also be of genomic or cDNA origin, for instance obtained by preparing a genomic or cDNA library and screening for DNA sequences coding for all or part of the antibody by hybridization using synthetic oligonucleotide probes in accordance with standard techniques (cf. Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor, 1989). The DNA sequence may also be prepared by polymerase chain reaction using specific primers, for instance as described in U.S. Pat. No. 4,683,202 or Saiki et al. Science 239, 487-491 (1988).
(116) In another main aspect, the invention relates to a method of producing a monovalent antibody binding to a selected antigen comprising (i) immunizing the animal of the invention with a selected antigen, a cell expressing a selected antigen, or a nucleic acid construct encoding a selected antigen or a combination thereof (ii) obtaining B cells from the transgenic animal expressing monovalent antibodies binding to the selected antigen, (iii) optionally generating hybridomas from said B cells, (iv) testing the monovalent antibodies produced by the B cells or hybridomas for binding to the selected antigen, and (v) identifying one or more monovalent antibodies capable of binding to the selected antigen.
(117) In one embodiment hereof, the method comprises the further steps of (vi) identifying the coding sequences for said monovalent antibodies and (vii) producing said monovalent antibodies in a recombinant expression system.
(118) In another embodiment, said method comprises step (iii) and the further steps of (vi) producing and purifying said monovalent antibodies from the hybridomas.
(119) In one embodiment, the antigen is a human protein molecule. In a preferred embodiment hereof, the antigen is selected from VEGF, c-Met, CD20, CD38, IL-8, CD25, CD74, FcalphaRI, FcepsilonRI, acetyl choline receptor, fas, fasL, TRAIL, hepatitis virus, hepatitis C virus, envelope E2 of hepatitis C virus, tissue factor, a complex of tissue factor and Factor VII, EGFr, CD4, and CD28.
(120) In a further main aspect, the invention relates to the use of a non-human transgenic animal of the invention as defined herein for generating a monovalent human antibody.
(121) In a further main aspect, the invention relates to a monovalent antibody obtained or obtainable by the method described above.
(122) In one embodiment, the monovalent antibody comprises a heavy chain, which heavy chain comprises (i) a human V.sub.H region, and (ii) a human C.sub.H region, wherein the C.sub.H region has been modified such that the region corresponding to the hinge region does not comprise any amino acid residues which are capable of forming disulfide bonds with an identical C.sub.H region, and wherein the C.sub.H3 region has the sequence as set forth in SEQ ID NO: 16, but wherein the C.sub.H3 region has been modified so that one or more of the following amino acid substitutions have been made: Thr (T) in position 234 has been replaced by Ala (A); Leu (L) in position 236 has been replaced by Ala (A); Leu (L) in position 236 has been replaced by Val (V); Phe (F) in position 273 has been replaced by Ala (A); Phe (F) in position 273 has been replaced by Leu (L); Tyr (Y) in position 275 has been replaced by Ala (A); Arg (R) in position 277 has been replaced by Ala (A), and a light chain, which light chain comprises (i) a human V.sub.L region, and (ii) a human C.sub.L region.
(123) In a further main aspect. the invention relates to a monovalent IgG4 antibody that binds to a selected antigen, which monovalent antibody comprises a heavy chain, which heavy chain comprises (i) a human V.sub.H region, and (ii) a human C.sub.H region, wherein the C.sub.H region has been modified such that the region corresponding to the hinge region does not comprise any amino acid residues which are capable of forming disulfide bonds with an identical C.sub.H region, and wherein the C.sub.H3 region has the sequence as set forth in SEQ ID NO: 16, but wherein the C.sub.H3 region has been modified so that one or more of the following amino acid substitutions have been made: Thr (T) in position 234 has been replaced by Ala (A); Leu (L) in position 236 has been replaced by Ala (A); Leu (L) in position 236 has been replaced by Val (V); Phe (F) in position 273 has been replaced by Ala (A); Phe (F) in position 273 has been replaced by Leu (L); Tyr (Y) in position 275 has been replaced by Ala (A); Arg (R) in position 277 has been replaced by Ala (A), and a light chain, which light chain comprises (i) a human V.sub.L region, and (ii) a human C.sub.L region. This antibody may be obtained from a non-human transgenic animal of the invention or may be produced by recombinant expression techniques well known in the art.
(124) In one embodiment, the monovalent antibody comprises the CH3 region as set forth in SEQ ID NO: 16.
(125) In another embodiment, the monovalent antibody comprises the CH3 region as set forth in SEQ ID NO: 16, but Glu (E) in position 225 has been replaced by Ala (A).
(126) In another embodiment, the monovalent antibody comprises the CH3 region as set forth in SEQ ID NO: 16, but Thr (T) in position 234 has been replaced by Ala (A).
(127) In another embodiment, the monovalent antibody comprises the CH3 region as set forth in SEQ ID NO: 16, but Leu (L) in position 236 has been replaced by Ala (A).
(128) In another embodiment, the monovalent antibody comprises the CH3 region as set forth in SEQ ID NO: 16, but Leu (L) in position 236 has been replaced by Val (V).
(129) In another embodiment, the monovalent antibody comprises the CH3 region as set forth in SEQ ID NO: 16, but Leu (L) in position 236 has been replaced by Glu (E).
(130) In another embodiment, the monovalent antibody comprises the CH3 region as set forth in SEQ ID NO: 16, but Leu (L) in position 236 has been replaced by Gly (G).
(131) In another embodiment, the monovalent antibody comprises the CH3 region as set forth in SEQ ID NO: 16, but Lys (K) in position 238 has been replaced by Ala (A).
(132) In another embodiment, the monovalent antibody comprises the CH3 region as set forth in SEQ ID NO: 16, but Asp (D) in position 267 has been replaced by Ala (A).
(133) In another embodiment, the monovalent antibody comprises the CH3 region as set forth in SEQ ID NO: 16, but Phe (F) in position 273 has been replaced by Ala (A).
(134) In another embodiment, the monovalent antibody comprises the CH3 region as set forth in SEQ ID NO: 16, but Phe (F) in position 273 has been replaced by Leu (L).
(135) In another embodiment, the monovalent antibody comprises the CH3 region as set forth in SEQ ID NO: 16, but Phe (F) in position 273 has been replaced by Asp (D) and/or Tyr (Y) in position 275 has been replaced by Glu (E).
(136) In another embodiment, the monovalent antibody comprises the CH3 region as set forth in SEQ ID NO: 16, but Phe (F) in position 273 has been replaced by Thr (T) and/or Tyr (Y) in position 275 has been replaced by Glu (E).
(137) In another embodiment, the monovalent antibody comprises the CH3 region as set forth in SEQ ID NO: 16, Tyr (Y) in position 275 has been replaced by Ala (A).
(138) In another embodiment, the monovalent antibody comprises the CH2 region as set forth in SEQ ID NO: 16, but Thr (T) in position 118 has been replaced by Gln (Q) and/or Met (M) in position 296 has been replaced by Leu (L).
(139) In another embodiment, the monovalent antibody comprises the CH2 region as set forth in SEQ ID NO: 16, but one, two or all three of the following substitutions have been made: Met (M) in position 120 has been replaced by Tyr (Y); Ser (S) in position 122 has been replaced by Thr (T); and Thr (T) in position 124 has been replaced by Glu (E).
(140) In another embodiment, the monovalent antibody comprises the CH2 region as set forth in SEQ ID NO: 16, but wherein Asn (N) in position 302 has been replaced by Ala (A).
(141) In another embodiment, the monovalent antibody comprises the CH2 region as set forth in SEQ ID NO: 16, but wherein Asn (N) in position 302 has been replaced by Ala (A) and Thr (T) in position 175 has been replaced by Ala (A) and Glu (E) in position 248 has been replaced by Ala (A).
(142) In a further embodiment, the monovalent antibody comprises two or more of the above mentioned substitutions.
(143) In a further main aspect, the invention relates to method for producing a non-human transgenic animal of the invention, said method comprising (i) introducing into the embryonic stem cells of a non-human animal, a heavy chain transgene construct according to the invention, and optionally a light chain transgene capable of producing a light chain as defined above, (ii) selecting embryonic stem cells expressing the transgene(s), (iii) injecting the transformed embryonic stem cells into the inner mass of a blastocyst, (iv) implanting the blastocysts into the uterus or oviduct of a non-human pseudopregnant female animal, (v) testing the offspring for the presence of the transgene(s), and (vi) mating two heterozygous offspring to produce homozygous transgenic strain of the non-human animal.
(144) In a further main aspect, the invention relates to method for producing a non-human transgenic animal according to the invention, said method comprising (i) injecting into the pronucleus of a fertilized ovum, such as the male pronucleus of a fertilized ovum, of a non-human animal of a vector construct comprising a transgene of the invention, and optionally a light chain transgene capable of producing a light chain as defined herein, (ii) implanting the fertilized ovum into the uterus or the oviduct of a non-human pseudopregnant female animal, (iii) testing the offspring for the presence of the transgene(s), and (iv) mating two heterozygous offspring to produce homozygous transgenic strain of the non-human animal.
(145) An alternative method for producing a non-human transgenic animal of the invention comprises the use of a transgenic animal which is already capable of producing human antibodies, such as a HuMab-Mouse or a Xenomouse. as a starting point for further genetic modification. This may be a more convenient method for producing the non-human transgenic animal of the invention, since instead of having to introduce an entire transgene comprising all coding regions for a human antibody, it may, in some embodiment, be carried out by a mere replacement of the sequences encoding the C region(s) in said animals by equivalent C sequences encoding C.sub.H regions having the modifications described herein.
(146) Accordingly, in a further main aspect, the invention relates to method for producing a non-human transgenic animal according to the invention, said method comprising (i) introducing into the embryonic stem cells of a non-human transgenic animal, which transgenic animal comprises pre-existing transgenic sequences allowing the animal to producing human antibodies, a transgene comprising a sequence which encodes a C.sub.H region or fragment thereof comprising the modifications as defined herein, and, optionally, a transgene comprising a sequence which encodes a C.sub.L region or fragment thereof comprising the modification as defined herein above, said transgene(s) being designed to, upon genomic integration and replacement of the corresponding human C.sub.H region or fragment thereof, and, optionally, corresponding human C.sub.L region or fragment thereof, of the transgenic animal genome become(s) operably linked to the remaining pre-existing transgenic sequences thus allowing the animal to produce monovalent antibodies as defined herein, (ii) selecting embryonic stem cells expressing the transgene(s) introduced in step (i), (iii) injecting the transformed embryonic stem cells into the inner mass of a blastocyst, (iv) implanting the blastocysts into the uterus or oviduct of a non-human pseudopregnant female animal, (v) testing the offspring for the presence of the transgene(s), and (vi) mating two heterozygous offspring to produce homozygous transgenic strain of the non-human animal.
(147) In a further main aspect, the invention relates to method for producing a non-human transgenic animal according to the invention, said method comprising (i) injecting into the pronucleus of a fertilized ovum of a non-human transgenic animal, which transgenic animal comprises pre-existing transgenic sequences allowing the animal to producing human antibodies, a transgene comprising a sequence which encodes a C.sub.H region or fragment thereof comprising the modifications as defined herein, and, optionally, a transgene comprising a sequence which encodes a C.sub.L region or fragment thereof comprising the modification as defined herein above, said transgene(s) being designed to, upon genomic integration and replacement of the corresponding human C.sub.H region or fragment thereof, and, optionally, corresponding human C.sub.L region or fragment thereof, of the transgenic animal genome become(s) operably linked to the remaining pre-existing transgenic sequences thus allowing the animal to produce monovalent antibodies as defined herein, (ii) implanting the fertilized ovum into the uterus or oviduct of a non-human pseudopregnant female animal, (iii) testing the offspring for the presence of the transgene(s) introduced in step (i), and (iv) mating two heterozygous offspring to produce homozygous transgenic strain of the non-human animal. In one embodiment of the above methods, the non-human transgenic animal provided in step (i) is a transgenic mouse, such as a HuMab-Mouse, KM-Mouse, TC-Mouse or a Xenomouse.
(148) In one embodiment, the monovalent antibody produced by the non-human transgenic animal of the invention is monovalent in the presence of physiological concentrations of polyclonal human IgG.
(149) The present invention is further illustrated by the following examples which should not be construed as further limiting.
EXAMPLES
Example 1
(150) Oligonucleotide Primers and PCR Amplification
(151) Oligonucleotide primers were synthesized and quantified by lsogen Bioscience (Maarssen, The Netherlands). Primers were dissolved in H.sub.2O to 100 pmol/l and stored at 20 C. A summary of all PCR and sequencing primers is tabulated (
Example 2
(152) Agarose Gel Electrophoresis
(153) Agarose gel electrophoresis was performed according to Sambrook (Sambrook J. and Russel, D. V. Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor, 2000) using gels of 50 ml, in 1Tris Acetate EDTA buffer. DNA was visualized by the inclusion of ethidium bromide in the gel and observation under UV light. Gel images were recorded by a CCD camera and an image analysis system (GeneGnome; Syngene, via Westburg B.V., Leusden, The Netherlands).
Example 3
(154) Analysis and Purification of PCR Products and Enzymatic Digestion Products
(155) Purification of desired PCR fragments was carried out using a MinElute PCR Purification Kit (Qiagen, via Westburg, Leusden, The Netherlands; product#28006), according to the manufacturer's instructions. Isolated DNA was quantified by UV spectroscopy and the quality was assessed by agarose gel electrophoresis.
(156) Alternatively, PCR or digestion products were separated by agarose gel electrophoresis (for instance when multiple fragments were present) using a 1% Tris Acetate EDTA agarose gel. The desired fragment was excised from the gel and recovered using the QIAEX II Gel Extraction Kit (Qiagen; product#20051), according to the manufacturer's instructions.
Example 4
(157) Quantification of DNA by UV Spectroscopy
(158) Optical density of nucleic acids was determined using a NanoDrop ND-1000 Spectrophotometer (lsogen Life Science, Maarssen, The Netherlands) according to the manufacturer's instructions. The DNA concentration was measured by analysis of the optical density (OD) at 260 nm (one OD.sub.260 nm unit=50 g/ml). For all samples, the buffer in which the nucleic acids were dissolved was used as a reference.
Example 5
(159) Restriction Enzyme Digestions
(160) Restriction enzymes and supplements were obtained from New England Biolabs (Beverly, Mass., USA) or Fermetas (Vilnius, Lithuania) and used according to the manufacturer's instructions.
(161) DNA (100 ng) was digested with 5 units of enzyme(s) in the appropriate buffer in a final volume of 10 l (reaction volumes were scaled up as appropriate). Digestions were incubated at the recommended temperature for a minimum of 60 min. For fragments requiring double digestions with restriction enzymes which involve incompatible buffers or temperature requirements, digestions were performed sequentially. If necessary digestion products were purified by agarose gel electrophoresis and gel extraction.
Example 6
(162) Ligation of DNA Fragments
(163) Ligations of DNA fragments were performed with the Quick Ligation Kit (New England Biolabs) according to the manufacturer's instructions. For each ligation, vector DNA was mixed with approximately three-fold molar excess of insert DNA.
Example 7
(164) Transformation of E. Coli
(165) Plasmid DNA (1-5 l of DNA solution, typically 2 l of DNA ligation mix) was transformed into One Shot DH5-T1.sup.R or MACH-1 T1.sup.R competent E. coli cells (Invitrogen, Breda, The Netherlands; product#12297-016) using the heat-shock method, according to the manufacturer's instructions. Next, cells were plated on Luria-Bertani (LB) agar plates containing 50 g/mlampicillin. Plates were incubated for 16-18 hours at 37 C. until bacterial colonies became evident.
Example 8
(166) Screening of Bacterial Colonies by PCR
(167) Bacterial colonies were screened for the presence of vectors containing the desired sequences via colony PCR using the HotStarTaq Master Mix Kit (Qiagen; product#203445) and the appropriate forward and reverse primers. Selected colonies were lightly touched with a 20 l pipette tip and touched briefly in 2 ml LB for small scale culture, and then resuspended in the PCR mix. PCR was performed with a TGradient Thermocycler 96 using a 35-cycle program: denaturation at 95 C. for 15 min; 35 cycles of 94 C. for 30 sec, 55 C. for 30 sec and 72 C. for 2 min; followed by a final extension step of 10 min at 72 C. If appropriate, the PCR mixtures were stored at 4 C. until analysis by agarose gel electrophoresis.
Example 9
(168) Plasmid DNA Isolation From E. Coli Culture
(169) Plasmid DNA was isolated from E. coli cultures using the following kits from Qiagen (via Westburg, Leusden, The Netherlands), according to the manufacturer's instructions. For bulk plasmid preparation (50-150 ml culture), either a HiSpeed Plasmid Maxi Kit (product#12663) or a HiSpeed Plasmid Midi Kit (product#12643) was used. For small scale plasmid preparation (2 ml culture) a Qiaprep Spin Miniprep Kit (product#27106) was used and DNA was eluted in 50 l elution buffer (supplied with kit).
Example 10
(170) Site-Directed Mutagenesis
(171) Site-directed mutagenesis was performed using the QuickChange II XL Site-Directed Mutagenesis Kit (Stratagene, Amsterdam, The Netherlands) according to the manufacturer's instructions. This method included the introduction of a silent extra Xmal site to screen for successful mutagenesis. Briefly, 5 l 10 reaction buffer, 1 l oligonucleotide IgG4S228Pf (P16) (100 pmol/l), 1 l oligonucleotide IgG4S228Pr (P17)(100 pmol/l), 1 l dNTP mix, 3 l Quicksolution, 1 l plasmid pTomG4Tom7D8 (see example 16) (50 ng/l) and 1 l PfuUltra HF DNA polymerase were mixed in a total volume of 50 l and amplified with a TGradient Thermocycler 96 (Whatman Biometra, Goettingen, Germany; product#050-801) using an 18-cycle program: denaturing at 95 C. for 1 min; 18 cycles of 95 C. for 50 sec, 60 C. for 50 sec, and 68 C. for 10 min. PCR mixtures were stored at 4 C. until further processing. Next, PCR mixtures were incubated with 1 l Dpnl for 60 min at 37 C. to digest the pTomG47D8 vector and stored at 4 C. until further processing. The reaction mixture was precipitated with 5 l sM NaAc and 125 l Ethanol, incubated for 20 minutes at 20 C. and spundown for 20 minutes at 4 C. at 14000g. The DNA pellet was washed with 70% ethanol, dried and dissolved in 4 l water. The total 4 l reaction volume was transformed in One Shot Top 10 competent E. coli cells (Invitrogen, Breda, The Netherlands) according to the manufacturer's instructions (Invitrogen). Next, cells were plated on Luria-Bertani (LB) agar plates containing 50 g/mlampicillin. Plates were incubated for 16-18 hours at 37 C. until bacterial colonies became evident.
Example 11
(172) DNA Sequencing
(173) DNA sequencing was performed using standard techniques.
Example 12
(174) Transient Expression in HEK-293F Cells
(175) Freestyle 293-F (a HEK-293 subclone adapted to suspension growth and chemically defined Freestyle medium, e.g. HEK-293F) cells were obtained from Invitrogen and transfected according to the manufacturer's protocol using 293 fectin (Invitrogen).
Example 13
(176) Construction of pConG1fA77: A Vector for the Production of the Heavy Chain of A77-IgG1
(177) The V.sub.H coding region of the mouse anti-FcRI antibody A77 was amplified from a scFv phage vector, containing the VH and VL coding regions of this antibody, by a double overlap extension PCR. This was used to incorporate a mammalian signal peptide, an ideal Kozak sequence and suitable restriction sites for cloning in pConG1f. The first PCR was done using primers A77VHfor1 and A77VHrev with the scFv phage vector as template. Part of this first PCR was used in a second PCR using primers A77VHfor2 and A77VHrev. The VH fragment was gel purified and cloned into pConG1f0.4. For this the pConG1f0.4 vector and the VH fragment were digested with HindiII and Apal and purified. The V.sub.H fragment and the pConG1f0.4HindIII-Apal digested vector were ligated and transformed into competent DH5-T1.sup.R cells. A clone was selected containing the correct insert size and the sequence was confirmed and was named pConG1fA77.
Example 14
(178) Construction of pConKA77: A Vector for the Production of the Light Chain of A77 Antibodies
(179) The V.sub.L coding region of the mouse anti-FcRI antibody A77 was amplified from a scFv phage vector, containing the VH and VL of this antibody, by a double overlap extension PCR. This was used to incorporate a mammalian signal peptide, an ideal Kozak sequence and suitable restriction sites for cloning in pConKappa0.4. The first PCR was done using primers A77VLfor1 and A77VLrev with the scFv phage vector as template. Part of this first PCR was used in a second PCR using primers A77VLfor2 and A77VLrev. The PCR product and the pConKappa0.4 vector were digested with HindiII and Pf123II and purified. The V.sub.L fragment and the pConKappa0.4HindIII-Pf123II digested vector were ligated and transformed into competent DH5 T1.sup.R E. coli.
(180) A clone was selected containing the correct insert size and the sequence was confirmed. This plasmid was named pConKA77.
Example 15
(181) Construction of pTomG4A77: A Vector for the Production of the Heavy Chain of A77-IgG4
(182) To construct a vector for expression of A77-IgG4, the VH region of A77 was cloned in pTomG4.
(183) For this, pTomG4 and pConG1fA77 were digested with HindiII and Apal and the relevant fragments were isolated.
(184) The A77 V.sub.H fragment and the pTomG4HindIII-Apal digested vector were ligated and transformed into competent DH5-T1.sup.R cells.
(185) A clone was selected containing the correct insert size. This plasmid was named pTomG4A77.
Example 16
(186) Construction of pTomG4A77HG: A Vector for the Production of the Heavy Chain of A77-HG
(187) To make a construct for expression of A77-HG, the VH region of A77 was cloned in pTomG47D8HG, replacing the VH 7D8 region.
(188) For this pTomG47D8HG and pConG1fA77 were digested with HindiII and Apal and the relevant fragments were isolated.
(189) The A77 V.sub.H fragment and the pTomG47D8HGHindIII-Apal digested vector fragment were ligated and transformed into competent DH5-T1.sup.R cells.
(190) A clone was selected containing the correct insert size. This plasmid was named pTomG4A77HG.
Example 17
(191) Construction of pEE6.4A77Fab: A Vector for the Production of the Heavy Chain of A77-Fab
(192) To make a construct for expression of A77-Fab, the VH region of A77 was cloned in pEE6.42F8Fab, replacing the VH 2F8 region.
(193) For this pEE6.42F8Fab and pConG1fA77 were digested with HindiII and Apal and the relevant fragments were isolated.
(194) The A77 V.sub.H fragment and the pEE6.42F8Fab HindIII-Apal digested vector fragment were ligated and transformed into competent DH5-T1.sup.R cells.
(195) A clone was selected containing the correct insert. This plasmid was named pEE6.4A77Fab.
Example 18
(196) Cloning of the Variable Regions of a Human Anti-cMet Antibody
(197) Total RNA was prepared from 110.sup.6 mouse hybridoma cells with the RNeasy kit (Qiagen, Westburg, Leusden, Netherlands) according to the manufacturer's protocol.
(198) 5-RACE-Complementary DNA (cDNA) of RNA was prepared from 60 ng total RNA, using the SMART RACE cDNA Amplification kit (BD Biosciences Clontech, Mountain View, Calif., USA), following the manufacturer's protocol.
(199) The VL and VH regions of the cMet antibody were amplified by PCR. For this PfuTurboe Hotstart DNA polymerase (Stratagene) was used according to the manufacturer's instructions. Each reaction mix contained 5 l 10 BD Advantage 2 PCR buffer (Clontech), 200 M mixed dNTPs (Roche Diagnostics), 12 pmol of the reverse primer (RACEG1A1 for the VH region and RACEKA1 for the VL region), 7.2 pmol UPM-Mix (UPM-Mix: 2M ShortUPMH3 and 0.4 M LongUPMH3 oligonucleotide), 1 l of the 5RACE cDNA template as described above, and 1 l 50BD Advantage 2 polymerase mix (Clontech) in a total volume of 50 l.
(200) PCR reactions were carried out with a TGradient Thermocycler 96 (Whatman Biometra) using a 35-cycle program: denaturing at 95 C. for 1 min; 35 cycles of 95 C. for 30 sec, 68 C. for 60 sec.
(201) The reaction products were separated by agarose gel electrophoresis on a 1% TAE agarose gel and stained with ethidium bromide. Bands of the correct size were cut from the gels and the DNA was isolated from the agarose using the Qiagen Minelute Reaction Cleanup kit (Qiagen).
(202) Gel isolated PCR fragments were cloned into the pCR4Blunt-TOPO vector (Invitrogen) using the Zero Blunt TOPO PCRCloning Kit for Sequencing (Invitrogen), following the manufacturer's protocol. 5 l of the ligation mixture was transformed into OneShot DH5T1R competent E. Coli (Invitrogen) and plated on LB/Ampicillin plates.
(203) From six, insert containing, clones, the V.sub.L sequences were determined and from five, insert containing, clones, the V.sub.H sequences were determined.
Example 19
(204) Construction of pConG1fcMet: A Vector for the Production of the Heavy Chain of cMet-IgG1
(205) The V.sub.H coding region of the human anti-cMet antibody was cut from a plasmid containing this region using HindIII and Apal. The VH fragment was gel purified and cloned into pConG1f0.4. For this pConG1f0.4 vector were digested with HindIII and Apal and purified. The V.sub.H fragment and the pConG1f0.4HindIII-Apal digested vector were ligated and transformed into competent DH5-T1R cells.
(206) A clone was selected containing the correct insert size was isolated and was named pConG1fcMet.
Example 20
(207) Construction of pConKcMet: A Vector for the Production of the Light Chain of cMet Antibodies
(208) The V.sub.L coding region of the human anti-cMet antibody was amplified from a plasmid containing this region using the primers shortUPMH3 and RACEVLBsiWI, introducing suitable restriction sites for cloning into pConK0.4.
(209) The PCR product and the pConKappa0.4 vector were digested with HindIII and Pf123II and purified. The V.sub.L fragment and the pConKappa0.4HindIII-Pf123II digested vector were ligated and transformed into competent DH5T1.sup.R E. coli.
(210) A clone was selected containing the correct insert size and the sequence was confirmed. This plasmid was named pConKcMet.
Example 21
(211) Construction of pTomG4cMet: A Vector for the Production of the Heavy Chain of cMet-IgG4
(212) To construct a vector for expression of cMet-IgG4, the VH region of cMet was cloned in pTomG4.
(213) For this, pTomG42F8 and pConG1fcMet were digested with HindIII and Apal and the relevant fragments were isolated.
(214) The cMet V.sub.H fragment and the pTomG42F8HindIII-Apal digested vector were ligated and transformed into competent DH5-T1 .sup.R cells.
(215) A clone was selected containing the correct insert size. This plasmid was named pTomG4cMet.
Example 22
(216) Construction of pTomG4cMetHG: A Vector for the Production of the Heavy Chain of cMet-HG
(217) To make a construct for expression of cMet-HG, the VH region of cMet was cloned in pTomG42F8HG, replacing the VH 2F8 region.
(218) For this pTomG42F8HG and pConG1fcMet were digested with HindIII and Apal and the relevant fragments were isolated.
(219) The cMet V.sub.H fragment and the pTomG42F8HGHindIII-Apal digested vector fragment were ligated and transformed into competent DH5-T1.sup.R cells.
(220) A clone was selected containing the correct insert size. This plasmid was named pTomG4cMetHG.
Example 23
(221) Construction of pEE6.4cMetFab: A Vector for the Production of the Heavy Chain of cMet-Fab
(222) To make a construct for expression of cMet-Fab, the VH region of cMet was cloned in pEE6.42F8Fab, replacing the VH 2F8 region.
(223) For this pEE6.42F8Fab and pConG1fcMet were digested with HindIII and Apal and the relevant fragments were isolated.
(224) The cMet V.sub.H fragment and the pEE6.42F8Fab HindIII-Apal digested vector fragment were ligated and transformed into competent DH5-T1.sup.R cells.
(225) A clone was selected containing the correct insert. This plasmid was named pEE6.4cMetFab.
Example 24
(226) Construction of pConG1f2F8: A Vector for the Production of the Heavy Chain of 2F8-IgG1
(227) The V.sub.H coding region of 2F8 (WO 2002/100348) was amplified by PCR from pIESR2F8 (Medarex) using the primers 2f8HCexfor and 2f8HCexrev and subcloned in PCRscriptCam (Stratagene). The VH fragment was subsequently cloned in pCONg1f0.4.
(228) For this pConG1f0.4 and the pCRScriptCAMVH2F8 vectors were digested with HindIII and Apal and the relevant fragments were purified.
(229) The V.sub.H fragment and the pConG1f0.4HindIII-Apal digested vector were ligated and transformed into competent DH5-T1.sup.R cells. A clone was selected containing the correct insert size, the sequence was confirmed and the vector was named pConG1f2F8.
Example 25
(230) Construction of pConK2F8: A Vector for the Production of the Light Chain of 2F8 Antibodies
(231) pIESR2F8 was digested with HindIII and BsiWI and the V.sub.L coding region of 2F8 (anti-EGFr) was isolated from gel. The pConKappa0.4 vector was digested with HindIII and BsiWI and purified. The V.sub.L fragment and the pConKappa0.4HindIII-BsiWI digested vector were ligated and transformed into competent DH5T1.sup.R E. coli.
(232) A clone was selected containing the correct insert size and the sequence was confirmed. This plasmid was named pConK2F8.
Example 26
(233) Construction of pTomG42F8: A Vector for the Production of the Heavy Chain of 2F8-IgG4
(234) To construct a vector for expression of 2F8-IgG4, the VH region of 2F8 was cloned in pTomG4.
(235) For this, pTomG4 and pConG1f2F8 were digested with HindIII and Apal and the relevant fragments were isolated.
(236) The 2F8 V.sub.H fragment and the pTomG4HindIII-Apal digested vector were ligated and transformed into competent DH5-T1.sup.R cells.
(237) A clone was selected containing the correct insert size. This plasmid was named pTomG42F8.
Example 27
(238) Construction of pTomG42F8HG: A Vector for the Production of the Heavy Chain of 2F8-HG
(239) To make a construct for expression of 2F8-HG, the VH region of 2F8 was cloned in pTomG47D8HG, replacing the VH7D8 region.
(240) For this pTomG47D8HG and pConG1f2F8 were digested with HindIII and Apal and the relevant fragments were isolated.
(241) The 2F8 V.sub.H fragment and the pTomG47D8HGHindIII-Apal digested vector fragment were ligated and transformed into competent DH5-T1 .sup.R cells.
(242) A clone was selected containing the correct insert size. This plasmid was named pTomG42F8HG.
Example 28
(243) Construction of pEE6.42F8Fab: A Vector for the Production of the Heavy Chain of 2F8-Fab
(244) The Fab coding region was amplified from vector pConG1f2F8 by PCR with primers pConG1seq1 and 2F8fabrev2, introducing a suitable cloning restriction site and a C-terminal his tag coding sequence. The PCR fragment was purified and cloned in PEE6.4.
(245) For this pEE6.4 and the PCR fragment were digested with HindIII and EcoRI and the relevant fragments were isolated.
(246) The 2F8 Fab fragment and the pEE6.4HindIII-EcoRI digested vector fragment were ligated and transformed into competent DH5-T1.sup.R cells.
(247) A clone was selected containing the correct insert and the sequence was confirmed by DNA sequencing. This plasmid was named pEE6.42F8Fab.
Example 29
(248) Construction of pConG1f7D8: A Vector for Production of the Heavy Chain of 7D8-IgG1
(249) The V.sub.H coding region of CD20 specific HuMab-7D8 (WO 04/035607) was amplified by PCR from a pGemT (Promega, Madison, USA) vector containing this region using the primers 7D8VHexfor (P8) and 2F8HCexrev (P13) (
(250) The V.sub.H fragment was gel purified and cloned into pConG1f0.4. For this the V.sub.H fragment was isolated from the pPCR-Script CAM vector after digestion with HindIII and Apal and gel purification.
(251) The pConG1f0.4 vector was digested with HindIII and Apal and the vector fragment was isolated from gel, followed by dephosphorylation with Shrimp Alkaline Phosphatase (New England Biolabs) The V.sub.H fragment and the pConG1f0.4HindIII-Apal dephosphorylated fragment were ligated and transformed into competent DH5-T1 .sup.R cells (Invitrogen). Eight colonies were checked by colony PCR (using primers pConG1seq1 (P10) and HCseq5 (P11) (
(252) A clone was chosen for further study and named pConG1f7D8.
Example 30
(253) Construction of pConK7D8: A Vector for Production of the Light Chain of 7D8-IgG1, 7D8-IgG4 and 7D8-HG
(254) The V.sub.L coding region of CD20 specific HuMab-7D8 (WO 04/035607) was amplified from a plasmid containing this region using the primers 7D8VLexfor (P7) and 7D8VLexrev (P6) (
(255) The PCR product and the pConKappa0.4 vector were digested with HindIII and Bs/Wl. The vector and V.sub.L fragment were purified and the vector was dephosphorylated with Shrimp Alkaline Phosphatase. The V.sub.L fragment and the pConKappa0.4HindIII-Bs/Wl digested vector were ligated and transformed into competent DH5 T1.sup.R E. coli. Ten colonies were checked by colony PCR (using primers pConKseq1 (P9) and LCseq3 (P5) (
(256) From 4 clones plasmid DNA was isolated and the V.sub.L region was sequenced. 3 clones contained the predicted sequence and one clone was chosen for further use and named pConK7D8.
Example 31
(257) Construction of pTomG4: A Vector for the Expression of Variable Heavy Chain Regions of Human IqG with the Constant Region of Human laG4
(258) Genomic DNA was isolated from a blood sample of a volunteer and used as a template in a PCR with primers IgG4gene2f (P15) and IgG4gene2r (P14) (
Example 32
(259) Construction of pTomG47D8: A Vector for the Production of the Heavy Chain of 7D8-IgG4
(260) Plasmid DNA from pConG1f7D8 was digested with HindIII and Apal and the V.sub.H fragment was gel purified. The pTomG4 vector was digested with HindIII and Apal and the vector fragment was isolated from gel. The V.sub.H fragment and the pTomG4HindIII-Apal fragment were ligated and transformed into competent DH5-T1.sup.R cells. Four colonies were checked by colony PCR (using primers pConKseq1 (P9) and HCseq11 (P12)) and two were found to contain the correct insert size and the presence of the pTomG4 backbone was confirmed by a digestion with Mspl on the colony PCR fragment. One of the clones was chosen for further use. This plasmid was named pTomG47D8.
Example 33
(261) Construction of pTomG47D8HG; A Vector for the Expression of the Heavy Chain of 7D8-HG
(262) Site directed mutagenesis was used to destroy the splice donor site of the hinge exon of IgG4 in the pTomG47D8 plasmid. A site-directed mutagenesis reaction was done according to the QuickChange XL site-directed mutagenesis method using primers IgG4S228Pf (P16) and IgG4S228Pr (P17). 24 colonies were screened by colony PCR and Xmal digestion (an extra Xmal site was introduced during mutagenesis) and all colonies appeared to contain the correct nucleotide changes. Two positive colonies were grown overnight, plasmid DNA was isolated and sequenced to confirm that the correct mutation was introduced. Both did contain the correct sequence and one was chosen for further propagation and named pTomG47D8HG. To exclude the introduction of additional mutations during the mutagenesis process, the whole IgG4 coding region of pTomG47D8HG was resequenced and no additional mutations were found. The final vector was named pTomG47D8HG.
Example 34
(263) Cloning of the Variable Regions of the Mouse Anti-Betv1 Antibody
(264) Total RNA was prepared from 0.310.sup.5 mouse hybridoma cells (Clone 2H8 from reference (Akkerdaas J H et al., Allergy 50(3), 215-20 (1995)) with the RNeasy kit (Qiagen, Westburg, Leusden, Netherlands) according to the manufacturer's protocol.
(265) 5-RACE-Complementary DNA (cDNA) of RNA was prepared from 112 ng total RNA, using the SMART RACE cDNA Amplification kit (BD Biosciences Clontech, Mountain View, Calif., USA), following the manufacturer's protocol.
(266) The V.sub.L and V.sub.H regions of the Betv1 antibody were amplified by PCR. For this PfuTurbo Hotstart DNA polymerase (Stratagene) was used according to the manufacturer's instructions. Each reaction mix contained 200 M mixed dNTPs (Roche Diagnostics), 12 pmol of the reverse primer (RACEG1mm1 (P19) for the V.sub.H region and RACEKmm1 (P18) for the V.sub.L region), 7.2 pmol UPM-Mix (UPM-Mix: 2 M ShortUPMH3 (P20) and 0.4 M LongUPMH3 (P21) oligonucleotide (
(267) PCR reactions were carried out with a TGradient Thermocycler 96 (Whatman Biometra) using a 35-cycle program: denaturing at 95 C. for 2 min; 35 cycles of 95 C. for 30 sec, a 55 C. for 30 sec, and 72 C. for 1.5 min; final extension at 72 C. for 10 min.
(268) The reaction products were separated by agarose gel electrophoresis on a 1% TAE agarose gel and stained with ethidium bromide. Bands of the correct size were cut from the gels and the DNA was isolated from the agarose using the QiaexII gel extraction kit (Qiagen).
(269) Gel isolated PCR fragments were A tailed by a 10 min 72 C. incubation with 200 M dATP and 2.5 units Amplitaq (Perkin Elmer) and purified using minielute columns (Qiagen). A-tailed PCR fragments were cloned into the pGEMTeasy vector (Promega) using the pGEMT easy vector system II kit (Promega), following the manufacturer's protocol. 2 l of the ligation mixture was transformed into OneShot DH5T1R competent E. Coli (Invitrogen) and plated on LB/Amp/IPTG/Xgal plates.
(270) Four insert containing, white colonies each for the V.sub.H and V.sub.L sequences were picked and the inserts were sequenced. The deduced amino acid sequences of the V.sub.H and V.sub.L of Betv1 are shown as SEQ ID No: 8 and SEQ ID No:12, respectively.
Example 35
(271) Construction of pConG1fBetV1: A Vector for the Production of the Heavy Chain of Betv1-IgG1
(272) The V.sub.H coding region of mouse anti-BetV1 antibody was amplified by PCR from a plasmid containing this region (example 18) using the primers VHexbetv1for (P4) and VHexbetv1rev (P3), introducing suitable restriction sites for cloning into pConG1f0.4 and an ideal Kozak sequence.
(273) The V.sub.H fragment was gel purified and cloned into pConG1f0.4. For this the PCR product and the pConKappa0.4 vector were digested with HindIII and Apal and purified.
(274) The V.sub.H fragment and the pConG1f0.4HindIII-Apal digested vector were ligated and transformed into competent DH5-T1.sup.R cells.
(275) A clone was selected containing the correct insert size and the correct sequence was confirmed. This plasmid was named pConG1fBetv1.
Example 36
(276) Construction of pConKBetv1: A Vector for the Production of the Light Chain of Betv1
(277) The V.sub.L coding region mouse anti-BetV1 antibody was amplified from a plasmid containing this region (example 18) using the primers VLexbetv1for (P2) and VLexbetv1rev (P1), introducing suitable restriction sites for cloning into pConK0.4 and an ideal Kozak sequence.
(278) The PCR product and the pConKappa0.4 vector were digested with HindIII and Bs/WI and purified. The V.sub.L fragment and the pConKappa0.4HindIII-Bs/WI digested vector were ligated and transformed into competent DH5 T1.sup.R E. coli.
(279) A clone was selected containing the correct insert size and the sequence was confirmed. The plasmid was named pConKBetv1.
Example 37
(280) Construction of pTomG4Betv1: A Vector for the Production of the Heavy Chain of Betv1-10G4
(281) To construct a vector for expression of Betv1-IgG4, the V.sub.H region of BetV1 was cloned in pTomG4.
(282) For this, pTomG4 and pConG1fBetv1 were digested with HindIII and Apal and the relevant fragments were isolated.
(283) The Betv1 V.sub.H fragment and the pTomG4HindIII-Apal digested vector were ligated and transformed into competent DH5-T1.sup.R cells.
(284) A clone was selected containing the correct insert size and the sequence was confirmed. This plasmid was named pTomG4Betv1.
Example 38
(285) Construction of pTomG4Betv1 HG; A Vector for the Production of the Heavy Chain of Betv1-HG
(286) To make a construct for expression of Betv1-HG, the V.sub.H region of Betv1 was cloned in pTomG47D8HG, replacing the V.sub.H 7D8 region.
(287) For this pTomG47D8HG and pConG1fBetv1 were digested with HindIII and Apal and the relevant fragments were isolated.
(288) The Betv1 V.sub.H fragment and the pTomG47D8HGHindIII-Apal digested vector fragment were ligated and transformed into competent DH5-T1.sup.R cells.
(289) A clone was selected containing the correct insert size and the sequence was confirmed. This plasmid was named pTomG4Betv1 HG.
Example 39
(290) Production of 7D8-10G1, 7D8-10G4, 7D8-HG, Betv1-10G1, Betv1-10G4, Betv1-HG, 2F8-IgG1, 2F8-IgG4, 2F8-HG, 2F8-Fab, A77-IgG1, A77-IgG4, A77-HG, A77-Fab, cMet-IgG1, cMet-IgG4, cMet-HG, and cMet-Fab by Transient Expression in Hek-293F Cells
(291) Antibodies were produced of all constructs by cotransfecting the relevant heavy and light chain vectors in HEK-293F cells using 293fectin according to the manufacturer's instructions. For 7D8-IgG1, pConG1f7D8 and pConK7D8 were coexpressed. For 7D8-IgG4, pTomG47D8 and pConK7D8 were coexpressed. For 7D8-HG, pTomG47D8HG and pConK7D8 were coexpressed. For Betv1-IgG1, pConG1Betv1 and pConKBetv1 were coexpressed. For Betv1-IgG4, pTomG4Betv1 and pConKBetv1 were coexpressed. For Betv1-HG, pTomG4Betv1HG and pConKBetv1 were coexpressed.
(292) For 2F8-IgG1, pConG1f2F8 and pConK2F8 were coexpressed. For 2F8-IgG4, pTomG42F8 and pConK2F8 were coexpressed. For 2F8-HG, pTomG42F8HG and pConK2F8 were coexpressed. For 2F8-Fab, pEE6.42F8-Fab and pConK2F8 were coexpressed.
(293) For cMet-IgG1, pConG1fcMet and pConKcMet were coexpressed. For cMet-IgG4, pTomG4cMet and pConKcMet were coexpressed. For cMet-HG, pTomG4cMetHG and pConKcMet were coexpressed. For cMet-Fab, pEE6.4cMet-Fab and pConKcMet were coexpressed.
(294) For A77-IgG1, pConG1fA77 and pConKA77 were coexpressed. For A77-IgG4, pTomG4A77 and pConKA77 were coexpressed. For A77-HG, pTomG4A77HG and pConKA77 were coexpressed. For A77-Fab, pEE6.4A77-Fab and pConKA77 were coexpressed.
Example 40
(295) Purification of IgG1, IgG4 and IgG4-Hingeless Antibodies
(296) All IgG1, IgG4 and hingeless antibodies were purified. First the supernatants were filtered over 0.20 M dead-end filter. Then, the supernatant was loaded on a 5 ml Protein A column (rProtein A FF, Amersham Bioscience) and eluted with 0.1 M citric acid-NaOH, pH 3. The eluate was immediately neutralized with 2 M Tris-HCl, pH 9 and dialyzed overnight to 12.6 mM sodium phosphate, 140 mM NaCl, pH 7.4 (B. Braun, Oss, The Netherlands). After dialysis samples were sterile filtered over 0.20 M dead-end filter.
(297) Antibodies were deglycosylated by overnight incubation at 37 C. with 1 unit PNgase F (Roche)/g antibody, followed by purification on protein A.
(298) Samples were analyzed for concentration of IgG by nephelometry and absorbance at 280 nm.
Example 41
(299) Purification of Recombinant Fab Antibodies by Metal Affinity Chromatography
(300) Talon beads (Clontech) were used for purification of the A77-Fab, 2F8-Fab and cMet-Fab antibodies.
(301) Before use, the beads were equilibrated with lx equilibration/wash buffer pH 7.0 (50 mM sodium phosphate and 300 mM NaCl) followed by incubation with the culture supernatant containing the Fab antibody. The beads were washed with 1 equilibration/wash buffer to remove aspecific bound proteins and the His-tagged protein was eluted with 1 elution buffer (50 mM sodium phosphate, 300 mM NaCl and 150 mM Imidazole) at pH 5.0. Incubation was done batch wise, whereas washing and elution were done in packed columns using centrifugation (2 minutes at 700 g). The eluted protein was desalted on a PD-10 column by exchanging to PBS. The yield of purified protein was determined by measuring the absorbance at 280 nm using the theoretic absorbance coefficient as calculated from the amino acid sequence. Purified proteins were analyzed by SDS-PAGE, the protein migrated as one band at the expected size.
Example 42
(302) Non-Reduced SDS-PAGE Analysis of 7D8-10G4 and 7D8-HG Antibodies
(303) After purification, the CD20 specific antibodies 7D8-IgG1 (IgG1 anti-CD20) 7D8-IgG4 (IgG4 anti-CD20) and 7D8-HG (hingeless IgG4 anti-CD20) were analyzed on non-reducing SDS-PAGE.
(304) The Bis-Tris electrophoresis method used is a modification of the Laemmli method (Laemmli UK, Nature 227, 6801 (1970)), where the samples were run at neutral pH. The SDS-PAGE gels were stained with Coomassie and digitally imaged using the GeneGenius (Synoptics, Cambridge, UK).
(305) As can be seen in
Example 43
(306) Mass Spectrometry of 7D8-HG
(307) For Mass Spectrometry by Nanospray technique the samples were concentrated and buffer was exchanged to 20 mM sodium phosphate, pH 7.2 using Millipore Microcon YM-30 concentrators. Subsequently, approximately 100 g IgG was digested for 16 hours at 37 C. with 1 U N-glycosidase F (Roche, cat. no. 1365177) to release the N-linked glycans.
(308) Samples were desalted off-line using a C4 micro-trap cartridge and eluted in 30% propanol/5% acetic acid. Molecular weight analysis was performed using nanospray Electrospray-MS using a Q-TOF (Waters, Almere, the Netherlands). The instrument was calibrated using glu-fibrinopeptide. Masslynx 4.0 software was used to deconvolute the multiply-charged data obtained.
(309) A further aliquot of the sample was reduced using dithiothreitol. The products of reduction were desalted off-line using a C4 microtrap and analyzed as described above. MS analysis of 7D8-HG under reducing conditions showed a light chain mass of 23440 dalton which is consistent with the predicted light chain mass of 23440 dalton. No mass of the heavy chain was detected, probably because of precipitation of the heavy chain.
(310) MS analysis under non-reduced conditions showed a predominant mass of 71520 dalton, which correlates well with the predicted mass (71522 dalton) of a half-molecule (combining one heavy and one light chain) missing the hinge. A tiny amount of a product with a mass of 143041 dalton was observed, probably representing a tetrameric molecule with a hingeless heavy chain.
Example 44
(311) Mass Spectometry Peptide Mapping of 7D8-HG
(312) An aliquot (25 g) of 7D8-HG was digested with CNBr for 5 hours at room temperature. The CNBr digested sample was freeze-dried and then redissolved in 50 mM ammonium bicarbonate buffer adjusted to pH 8.4 with 10% aq. ammonia and digested with TPCK-treated trypsin for 5 hours at 37 C. The products of digestion were lyophilized and reduction was performed on the digested lyophilized sample using a 20 times molar excess of dithiothreitol (DTT) in Tris-acetate buffer at pH 8.5. The products of the reaction were analyzed by on-line LC/ES-MS using a C18 column. Elution was carried out using aqueous formic acid and an acetonitrile gradient. Detection of masses occurred with a LCT Premier Electrospray mass spectrometer, calibrated over the range of m/z 250 to 3000.
(313) A tryptic peptide with a mass of 2026.2 Da corresponding to the theoretic mass of the hingeless specific peptide 220 VAPEFLGGPSVFLFPPKPK 238 was detected (
(314) This result shows that the 7D8-HG antibody does not contain a hinge region.
Example 45
(315) Molecular Mass Distribution from Sedimentation Velocity by Analytical Ultracentrifuge (AUC) Experiments of 7D8-HG
(316) A 1 mg/ml sample of 7D8-HG in PBS was send to Nanolytics (Dalgow, Germany) for AUC analysis. A dominant population of 7D8-HG sediments with a velocity of 6.7 S (95%) was identified. A distinct aggregate was found at 11.5 S (2%). The rest of the material was found in higher aggregates.
(317) The sedimentation coefficient of the major fraction indicates that 7D8-HG in PBS predominantly occurs as a dimer with a frictional ratio of 1.4.
(318) Apparently 7D8-HG forms a dimer by low affinity non-covalent interactions, presumably in the 0H3 region (Saphire, Stanfield et al. 2002 J Mol Biol 319(1): 9-18). This dimerization process can be inhibited by using HG molecules in the presence of an excess of irrelevant antibodies (see example 54)
Example 46
(319) Functional Analysis of 7D8-IaG1, 7D8-10G4 and 7D8-HG Antibodies
(320) Binding to the CD20 antigen of these CD20 specific antibodies was examined by flow cytometry. NSO/CD20 transfected cells (50,000 cells/50 l) were washed in FACS buffer (FB: PBS, 0.05% BSA, 0.02% NaN.sub.3) and incubated in V-bottom 96-well plates with the test antibodies (50 l at 4 C. for 30 min). After washing, goat F(ab).sub.2 anti-human IgG-kappa labeled with PE (Southern Biotechnology, cat No: 2062-09, www.southernbiotech.com) was added to the cells. Cells were washed in FB and cells were collected in FACS tubes in a total volume of 150 l. Samples were measured and analyzed by use of FACScalibur (Becton Dickinson, San Diego, Calif., USA).
(321) As can be seen in
(322) In order to determine binding of C1q (the first component of the classical complement cascade) to 7D1-IgG1, 7D8-IgG4 and 7D8-HG an ELISA was performed. In short, microtiter ELISA plates (Greiner, Germany) were coated overnight at RT with the test antibodies serially diluted from 10 g/ml to 0.06 g/ml in PBS. Plates were emptied and wells were blocked with 200 l ELISA-diluent per well (0.1 M NaPO.sub.4, 0.1 M NaCl, 0.1% gelatin and 0.05% Tween-20), at RT for 30 minutes. Subsequently, plates were emptied and wells were incubated with 2 g/ml human C1q (Quidel, lot #900848) in C1q buffer (PBS supplemented with 0.1% w/v gelatine and 0.05% v/v Tween-20, 100 l/well, 37 C., 1 hour). Plates were washed three times with PBST and wells were incubated with rabbit anti-human C1q (DAKO, A0136), diluted in C1q buffer (100 l/well, RT, 1 h). After washing the plates (3) with PBST, wells were incubated with HRP-conjugated swine anti-rabbit IgG-Fc (DAKO, P0300, lot #069) diluted in ELISA diluent (1:2500, 100 l/well, RT, 1 hour). Thereafter, plates were washed thrice and assays were developed with freshly prepared 1 mg/ml ABTS solution (ABTS: 2,2-azino-bis[3-ethylbenzthiazoline-6-sulfonic acid]); 2 tablets of 5 mg in 10 ml ABTS buffer, Boehringer Mannheim, Ingelheim, Germany) at RT in the dark for 30 minutes. Absorbance was measured at 405 nm in an ELISA plate reader (Biotek Instruments Inc., Winooski, USA).
(323) As can be seen in
(324) To further investigate the complement properties of the CD20-specific antibodies, the complement-dependent cellular toxicity was examined. After harvesting, Daudi cells (ATC, www.ATCC.org) were washed trice in PBS and resuspended at 210.sup.6 cells/ml in RPMI 1640, supplemented with 1% (w/v) bovine serum albumin (BSA; Roche, Basel, Switzerland). Then, cells were put in a 96-well round-bottom plate at 1.010.sup.5 cells/well in a volume of 50 l. The same volume of antibody (highest concentration 10 g/ml, diluted in RPMI 1640 and 1% BSA) was added to the wells and incubated for 15 minutes at room temperature (RT). Then 25 l normal human serum (NHS) was added and the cells were incubated at 37 C. for 45 minutes. Heat-inactivated serum (serum T) is NHS which has been incubated for 10 minutes on 56 C. After incubation for 45 minutes, cells were resuspended transferred to FACS tubes (Greiner). Then, 10 l propidium iodide (PI; Sigma-Aldrich Chemie B.V.) was added (10 g/mIsolution) to this suspension. Lysis was detected by flow cytometry (FACScalibur, Becton Dickinson, San Diego, Calif., USA) by measurement of the number of dead cells (P1-positive cells).
(325) As can be seen in
(326) To evaluate the role of serum, heat-inactivated serum (serum T) was added to cells incubated with 10 g antibody.
Example 47
(327) Non-Reduced SDS-PAGE Analysis of Betv1-HG Antibody
(328) After purification, the Betv1-HG (hingeless IgG4 anti-Bet v1) was analyzed on non-reducing SDS-PAGE. The used Bis-Tris electrophoresis method is a modification of the Laemmli method the samples were run at neutral pH. The SDS-PAGE gels were stained with Coomassie and digitally imaged using the GeneGenius (Synoptics, Cambridge, UK).
(329) As can be seen in
Example 48
(330) Gelfiltration of Betv1-HG Antibody
(331) Betv1-HG was subjected to gelfiltration to investigate whether this mutant would elute as half-molecule or intact dimer. Samples (100 l) were applied to a Superdex 200 HR 10/30 column (Amersham Biosciences, Uppsala, Sweden), which was connected to a HPLC system (KTA explorer) from Amersham Biosciences, Uppsala, Sweden. The column was first equilibrated in PBS. Fractions of 250 l were collected, in which Bet v 1 specific IgG was measured using the antigen binding assay. The samples were also followed by measuring the absorption at 214 nm.
(332) To test the antigen binding of the Bet v 1 specific antibodies, a sample of diluted antibody was incubated overnight at room temperature with 0.75 mg Protein-G sepharose (Amersham Biosciences, Uppsala, Sweden) in 750 l PBS/AT (PBS supplemented with 0.3% BSA, 0.1% Tween-20, 0.05% NaN3) together with 50 l diluted .sup.125I-labelled Bet v 1 or .sup.125I-labelled Fel d 1. Bet v 1 was iodinated by the chloramine-T method with carrier free .sup.125I (Amersham Biosciences, Uppsala, Sweden) as described in Aalberse et al. (Serological aspects of IgG4 antibodies. 1983. 130:722-726). After washing the Sepharose suspension with PBS-T (PBS supplemented with 0.1% Tween-20), the bound radioactivity was measured. The results were expressed as the amount of radioactivity relative to the amount added.
(333) The Bet v 1 binding activity of the hingeless Betv1-HG eluted in one peak, which was more retained than the elution peak of purified Betv1-IgG4 (IgG4 anti Bet v 1) containing an intact hinge (
Example 49
(334) Functional Characterization of Betv1-10G4 and Betv1-HG Antibodies
(335) Previously was shown that, in contrast to serum-derived antigen specific IgG4, in vitro produced monoclonal IgG4 antibodies are able to crosslink antigen like IgG1 antibodies and are therefore bivalent antibodies (Schuurman J et al., Immunology 97, 693 (1999); Aalberse R C et al., Immunology 105, 9 (2002)). The ability to crosslink antigen of Betv1-IgG1, Betv1-IgG4 and Betv1-HG was determined by a Radio Immuno Assay using Sepharose bound Bet v 1 and .sup.125 I labelled antigen. Herefore, Birch pollen Sepharose was prepared. Briefly, Birch pollen extract (Allergon, ngelholm, Sweden) was coupled to CNBr-activated Sepharose 4B (Amersham Biosciences, Uppsala, Sweden) according to the instructions of the manufacturer. Subsequently, the Sepharose was resuspended in PBS supplemented with 0.3% BSA, 0.1% Tween-20, 0.05% NaN.sub.3.
(336) To examine the ability of the antibody to crosslink Sepharose bound antigen to .sup.125 I labelled antigen, 50 l of diluted antibody was incubated overnight at room temperature with 750 l Sepharose in PBS/AT. Next, the Sepharose suspension was washed with PBS-T, after which the suspension was incubated overnight at room temperature with 50 l diluted .sup.125I labelled Bet v1 in a total volume of 750 l PBS/AT. Finally, the Sepharose was washed with PBS-T and bound radioactivity was measured. The results were expressed as the amount of radioactivity bound relative to the amount of radiolabel added.
(337) As can be seen in
(338) In
Example 50
(339) Pharmacokinetic Evaluation of an IgG4 Hingeless Mutant Antibody, Compared to Normal IgG1, IgG4 and IgG1 Fragments
(340) Twenty-five SCID mice (C.B-17/IcrCrl-scid-BR, Charles-River) with body weights between 24 and 27 g were used for the experiment. The mice were housed in a barrier unit of the Central Laboratory Animal Facility (Utrecht, The Netherlands) and kept in filter-top cages with water and food provided ad libitum. All experiments were approved by the Utrecht University animal ethics committee.
(341) Monoclonal antibodies were administered intravenously via the tail vein. 50 l blood samples were collected from the saphenal vein at 1 hour, 4 hours, 24 hours, 3 days, 7 days, 14 days, 21 days and 28 days after administration. Blood was collected into heparin containing vials and centrifuged for 5 minutes at 10,000 g. Plasma was stored at 20 C. for determination of mAb concentrations.
(342) In this experiment the clearance of the hingeless IgG4 variant (7D8-HG, lot 570-003-EP) was compared with that of normal human IgG4 (7D8-IgG4, lot 570-002-EP), a IgG1 variant (7D8-IgG1, lot 793-001-EP), F(ab).sub.2 (7D8-G1-F(ab)2, lot 815-004-XX) and Fab fragments (7D8-G1-Fab, 815-003-X) of the latter mAb. Each antibody was administered to 5 mice, at a dose of 0.1 mg in 200 l per mouse.
(343) Human IgG concentrations were determined using a sandwich ELISA. Mouse mAb anti-human IgG-kappa clone MH19-1 (#M1272, CLB Sanquin, The Netherlands), coated to 96-well Microlon ELISA plates (Greiner, Germany) at a concentration of 100 ng/well was used as capturing antibody. After blocking plates with PBS supplemented with 2% chicken serum, samples were added, serially diluted in ELISA buffer (PBS supplemented with 0.05% Tween 20 and 2% chicken serum), and incubated on a plate shaker for 1 h at room temperature (RT). Plates were subsequently incubated with peroxidase-labeled F(ab).sub.2 fragments of goat anti-human IgG immunoglobulin (#109-035-097, Jackson, West Grace, Pa.) and developed with 2,2-azino-bis (3-ethylbenzthiazoline-6-sulfonic acid) (ABTS; Roche, Mannheim, Germany). Absorbance was measured in a microplate reader (Biotek, Winooski, Vt.) at 405 nm.
(344) SCID mice were chosen because they have low plasma IgG concentrations and therefore relatively slow clearance of IgG. This provides a PK model that is very sensitive for detecting accelerated clearance due to diminished binding of the Fcy-part to the neonatal Fc receptor (FcRn).
(345) Pharmacokinetic analysis was done by determining the area under the curve (AUC) from the concentrationtime curves, with tail correction. The plasma clearance rate was calculated as Dose/AUC (ml/day). Statistical testing was performed using GraphPad PRISM vs. 4 (Graphpad Software).
(346)
(347)
Example 51
(348) Pharmacokinetic Evaluation of an IgG4 Hingeless Mutant Antibody Compared to Normal IgG4 and IgG1 F(ab)2 Fragments in Immune-Competent Mice
(349) Twelve 8-week old Balb/c mice (Balb/CAnNCrl, Charles-River) were used for the experiment. The mice were housed in a barrier unit of the Central Laboratory Animal Facility (Utrecht, The Netherlands) and kept under sterile conditions in filter-top cages with water and food provided ad libitum. All experiments were approved by the Utrecht University animal ethics committee.
(350) Monoclonal antibodies were administered intravenously via the tail vein. 50 l blood samples were collected from the saphenal vein at 1 hour, 4 hours, 24 hours, 3 days, 7 days, and 10 days after administration. Blood was collected into heparin containing vials and centrifuged for 5 minutes at 10,000 g. Plasma was stored at 20 C. for determination of mAb concentrations.
(351) In this experiment the plasma clearance rate of the hingeless IgG4 variant (7D8-HG, lot 570-003-EP) was compared with that of normal human IgG4 (7D8-IgG4, lot 570-002-EP), a F(ab).sub.2 fragments from 7D8 IgG1 (7D8-G1-F(ab).sub.2, lot 815-004-XX). Each antibody was administered to 4 mice, at a dose of 0.1 mg in 200 l per mouse, corresponding to a dose of 4 mg per kg of body weight.
(352) Human IgG plasma concentrations were determined using a sandwich ELISA. Mouse mAb anti-human IgG-kappa clone MH19-1 (#M1272, CLB Sanquin, The Netherlands), coated to 96-well Microlon ELISA plates (Greiner, Germany) at a concentration of 100 ng/well was used as capturing antibody. After blocking plates with PBS supplemented with 2% chicken serum, samples were added, serially diluted in ELISA buffer (PBS supplemented with 0.05% Tween 20 and 2% chicken serum), and incubated on a plate shaker for 1 h at room temperature (RT). After washing, the plates were subsequently incubated with peroxidase-labeled F(ab).sub.2 fragments of goat anti-human IgG immunoglobulin (#109-035-097, Jackson, West Grace, Pa.) and developed with 2,2-azino-bis(3-ethylbenzthiazoline-6-sulfonic acid) (ABTS; Roche, Mannheim, Germany). Absorbance was measured in a microplate reader (Biotek, Winooski, Vt.) at 405 nm.
(353) Balb/c mice were chosen because they have normal IgG production and therefore faster clearance of IgG than SCID mice. This provides a mouse model in which the administered antibodies have to compete with endogenous mouse IgG for binding to the neonatal Fc receptor (FcRn).
(354)
(355) This experiment indicates that the Fc-part has a favorable effect on the plasma residence time in mice having a normal immune system and provides an indication of a functional interaction with the neonatal Fc receptor (FcRn) also in the presence of endogenous IgG.
Example 52
(356) Pharmacokinetic Evaluation of an IgG4 Hingeless Mutant Antibody in Human IgG-Supplemented SCID mice
(357) Sixteen SCID mice (C.B-17/IcrCrl-scid-BR, Charles-River) with body weights between 18 and 22 g were used for the experiment. The mice were housed in a barrier unit of the Central Laboratory Animal Facility (Utrecht, The Netherlands) and kept under sterile conditions in filter-top cages with water and food provided ad libitum. All experiments were approved by the Utrecht University animal ethics committee.
(358) Immunodeficient SCID mice were chosen for studying the pharmacokinetics of the hingeless IgG4 variant, because these mice do not develop antibody responses to human proteins which may affect clearance studies with durations of more than one week. These IgG-deficient mice were supplemented with a high dose of intravenous immunoglobulin (human multidonor polyclonal IgG) to study the clearance of hingeless IgG4 mutant in the presence of human IgG at physiologically relevant concentrations. This provides a mouse model which better represents the conditions in humans, because 1) association of hingeless IgG4 into a bivalent form is prevented by the presence of IVIG, and 2) hingeless IgG4 has to compete with other IgG for binding to the neonatal Fc receptor (FcRn) (Bazin et al. (1994) J. Immunol Methods 172:209). Binding to FcRn protects IgG from intracellular degradation after endocytosis and is responsible for its long plasma half-life.
(359) In this model the plasma clearance was studied of variants from the human CD20 specific human mAb clone 7D8. The clearance rate of the hingeless IgG4 variant (7D8-HG, lot 992-001-EP) was compared with that of normal human IgG4 (7D8-IgG4, lot 992-002-EP), of F(ab).sub.2 fragments from 7D8 IgG1 (7D8-F(ab).sub.2, lot 892-020-XX). In addition, a preparation of the hingeless variant tested that was enzymatically deglycosylated (TH3001-7D8-HG deglyc, lot 991-004-EP). Each antibody was administered to 4 mice via the tail vein, at a dose of 0.1 mg in 200 l, corresponding to a dose of about 5 mg per kg of body weight. The monoclonal antibodies were administered in a 1:1 mixture with Intravenous Immunoglobulin (60 mg/ml, Sanquin, The Netherlands, JFK108ST, charge#04H04H443A). The total injected volume was 400 l/mouse, giving an IVIG dose of 12.5 mg per mouse.
(360) Fifty l blood samples were collected from the saphenal vein at 15 minutes, 5 hours, 24 hours, 2 days, 3 days, 7 days, and 10 days after administration. Blood was collected into heparin containing vials and centrifuged for 10 minutes at 14,000g. Plasma was stored at 20 C. for determination of mAb concentrations. Plasma concentrations of the 7D8 variants were determined using a sandwich ELISA. A mouse mAb anti-7D8-idiotype antibody (clone 2F2 SAB 1.1 (LD2), lot 0347-028-EP) was used as capturing antibody. After blocking plates with PBS supplemented with 0.05% Tween and 2% chicken serum, samples were added, serially diluted in ELISA buffer (PBS supplemented with 0.05% Tween 20 and 2% chicken serum), and incubated on a plate shaker for 2 h at room temperature (RT). The infused antibodies were used as reference. After washing, the plates were subsequently incubated with peroxidase-labeled goat anti-human F(ab).sub.2 specific (109-035-097, Jackson lmmunoresearch, West Grace, Pa.) and developed with 2,2-azino-bis (3-ethylbenzthiazoline-6-sulfonic acid) (ABTS; Roche, Mannheim, Germany). Absorbance was measured in a microplate reader (Biotek, Winooski, Vt.) at 405 nm. Total human IgG plasma concentrations were determined using a similar ELISA. Mouse mAb anti-human IgG-kappa clone MH16 (#M1268, CLB Sanquin, The Netherlands) was used as capturing antibody. Peroxidase-labeled goat anti-human IgG immunoglobulin (#109-035-098, Jackson, West Grace, Pa.) was used for detection.
(361) Pharmacokinetic analysis was done by determining the area under the curve (AUC) from the concentrationtime curves, with tail correction. The plasma clearance rate was calculated as Dose/AUC (ml/day). Statistical testing was performed using Graph Pad PRISM vs. 4 (Graphpad Software).
(362)
(363) TABLE-US-00001 PLASMA CLEARANCE RATE (D/AUC) in ml/day per kg IgG1 IgG4 HG F(ab)2 IgG4 IgG4 HG deglyc Mean 380 14 39 29 Lower 95% CI of mean 346 12 25 19 Upper 95% CI of mean 415 17 53 38 Number of values 4 4 4 4
(364) Thus, also in the presence of human IgG in physiologically relevant concentrations the clearance of the hingeless variant is much slower than that of F(ab)2 fragments, which have a comparable molecular size. This experiment demonstrates that, also in the presence of competing human IgG at physiologically relevant concentrations, the hingeless IgG4 variant is capable of functional interaction with the neonatal Fc receptor (FcRn). Furthermore, this experiment indicates that the glycosylation of the hingeless IgG4 variant does not affect plasma clearance and that non-glycosylated hingeless IgG4 has a similar half-life in vivo as the fully glycosylated from.
Example 53
(365) Pharmacokinetic Evaluation of an IgG4 Hingeless Mutant Antibody Compared to Normal IgG4 anc IgG1 F(ab).sub.2 Fragments in FcRn / Mice
(366) This experiment was performed to investigate whether the IgG4 hingeless mutant is capable of interacting with the neonatal Fe receptor (FcRn), which is responsible for the long plasma half-life of IgG by protecting IgG from intracellular degradation after endocytosis. B2M knockout mice were used in this experiment because they do not express FcRn.
(367) Twelve female C57BI/6 B2M knockout mice (Taconic model B2MN12-M, referred to as FcRn/ mice), and twelve female C57BI/6 wild type control mice (Taconic, model nr. B6, referred to as WT mice) were used for the experiment. The mice were housed in a barrier unit of the Central Laboratory Animal Facility (Utrecht, The Netherlands) and kept in filter-top cages with water and food provided ad libitum. All experiments were approved by the Utrecht University animal ethics committee.
(368) The plasma clearance was studied of variants from the human CD20 specific human mAb clone 7D8. The clearance rate of the hingeless IgG4 variant (7D8-HG, lot 992-001-EP) was compared with that of normal human IgG4 (7D8-IgG4, lot 992-002-EP), F(ab).sub.2 fragments from 7D8-IgG1 (7D8-G1-F(ab).sub.2, lot 892-020-XX).
(369) Monoclonal antibodies were administered intravenously via the tail vein. Each antibody was administered to 4 mice at a dose of 0.1 mg in 200 l per mouse, corresponding to a dose of 5 mg per kg of body weight. Fifty l blood samples were collected from the saphenal vein at 10 minutes, 5 hours, 24 hours, 2 days, 3 days, 7 days, and 10 days after administration. Blood was collected into heparin containing vials and centrifuged for 10 minutes at 14,000 g. Plasma was stored at 20 C. for determination of mAb concentrations. Human IgG plasma concentrations were determined using a sandwich ELISA in which mouse mAb anti-human IgG-kappa clone MH19-1 (#M1272, CLB Sanquin, The Netherlands), coated to 96-well Microlon ELISA plates (Greiner, Germany) at 100 ng/well was used as capturing antibody. After blocking plates with ELISA buffer (PBS supplemented with 0.05% Tween and 2% chicken serum), samples were added, serially diluted in ELISA buffer. Serial dilutions of the corresponding infused antibody preparations were used as reference. After incubation and washing, the plates were incubated with peroxidase-labeled AffiniPure Goat Anti-Human IgG, F(ab).sub.2 Fragment Specific (#109-035-097, Jackson lmmunoresearch, West Grace, Pa.) and developed with 2,2-azino-bis (3-ethylbenzthiazoline-6-sulfonic acid) (ABTS; Roche, Mannheim, Germany). Absorbance was measured in a microplate reader (Biotek, Winooski, Vt.) at 405 nm. Pharmacokinetic analysis was done by determining the area under the curve (AUC) from the concentrationtime curves, with tail correction. The plasma clearance rate was calculated as Dose/AUC (ml/day). Statistical analysis was performed using Graph Pad PRISM vs. 4 (Graphpad Software).
(370)
(371) TABLE-US-00002 PLASMA CLEARANCE RATE ml/day per kg F(ab)2 F(ab)2 IgG4 IgG4 IgG4 HG IgG4 HG WT FcRn/ WT FcRn/ WT FcRn/ Mean 183 159 12 45 15 83 Std. Deviation 19 19 10 3 4 29 Number of values 4 4 4 4 4 4 Significance difference: 0.1265 ns 0.0009 *** 0.0033 ** Pvalue (t-test)
(372) For F(ab).sub.2 fragments no significant differences were observed between wild type (WT) and knockout (FcRn/) mice. In contrast, for IgG4 and the hingeless IgG4 variant the clearance rates were 3 to 5 times slower in the WT mice compared to that in FcRn / mice. This experiment shows that the presence of FcRn has a favorable effect on the plasma residence time of hingeless IgG4. Therefore, it provides evidence that hingeless IgG4 is capable having a functional interaction with FcRn in vivo, which explains its favorable plasma half-life.
Example 54
(373) Functional Analysis of 2F8-HG Anti-EGFr mAb
(374) MAb 2F8 is a human IgG1 monoclonal antibody (mAb) against human Epidermal Growth Factor receptor (EGFr) which is capable to inhibit EGFr signalling by blocking binding of ligands. From this mAb an IgG4 variant, 2F8-IgG4, was made and also a hingeless variant, 2F8-HG.
(375) In the present example, we compared the potency of 2F8-HG with that of 2F8-IgG1 and 2F8-Fab fragments to inhibit ligand-induced EGFr phosphorylation in cells in vitro. This was done both with and without addition of Intravenous Immunoglobulin (IVIG), a polyclonal human IgG preparation, containing all IgG subclasses.
(376) Inhibition of EGFr phosphorylation was measured in a two-step assay using the epidermoid cell line, A431 (ATCC, American Type Culture Collection, Manassas, USA). The cells were cultured overnight in 96-wells plates in serum-free medium containing 0.5% human albumin (human albumin 20%, Sanquin, the Netherlands). Next, mAb were added in serial dilution, with or without IVIG (Immunoglobuline I.V., Sanquin) at a fixed final concentration of either 100 or 1000 g/ml. After 60 minutes incubation at 37 C., 50 ng/ml recombinant human EGF (Biosource) was added to induce activation of non-blocked EGFr. Following an additional 30 minutes incubation, cells were solubilized with lysis buffer (Cell Signaling Technology, Beverly, Mass.), and the lysates were transferred to ELISA plates coated with 1 g/m1 of mouse anti-EGF-R antibodies (mAb EGFR1, BD Pharmingen, San Diego, Calif.). After 2 hours incubation at RT, the plates were washed and binding of phosphorylated EGF-R was detected using a europium-labelled mouse mAb, specific for phosphorylated tyrosines (mAb Eu-N1 P-Tyr-100, PerkinElmer). Finally, DELFIA enhancement solution was added, and time-resolved fluorescence was measured by exciting at 315 nm and measuring emission at 615 nm on an EnVision plate reader (PerkinElmer). Sigmoidal dose-response curves were calculated using non-linear regression (GraphPad Prism 4).
(377) As can be seen in the upper panel of
Example 55
(378) Proof of Principle: IgG4 Hingeless Against CD89 (CD89-HG) Inhibits 10E-Mediated Asthma in a Mouse Model
(379) Pasquier et al. (Pasquier, B et al., Immunity 22, 31(2005)) showed that FcRI (CD89 (Monteiro R C et al., Annu Rev Immunol 21, 177 (2003)) has both an anti- and proinflammatory role. Aggregation of FcRI leads to cell activation by recruitment of Syk and aborting SHP-1 binding. A monomeric interaction with FcRI inhibits the activating response: SHP-1 is being recruited and impairment of Syk, LAT and ERK phosphorylation occurs.
(380) Fab fragments of an anti-CD89 antibody (clone A77) could inhibit IgG-mediated phagocytosis using human monocytes. Furthermore, IgE-mediated responses in vitro using FcRI transfected RBL-2H3 cells and in vivo in an IgE-mediated asthma model were inhibited by Fab fragments of this anti-CD89 antibody. In this animal model, FcRI-transgenic mice (Launay P et al., J Exp Med 191, 1999 (2000)) were sensitized with TNP-OVA. Mice challenged intranasally with IgE-TNP-OVA immune complexes in the presence of A77 Fab-fragments showed reduced bronchial reactivity to methacholine whereas and irrelevant Fab-fragment could reduce the bronchial hyperreactivity.
(381) Proof on principle in vitro of an antigen specific, non-crosslinking, monovalent, non-activating antibody is obtained in the following experiment. Adherent PBMC are incubated with 10 g/ml A77-HG (IgG4 hingeless) preincubated 24 h with or without irrelevant IgG4 (Genmab BV) or incubated with irrelevant HG antibody for 30 min at 37 C., washed, and incubated at 37 C. for 30 min with Texas-red-conjugated E. coli (50 bacteria/cell) (Molecular Probes, Eugene, Oreg.) opsonized or not with polyclonal rabbit anti-E. coli IgG antibodies according to the manufacturer's instructions. Slides are mounted and examined with a confocal laser microscope. The PBMC receiving opsonized E. coli and A77-HG (pre-incubated with irrelevant IgG4) show reduced phagocytosis of E. coli when compared to PMBC receiving opsonized E. coli and control-HG antibody.
(382) FcRI-transgenic mice are sensitized with TNP-OVA as described (Pasquier B et al., Immunity 22, 31(2005)); or alternatively with OVA as described by Deurloo et al. (Deurloo D T et al., Clin Exp Allergy 33, 1297 (2003)). Human FcRI transgenic mice and littermate controls are immunized twice on day 0 and day 7 intraperitonally with TNP-OVA or OVA (Sigma) in aluminium hydroxide. Mice are challenged intranasally for a few consecutive days with either TNP-OVA complexed with 20 g anti-DNP-IgE (Zuberi, R I et al., J Immunol 164, 2667 (2000)) or OVA aerosol (Deurloo D T et al., Clin Exp Allergy 33, 1297 (2003)) in the presence of A77-HG (IgG.sub.4 hingeless) or an irrelevant hingeless antibody (control-HG).
(383) The mice receive 50 g A77-HG or control-HG intraperitoneally twice, once during the challenge period and once with the last intranasal challenge. Twelve hours after the final intranasal challenge, the mice are placed in a whole-body plethysmograph chamber (BUXCO Electronics, Sharon Conn., USA), and 300 mM methacholine delivered. Airway resistance is measured after exposure to methacholine. Immunohistological evaluation is performed on lung sections after euthanizing the mice.
(384) The mice receiving A77-HG show a reduced hyper reactivity when compared to the mice receiving the control-HG antibody.
(385) This indicates that a hingeless IgG.sub.4 molecule is non-crosslinking, monovalent and non-activating and therefore useful for therapeutic purposes where such inert antibody may be favorable such as in the inhibition of inflammatory reactions through FcRI.
Example 56
(386) Proof of Concept Study with Hingeless IgG4 cMet (cMet-HG)
(387) The receptor tyrosine kinase c-Met is prominently expressed on a wide variety of epithelial cells. During embryogenesis, cMet and Hepatocyte Growth factor/Scatter factor (HGF/SF) are involved in tissue-specific differentiation, leading to a proper organization of epithelial cells, muscle endothelium, and the nervous and hematopoietic systems. Abnormal cMet signalling has been implicated in tumorogenesis, particularly in the development of invasive and metastatic tumors. As a consequence of enhanced cMet activity, tumor cells may increase their growth rate and become resistant to apoptosis, resulting in a growth and/or survival advantage. Furthermore, cMet activation may lead to cytoskeletal reorganization and integrin activation, as well as to activation of proteolytic systems involved in extracellular matrix degradation, resulting in an increased invasive and metastatic capacity. Inhibition of HGF/SF-cMet signaling, therefore, represents an important therapeutic avenue for the treatment of malignant tumors.
(388) Kong-Beltran et al. in Cancer Cell (2004 volume 6, pages 75-84) raised an antibody (5D5) to the extracellular domain of cMet and inhibited HGF binding. The Fab fragment of anti-Met 5D5 was shown to inhibit HGF-driven cMet phosphorylation, cell motility, migration and tumor growth. They speculate that anti-cMet-5D5-Fab block receptor dimerization by steric hindering.
(389) MAb C6 is a human IgG1 monoclonal antibody (mAb) against human cMet which is capable of binding with high affinity to H441 cells, activate cMet phosphorylation, induce scattering of DU-145 and block HGF binding to cMet in ELISA. From this mAb a Fab fragment (cMet-Fab), an IgG4 variant (cMet-IgG4), and also a hingeless variant was made (cMet-HG).
(390) In a proof-of-concept study with hingeless IgG4 against cMet (cMet-HG) this monovalent antibody inhibited HGF binding, receptor dimerization/activation, cell scattering, and downstream signalling. This experiment was performed both with and without addition of Intravenous Immunoglobulin (IVIG), a polyclonal human IgG preparation, containing all IgG subclasses and with and without rHGF.
(391) DU-145 Scatter Assay
(392) DU-145 (humane prostate carcinoma cell line, ATCC HTB-81) cells were cultured in DMEM+ (containing 500 ml MEM Dulbecco (DMEM-Medium, glucose 4.5 g/ml with NaHCO3, without glutamine, Sigma, D-6546), 50 ml Cosmic Calf Serum (Hyclone 5H30087.03), 5 ml of 200 mM/L L-glutamine (Bio Whittaker, BE17-605F), 5 ml sodium pyruvate (Bio WhittakerBE13-115E), 5 ml penicillin/streptamicin (Bio Whittaker, DE17-603E)) and were growing adherent clustered cells. Upon addition of rhHGF (Sigma, H-1404), migration of the cells was induced, which leads to singularized cells. This process was called scattering. Induction or inhibition of scattering was observed by microscopy.
(393) Day 1: cMet, cMet-HG, cMet-Fab, cMet-IgG4 (30/3.0/0.3/0.03 g/ml), were incubated over night with and without addition of IVIG, 6 mg/ml. DU145 cells were seeded (adherent cells out of T75-culture flask) cell culture supernatant was removed and cells were washed 1 time with 10 ml PBS 2 ml Trypsine/EDTA was added (37 C.) and cells were incubated at 37 C. for 1-2 min. The cells were removed from the surface of the culture flask by tapping and the Trypsine/EDTA reaction was stopped with stored culture supernatant. The cells were counted and a suspension was prepared of 1*10.sup.4cells/ml in fresh culture medium and 50 l/well was plated into 96-well plate (Sterile flat bottom Costar, 3596)(final density 1000 cells/well). Cells were cultured for 15-24 h at 3TC and 5% CO.sub.2 in an incubator.
(394) Day 2: Medium was replaced by fresh medium, 40 l/well. 40 ul of the preincubated antibody was added to the cells and cells were incubated at 37 C. in an incubator for 60 min, after which 40 l/well medium or 60 ng/ml rh-HGF was added. (Final concentrations were: 10/1.0/0.1/0.01 g/ml Ab, 2 mg/ml IVIG, 20 ng/ml HGF). Cells were incubated for at least 24 h.
(395) Day 3 and 4: Scattering was observed double-blinded by microscope after 24 h or after 48 h. Morphological characteristics of scattering: cells detach from the surface, show spindle shaped forms (migrate), and most were single cells not in clusters.
(396) Ranking of rh-HGF induced scatter inhibition by antibodies: 3 cells were maximal scattering 2 small inhibition of scattering 1 inhibition of scattering 0 no scattering
(397) In this experiment C6-HG pre-incubated with IVIG significantly blocked the HGF induced scattering.
(398) Phosphorylation of the cMet Receptor
(399) A549 cells were cultured in Ham's F12 medium and cMet was not phosphorylated under normal culture conditions. Upon activation by HGF, the cMet receptor becomes phosphorylated. By applying cMet blocking cMet-Fab or cMet-HG with pre-incubation of IVIG the HGF mediated phosphorylation of the receptor was inhibited.
(400) Day 1: cMet-IgG1, cMet-HG (12.5 g/ml), were incubated over night with and without addition of IVIG, 2.5 mg/ml. A549 cells (1*10.sup.6 /well) were cultured in a 6 well plate.
(401) Day 2: The culture medium, (containing 500 ml Ham's F12 (Bio Whittaker BE12-615F 50 ml Cosmic Calf Serum (Hyclone 5H30087.03), 5 ml of 200 mM/L L-glutamine (Bio Whittatker, BE17-605F), 5 ml penicillin/streptamicin (Bio Whittaker, DE17-603E)) was removed and 800 l of the preincubated antibody was added to the cells and cells were incubated herewith at 3TC in an incubator for 15 min, after which 200 l/well medium or 80 ng/ml rh-HGF was added. (Final concentrations were 10 g/ml Ab, 2 mg/ml IVIG, 16 ng/ml HGF). After incubation for another 15 min, the incubation medium was removed and the cells were washed twice with ice cold PBS, and 250 l RIPA lysis buffer (containing 50 mM Tris, pH 7.5, 0.5% Na deoxycholate and 0.1% Nonidet P40, 150mM NaCl, 0.1% SDS, 2 mM vanadate and Complete (Protease inhibitor, Roche 1836170) was added, and the plate was gently rotated for 10 min. at 4 C. The lysates were transferred into pre-cooled tubes (Eppendorf) and centrifuged at highest speed for 30 min. at 4 C. DNA was removed and the lysate was flash frozen in N.sub.2 after a fraction was used to measure BCA protein content analysis (Pierce). Lysates were stored at 80 C. until analysis by Western-blot.10 g reduced samples were undergoing electrophoresis on 4-20% Tris-HCl Criterion Precast gel (Biorad 345-0033) and Western blotting on a nitrocellulose membrane (Biorad 162-0114) according standard procedures. The membrane was blocked with blocking solution (containing5% BSA (Roche, 10735086) in TBST (Tris-HCL 20 mM pH 7.5, NaCl 150 mM, 0.1% Tween 20) for 1.5 hours at room temperature on a roller bank. The membrane was incubated over night at 4 C. with 1:1000 dilution of anti-phospho-Met(pYpYpY 1230 1234 1235)-rabbit IgG, (Abcam, ab5662). After washing 6 times with TBST, the secondary antibodies, goat-anti-rabbit-HRP, Cell Signalling, 7074 (1:2000) in blocking reagent were incubated for 60 min. at room temperature on a roller bank. The membrane was washed 6 times with TBST. Finally the bands were developed with Luminol Enhancer stop solution (Pierce 1856145) and analyzed on a Lumiimager.
(402) cMet-HG pre-incubated with IVIG inhibits the HGF mediated phosphorylation of the receptor.
(403)
(404) DU-145 cells were cultured and incubated with a serial dilution of (A) cMet-Fab, cMet-Fab and IVIG, cMet-Fab and HGF, cMet-Fab and IVIG and HGF (B) cMet-HG, cMet-HG and IVIG, cMet-HG and HGF, cMet-HG and IVIG and HGF. Scattering was observed double-blinded (scored by 14 people) by microscope after 48 h and the averaged scoreSEM is plotted.
(405) cMet -Fab with or without IVIG (A) and cMet-HG pre-incubated with IVIG (B) significantly blocked the HGF induced scattering dose-dependently.
(406)
(407) DU-145 cells were cultured and incubated with 10 g/ml of (A) cMet-Fab, cMet-Fab and IVIG, cMet-Fab and HGF, cMet-Fab and IVIG and HGF (B) cMet-HG, cMet-HG and IVIG, cMet-HG and HGF, cMet-HG and IVIG and HGF. Scattering was observed double-blinded (scored by 14 people) by microscope after 48 h.
(408) cMet-Fab with or without IVIG and cMet-HG pre-incubated with IVIG significantly inhibited the HGF induced scattering. For statistical analysis a two-tailed Wilcoxon signed ranked test was done with a hypothetical median value of 3 (maximal scattering).
(409)
(410) Extracts prepared from A549 cells incubated with cMet-HG (lane 1), cMet-HG and IVIG (lane 2), cMet-HG and HGF (lane 3), cMet-HG, IVIG and HGF (lane 4), cMet-IgG1 (lane 5), cMet-IgG1 and IVIG (lane 6) were resolved by SDS-PAGE on a 4-20% Tris-HCl Criterion Precast gel and Western blotting on a nitrocellulose membrane. The membrane was incubated over night at 4 C. with anti-phospho-Met(pYpYpY 1230 1234 1235)-rabbit IgG, (Abcam, ab5662). After washing with TBST, the secondary antibodies, goat-anti-rabbit-HRP, Cell Signalling, 7074 in blocking reagent were incubated for 60 min. at room temperature on a roller bank. The membrane was washed 6 times with TBST. Finally the bands were developed with Luminol Enhancer stop solution and analyzed on a Lumiimager. The Western blot shows a 169 Kd band indicating phospho-Met(pYpYpY 1230 1234 1235).
Example 57
(411) In Vitro Evaluation of an IgG4 Hingeless Mutant Antibody Targeting the Epidermal Growth Factor Receptor (EGFr): Binding Avidity and Induction of Antibody Dependent Cell-Mediated Cytotoxicity (ADCC)
(412) In this experiment an IgG4 hingeless mutant antibody targeting the Epidermal Growth Factor Receptor (EGFr), mAb 2F8-HG was compared to an IgG4 version, an IgG1 version and Fab fragments, referred to as 2F8-IgG4, 2F8-IgG1 and 2F8-Fab, respectively. The in vitro evaluation comprised the avidity of binding to EGFr in an ELISA and the induction of ADCC.
(413) ELISA. Binding affinities were determined using an ELISA in which purified EGF-R (Sigma, St Louis, Mo.) was coated to 96-well Microlon ELISA plates (Greiner, Germany), 50 ng/well. Plates were blocked with PBS supplemented with 0.05% Tween 20 and 2% chicken serum. Subsequently, samples, serially diluted in a buffer containing 100 g/ml polyclonal human IgG (Intravenous Immunoglobulin, IVIG, Sanquin Netherlands) were added and incubated for 1 h at room temperature (RT). Plates were subsequently incubated with peroxidase-conjugated rabbit-anti-human kappa light chain (DAKO, Glostrup, Denmark) as detecting antibody and developed with 2,2-azino-bis (3-ethylbenzthiazoline-6-sulfonic acid) (ABTS; Roche, Mannheim, Germany). Absorbance was measured in a microplate reader (Biotek, Winooski, Vt,) at 405 nm.
(414)
(415) Antibody dependent cell-mediated cytotoxicity (ADCC). The capacity to induce effector cell-dependent lysis of tumor cells was evaluated in Chromium-51 (.sup.51Cr) release assay. Target A431 cells (2-5106 cells) were labeled with 100 Ci Na.sub.2.sup.51CrO.sub.4 (Amersham Biosciences, Uppsala, Sweden) under shaking conditions at 37 C. for 1 h. Cells were washed thrice with PBS and were re-suspended in culture medium 110.sup.5 cells/ml. Labeled cells were dispensed in 96 wells plates (510.sup.3, in 50 l/well) and pre-incubated (RT, 30 minutes) with 50 l of 10-fold serial dilutions of mAb in culture medium, ranging from 20 g/ml to 0.02 ng/ml (final concentrations). Culture medium was added instead of antibody to determine the spontaneous .sup.51Cr release, tritonX100 (1% final concentration) was added to determine the maximal .sup.51Cr release. Thereafter, PBMC were added to the wells (510.sup.5/well) and cells were incubated at 37 C. overnight. The next day, supernatants were collected for measurement of the .sup.51Cr release by determination of the counts per minute (cpm) in a gamma counter. Percentage of cellular cytotoxicity was calculated using the following formula:
% specific lysis=(experimental release (cpm)spontaneous release (cpm))/(maximal release (cpm)spontaneous release (cpm))100
(416) where maximal .sup.51Cr release determined by adding triton X-100 to target cells, and spontaneous release was measured in the absence of sensitizing antibodies and effector cells.
(417)
Example 58
(418) AlgoNomics' Epibase platform was applied to IgG4 constant hingeless monovalent antibody. In short, the platform analyzes the HLA binding specificities of all possible 10-mer peptides derived from a target sequence (Desmet et al. 1992, 1997, 2002, 2005). Profiling is done at the allotype level for 20 DRB1, 7 DRB3/4/5, 14 DQ and 7 DP, i.e. 48 HLA class II receptors in total.
(419) Epibase calculates a quantitative estimate of the free energy of binding iGbind of a peptide for each of the 48 HLA class II receptors. These data are then further processed as follows: Peptides are classified as strong (S), medium (M), weak and non (N) binders.
(420) No strong and only 1 medium binding epitope was encountered within the constant region of IgG4 hingeless monovalent antibody. This single neo-epitope created a medium DRB1*0407 binder. DRB1*0407 is a minor allotype, present in less than 2% of the Caucasian population. In addition, a single epitope of medium strength is insignificant in the total epitope count of even the least immunogenic antibody.
(421) In conclusion the hingeless monovalent IgG4 antibody is predicted to be very Unlikely to be immunogenic.
Example 59
(422) Background of Studies and Materials used in Examples 59 and 60 Presented for Unibody-CD4
(423) In vitro and in vivo experiments were performed to address the ability of a human monoclonal antibody against CD4 (HuMax-CD4) to inhibit HIV-1 infection. The antibody is directed against domain 1 of CD4 and overlaps with the HIV-1 gp120 binding site on CD4.
(424) The present example (59) shows that Fab fragments of anti-CD4 antibodies inhibits the infection of CD4-CCR5 cells or CD4-CXCR4 cells by different primary isolates and T-cell line adapted HIV viruses. The 1050 values of inhibition are in the range of the EC50 values of HuMax-CD4 binding to sCD4 and cell bound CD4 (data not shown), implicating inhibition of HIV-1 envelope binding to CD4 as a mechanism of inhibition. In general Fab fragments of HuMax-CD4 inhibit with a 10 times lesser efficiency than the whole antibody which is as expected from the difference in avidity between the Fab and the whole antibody.
(425) Example 60 shows that in mice treated with HuMax-CD4 a lesser decline in CD4/CD8 ratio compared is observed than in IgG control treatment groups, indicating that HuMax-CD4 protects against depletion of CD4 positive cells by HIV-1. Furthermore, HuMax-CD4 treatment leads to a decrease in the amount of HIV-1 RNA copies in the blood in time, whereas the IgG control treatment does not induce this decrease. The in vitro data indicate that anti-CD4 antibodies can protect against HIV-1-induced CD4 depletion, and decrease the magnitude of HIV infection and viral load.
(426) Norris et al have published on the treatment of HIV-1 infected individuals with a whole anti-CD4 (domain 2) antibody of the IgG4 subclass. Efficacy results demonstrated significant antiviral activity at primary endpoint (Week 24). Durable response suggested by Week-48 results in patients receiving TNX-355. TNX-355 10 mg/kg+OBR demonstrated a 0.96 log10 reduction in HIV-RNA from baseline at Week 48 versus 0.14 log10 decrease for placebo+OBR (p<0.001). TNX-355 15 mg/kg+OBR demonstrated a 0.71 log10 reduction in HIV-RNA from baseline at Week 48 versus 0.14 log10 for placebo+OBR (p=0.009). Treatment with TNX-355+OBR was associated with statistically significant and clinically-meaningful increases in CD4+cells at Week 48 in both the 10 mg/kg arm (+48 cells, p=0.031) and the 15 mg/kg (+51 cells, p=0.016) arms versus the placebo increase (+1 cell).
LITERATURE Zwick M. B., Wang M., Poignard P., Stiegler G., Katinger H., Burton D. R., and Parren P. W. H. I. 2001. Neutralization synergy of human immunodeficiency virus type 1 primary isolates by cocktails of broadly neutralizing antibodies. J Vir 75:12198. Poignard P., Sabbe R., Picchio G. R., Wang M., Gulizia R. J., Katinger H., Parren P. W. H. I., Mosier D. E., and Burton D. R. 1999. Neutralizing antibodies have limited effects on the control of established HIV-1 infection in vivo. Immunity 10:431. Norris D., Moralis J., Gathe J., Godafsky E., Garcias F., Hardwick R., and Lewis S. 2006. Phase 2 efficacy and safety of the novel viral-entry inhibitor, TNX-355, in combination with optimized background regimen (OBR). XVI International AIDS Conference, Toronto, Canada
In Vitro HIV-1 Neutralization by HuMax-CD4 Whole Antibody and Fab Fragments of the HuMax-CD4 Antibody
(427) The method is described in detail in Zwick et al 2001. In summary, the degree of virus neutralization by antibody was measured by luciferase activity. Viruses competent for a single round of replication were produced by cotransfections of the appropriate virus constructs in a modified pSVIllenv vector (for instance primary isolates: JR-CSF, JR-FL, SF162, ADA, YU2, 89.6, U5143 and T cell line adapted virus: IIIB) and pNL4-3.1ec.R-E-. Viruses were pre-incubated with various amounts of antibody (before addition determined to yield about 100,000 counts) to U87.CD4.CCR5 cells (primary isolates) or CD4-CXCR4 cells (for IIIB), and culturing for 3 days. The wells were washed, incubated with luciferase cell culture lysis reagent, and lysates were transferred to opaque assay plate to measure luciferase activity on a luminometer using luciferase assay reagent. For neutralization HuMax-CD4 and Fab fragments of HuMax-CD4 were tested.
(428) According to the method described, the virus constructs YU2, IIIB, ADA, 89.6, US143, JR-FL, JR-CSF, and SF 162 were used in the in vitro neutralization assay using the luciferase assay expression system. HIV-1 IIIB is a T-cell line adapted virus, all the other viruses are primary isolates of HIV-1. The HuMax-CD4 antibody and Fab fragments of HuMax-CD4 were added in a 1:2 dilution response starting at the concentrations indicated in
(429) Our experiments provide proof-of-principle for an effective inhibition of HIV-1 infection of both CXCR4 and CCR5 HIV-1 co-receptor expressing cells by monovalent binding of an anti-CD4 antibody (i.e. Fab fragment). This provides evidence that a similar inhibition could be accomplished by a HG anti-CD4 antibody.
Example 60
(430) Protection of CD4+ T Cell Depletion in In Vivo hu-PBMC-SCID Mouse Model of HIV Infection
(431) The experimental procedure is described in detail in Poignard et al 1999. In summary, CB-17 SCID mice were reconstituted with about 2510.sup.6 normal human PBMC (peripheral blood mononuclear cells). About two weeks later the animals were infected with HIV-1 (HIV-1.sub.JR-CSF). Three days later the animals are treated with 1 mg/ml HuMax-CD4, or a human IgG isotype control antibody, or no treatment delivered intraperitoneally. Blood samples were taken at 1 hr, 6 hrs, day 1, 2, 3, 6, 9, 13, and 15 after injection and two weeks later the animals were euthanized and FACS analysis performed to determined the % of human cells (using H2Kd-PE and human CD3-APC) and the CD4/CD8 ratio (using CD4-PE and CD8-APC double staining). Furthermore, plasma viral load was measured by measuring HIV-1 RNA levels by the quantitative Roche RT PCR assay. In addition, with a direct sCD4 binding ELISA (coat of sCD4 on the plate, and detection by anti-Fc polyclonal antibody) the concentrations of HuMax-CD4 in plasma were determined.
(432) In
(433) In
(434) Our experiment provides proof of principle for the protection against CD4 cell depletion in HIV-1 infection in vivo. The protection against depletion is observed even though the whole anti-CD4 antibody has CD4 depleting properties it self. This indicates that stronger protection against HIV-1-induced T cell depletion can be obtained by treatment with a monovalent non-depleting anti-CD4 antibody such as an anti-CD4 HG antibody. Proof of principle for HIV-1 neutralization by anti-CD4 HG and protection against CD4 depletion can be obtained in a similar experimental set-up. This provides evidence that HuMax-CD4 HG showing a long in vivo half life, could inhibit HIV-1 infection and HIV-1 viral load and protect from depletion of CD4 positive cells.
(435) Summary of the Results
(436) The data presented in the examples shows that expression of a hingeless IgG4 antibody by destroying the splice donor site of the hinge exon results in hingeless IgG4 half-molecules (one heavy and one light chain combined). The presence of IgG4 hingeless half-molecules is confirmed by SDS-PAGE under non-reducing conditions, mass spectrometry, size exclusion chromatography and radio immuno assay the absence of cross-linking abilities. The hingeless antibodies retain the same antigen binding specificity as natural format IgG1 and IgG4 antibody molecules. This is shown for two hingeless antibodies with different specificity, 7D8-HG (specific for the B-cell antigen CD20) and Betv1-HG (specific for the Birch pollen antigen Bet v 1). C1q binding of 7D8-HG is absent and only minor complement-dependent cellular toxicity (ADCC) is observed (comparable to the natural format 7D8-IgG4 antibody). Monovalency of the hingeless half-molecule is shown in the crosslinking experiment using Betv1-HG. Whereas both IgG1 and IgG.sub.4 show crosslinking of Sepharose bound Bet v 1 to radiolabelled Bet v 1, the hingeless molecule Betv1-HG is unable to crosslink.
(437) Half-life of 7D8-HG is evaluated in vivo in a mouse pharmacokinetic (PK) experiment and compared with 7D8-IgG4. Although 7D8-HG has a 2 to 3 times faster clearance than normal IgG4 in this model, the 6 day half-life is counted favorable to the half-life of less than one day reported for IgG F(ab)2 fragments. We conclude that the favorable PK-profile will make IgG4-hingeless antibodies valuable for therapeutic applications when a non-crosslinking, monovalent and non-complement-activating antibody is needed.
Example 61
(438) Constructions and Biochemical Analysis of CH3 Variants of 2F8-HG
(439) To prevent dimerization irrespective of the presence of irrelevant antibodies, additional mutations were introduced into the CH3 region. To make the constructs for the expression of the CH3 mutants, the mutations were introduced into pTomG42F8HG using site-directed mutagenesis. The constructs were expressed transiently. In order to investigate whether CH3 variant HG molecules exist as monomers or dimers, a mass spectrometry method was employed as described above.
(440)
(441) The monomer or dimer configuration of CH3 mutants was verified using NativePAGE Novex Bis-Tris gel electrophoresis (Invitrogen, Carlsbad, Calif.) according to the instructions of the manufacturer as shown in
(442) Under these experimental conditions, 2F8-HG (WT) and R277K and R277A showed a protein band corresponding to the size of a full tetrameric (two heavy and two light chains) molecule. The CH3 mutants T234A, L236A, L236V, F273A, F273L, and Y275A were shown to be half molecules (only one heavy and one light chain).
Example 62
(443) Functional analysis of CH3 Mutants of 2F8-HG
(444) Binding of 2F8-HG (WT) and variants was determined in the absence and presence of 200 g/ml polyclonal human IgG (Intravenous Immunoglobulin, IVIG, Sanquin Netherlands) (as described in Example 57).
(445)
Example 63
(446) Functional Analysis of CH3 Mutants of 2F8-HG
(447) CH3 mutants of 2F8-HG were shown to bind EGFr with lower apparent affinities than 2F8-HG in a binding ELISA coated with EGFr protein (see above). The potency of 2F8-HG CH3 mutants to inhibit ligand-induced EGFr phosphorylation in cells in vitro was compared to that of 2F8-HG (WT) and 2F8-Fab fragments in the Phosphorylation Inhibition Assay (PIA) as described in example 54.
(448) CH3 HG mutants were less potent to inhibit EGFr phosphorylation than 2F8-HG (WT) and the control mutants R277K and R277A, in line with the increase in monomer/dimer ratio of these mutants (
Example 64
(449) Concentration Dependent Configuration of CH3 Mutants of HG
(450) The monomer/dimer configuration of CH3 mutants F273A, L236V, and Y275A was further investigated at different concentrations, ranging from 0.01-10 M using non-covalent nano-electrospray mass spectrometry as described above. The monomer/dimer configuration of these CH3 mutants was compared to the configuration of 2F8-HG (WT) and R277K.
(451) The percentage molecules present as monomers at each concentration were plotted and EC50 values were calculated for each mutant (
(452) All HG mutants were 100% monomeric at low concentrations (except for R277K which behaved as dimer). With increased concentration of HG mutants, a decrease in monomericity was observed. However, the figure shows that the CH3 mutants exhibited such decrease in monomericity at much higher concentration than 2F8-HG (WT). Hence, the CH3 mutants contained a higher percentage of monomer molecules at higher molar concentrations.
Example 65
(453) Production of Human Monovalent Antibodies Against EGFr in a Non-Human Transgenic Mouse
(454) A transgenic C57BL/6J mice strain is used to generate human monovalent antibodies against EGFr. The mouse strain is homozygous for a transgene comprising, in operable linkage, a plurality of human V genes, a plurality of human D genes, a plurality of human J genes, and a plurality of human C.sub.H genes and associated isotype switch sequences, comprising a human C.sub.H gene and a C.sub.H gene as set forth in SEQ ID NO:15. Furthermore, the endogenous mouse immunoglobulin heavy chain gene locus, the endogenous mouse immunoglobulin light chain gene locus and the endogenous mouse immunoglobulin light chain gene locus have been inactivated.
(455) The below immunization schedule is used. Mice are immunized twice with A 431 cells, cultures in High Glucose DMEM, followed by soluble antigen in Ribi Adjuvant. The EGFR specific serum titer is determined by ELISA after the third immunization. Three different immunizations are performed for the final boosts before the fusion. These include two or three sequential intravenous (iv) boosts via the tail vein with 10 g of antigen in 50 l PBS or two sequential intraperitoneal (i.p.) boosts with 25 g soluble EGFr in Ribi adjuvant.
(456) TABLE-US-00003 Immunization Schedule ELISA EGFR ELISA EGFR A431 cells A431 cells Titer in Ribi ip Titer Fusion in RIBI ip Fusion Mouse Day 1 Day 20 Day 30 Day 33 Day 43 Day 46 Day 50 Day 53 #1 2 10.sup.6 1 10.sup.7 0 25 g Titer 25 g Ribi determination 2 25 g*** #2 2 10.sup.6 1 10.sup.7 0 25 g Titer 25 g 2 iv determination 10 g** #3 2 10.sup.6 1 10.sup.7 450 25 g Titer 3 iv determination 10 g* *EGFR in PBS (10 g) iv (tail) on days 4, 3, and 2 **EGFR in PBS (10 g) iv (tail) on day 4, and 3 ***EGFR in Ribi (25 g) ip on day 4 and 3
Mice showing a robust response level to EGFr after repeated immunizations are prepared for fusion according to standard procedures.
Example 66
(457) Hybridoma Preparation
(458) The P3 X63 ag8.653 myeloma cell line (ATCC CRL 1580, lot F-15183) is used for the fusions. The original ATCC vial is thawed and expanded in culture. A seed stock of frozen vials is prepared from this expansion. A fresh vial of cells is thawed one to two weeks before the fusions.
(459) High Glucose DMEM (Mediatech, Cellgro #10013) containing 10% FBS, Pennicillin-Streptomycin (Sigma, P-7539), and 5.510.sup.5M 2-mercaptoethanol (GibcoBRL, 21985-023) is used to culture myeloma cells. Additional media supplements are added to the hybridoma growth media, which includes: 3% Origin-Hybridoma Cloning Factor (Igen, 21001), OPI supplement (Sigma, 0-5003), 1.110.sup.3 M Oxalo acetic acid, 4.510.sup.4 M sodium Pyruvate, and 24 international units/L bovine Insulin, HAT (Sigma, H 0262) 1.010.sup.4 M Hypoxanthine, 4.010.sup.7 M Aminopterin, 1.610 .sup.5 M Thymidine, or HT (Sigma, H0137) 1.010.sup.4 M Hypoxanthine, 1.610 .sup.5 M Thymidine. Characterized Fetal bovine serum (5H30071 lot #s AJE10321 and AGH6843) may be obtained from Hyclone, Logan, Utah. Serum Free medium contains DMEM, antibiotics and 2-mercaptoethanol only.
(460) The splenocytes from the immunized mice are fused to the myeloma cell line according to standard procedures.
(461) The initial ELISA screen for human IgG4 antibodies is performed 7-10 days post fusion. Human IgG4, positive wells are screened on soluble EGFR coated ELISA plates. Antigen positive hybridomas are transferred to 24 well plates and eventually to tissue culture flasks. EGFR specific hybridomas are subcloned by limiting dilution to assure monoclonality. Antigen positive hybridomas are preserved at several stages in the development process by freezing cells in DMEM 10% FBS plus 10% DMSO (Sigma, D2650) or in Origen Freeze Medium (Igen, #210002). Cells are stored at 80 C. or in LN.sub.2. Initial EGFR specific hybridomas are subsequently screened for desired characteristics and selected for further characterization.
(462) TABLE-US-00004 SEQUENCELISTING SEQIDNo:1:ThenucleicacidsequenceofC.sub.LkappaofhumanIgG 1 CGTACGGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCA 51 GTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATC 101 CCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGT 151 AACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAG 201 CCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAG 251 TCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAG 301 AGCTTCAACAGGGGAGAGTGT SEQIDNo:2:TheaminoacidsequenceofC.sub.LkappaofhumanIgG 1 RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSG 51 NSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTK 101 SFNRGEC SEQIDNo:3:ThenucleicacidsequenceofC.sub.LlambdaofhumanIgG 1 ACCGTCCTAGGTCAGCCCAAGGCTGCCCCCTCGGTCACTCTGTTCCCGCC 51 CTCCTCTGAGGAGCTTCAAGCCAACAAGGCCACACTGGTGTGTCTCATAA 101 GTGACTTCTACCCGGGAGCCGTGACAGTGGCCTGGAAGGCAGATAGCAGC 151 CCCGTCAAGGCGGGAGTGGAGACCACCACACCCTCCAAACAAAGCAACAA 201 CAAGTACGCGGCCAGCAGCTACCTGAGCCTGACGCCTGAGCAGTGGAAGT 251 CCCACAGAAGCTACAGCTGCCAGGTCACGCATGAAGGGAGCACCGTGGAG 301 AAGACAGTGGCCCCTACAGAATGTTCA SEQIDNo:4:TheaminoacidsequenceofC.sub.LlambdaofhumanIgG 1 TVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSS 51 PVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVE 101 KTVAPTECS SEQIDNo:5:ThenucleicacidsequencefortheV.sub.HofHuMab-7D8 1 GAAGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTACAGCCTGACAGGTC 51 CCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTCATGATTATGCCA 101 TGCACTGGGTCCGGCAAGCTCCAGGGAAGGGCCTGGAGTGGGTCTCAACT 151 ATTAGTTGGAATAGTGGTACCATAGGCTATGCGGACTCTGTGAAGGGCCG 201 ATTCACCATCTCCAGAGACAACGCCAAGAACTCCCTGTATCTGCAAATGA 251 ACAGTCTGAGAGCTGAGGACACGGCCTTGTATTACTGTGCAAAAGATATA 301 CAGTACGGCAACTACTACTACGGTATGGACGTCTGGGGCCAAGGGACCAC 351 GGTCACCGTCTCCTCA SEQIDNo:6:TheaminoacidsequencefortheV.sub.HofHuMab-7D8 1 EVQLVESGGGLVQPDRSLRLSCAASGFTFHDYAMHWVRQAPGKGLEWVST 51 ISWNSGTIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKDI 101 QYGNYYYGMDVWGQGTTVTVSS SEQIDNo:7:ThenucleicacidsequencefortheV.sub.Hofmouseanti-Betv-1 1 GAGGTTCAGCTGCAGCAGTCTGGGGCAGAGCTTGTGAAACCAGGGGCCTC 51 AGTCAAGTTGTCCTGCACAGCTTCTGGCTTCAACATTAAAGACACCTATA 101 TCCACTGGGTGAAGCAGAGGCCTGAACAGGGCCTGGAGTGGGTTGGAAGG 151 ATTGATCCTGCGACTGGCAATACTAGATATGACCCGAAGTTCCAGGGCAA 201 GGCCACTATAACAGCTGACACATCCTCCAACACAGCCTACCTGCAACTCA 251 GCAGCCTGACATCTGAGGACACTGCCGTCTATTACTGTGCTAGTTTTAGG 301 CCGGGGTATGCTCTGGACTACTGGGGTCAAGGAACCTCAGTCACCGTCTC 351 CTCA SEQIDNo:8:TheaminoacidsequencefortheV.sub.Hofmouseanti-Betv-1 1 EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYIHWVKQRPEQGLEWVGR 51 IDPATGNTRYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCASFR 101 PGYALDYWGQGTSVTVSS SEQIDNo:9:ThenucleicacidsequencefortheV.sub.LofHuMab-7D8 1 GAAATTGTGTTGACACAGTCTCCAGCCACCCTGTCTTTGTCTCCAGGGGA 51 AAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCTACTTAG 101 CCTGGTACCAACAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGAT 151 GCATCCAACAGGGCCACTGGCATCCCAGCCAGGTTCAGTGGCAGTGGGTC 201 TGGGACAGACTTCACTCTCACCATCAGCAGCCTAGAGCCTGAAGATTTTG 251 CAGTTTATTACTGTCAGCAGCGTAGCAACTGGCCGATCACCTTCGGCCAA 301 GGGACACGACTGGAGATTAAA SEQIDNo:10:TheaminoacidsequencefortheV.sub.LofHuMab-7D8 1 EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYD 51 ASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPITFGQ 101 GTRLEIK SEQIDNo:11:ThenucleicacidsequencefortheV.sub.Lofmouseanti-Betv-1 1 GACATTGTGATGACCCAGTCTCACAAATTCATGTCCACATCAGTTGGAGA 51 CAGGGTCAGCTTCACCTGCAAGGCCAGTCAGGATGTGTTTACTGCTGTAG 101 CCTGGTATCAACAAAAACCAGGGCAATCTCCTAAACTACTGATTTACTGG 151 GCATCCACCCGGCGCACTGGAGTCCCTGATCGCTTCACAGGCAGTGGATC 201 TGGGACAGATTATACTCTCACCATCAGCAGTGTGCAGGCTGAAGACCTGG 251 CACTTTATTACTGTCAGCAACATTTTAGCACTCCTCCGACGTTCGGTGGA 301 GGCACCAAGCTGGAAATCAAA SEQIDNo:12:TheaminoacidsequencefortheV.sub.Lofmouseanti-Betv-1 1 DIVMTQSHKFMSTSVGDRVSFTCKASQDVFTAVAWYQQKPGQSPKLLIYW 51 ASTRRTGVPDRFTGSGSGTDYTLTISSVQAEDLALYYCQQHFSTPPTFGG 101 GTKLEIK SEQIDNo:13:ThenucleicacidsequenceofthewildtypeC.sub.Hregionof humanIgG4 1 GCTAGCACCAAGGGCCCATCCGTCTTCCCCCTGGCGCCCTGCTCCAGGAG 51 CACCTCCGAGAGCACAGCCGCCCTGGGCTGCCTGGTCAAGGACTACTTCC 101 CCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTG 151 CACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAG 201 CGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACGAAGACCTACACCTGCA 251 ACGTAGATCACAAGCCCAGCAACACCAAGGTGGACAAGAGAGTTGGTGAG 301 AGGCCAGCACAGGGAGGGAGGGTGTCTGCTGGAAGCCAGGCTCAGCCCTC 351 CTGCCTGGACGCACCCCGGCTGTGCAGCCCCAGCCCAGGGCAGCAAGGCA 401 TGCCCCATCTGTCTCCTCACCCGGAGGCCTCTGACCACCCCACTCATGCT 451 CAGGGAGAGGGTCTTCTGGATTTTTCCACCAGGCTCCGGGCAGCCACAGG 501 CTGGATGCCCCTACCCCAGGCCCTGCGCATACAGGGGCAGGTGCTGCGCT 551 CAGACCTGCCAAGAGCCATATCCGGGAGGACCCTGCCCCTGACCTAAGCC 601 CACCCCAAAGGCCAAACTCTCCACTCCCTCAGCTCAGACACCTTCTCTCC 651 TCCCAGATCTGAGTAACTCCCAATCTTCTCTCTGCAGAGTCCAAATATGG 701 TCCCCCATGCCCATCATGCCCAGGTAAGCCAACCCAGGCCTCGCCCTCCA 751 GCTCAAGGCGGGACAGGTGCCCTAGAGTAGCCTGCATCCAGGGACAGGCC 801 CCAGCCGGGTGCTGACGCATCCACCTCCATCTCTTCCTCAGCACCTGAGT 851 TCCTGGGGGGACCATCAGTCTTCCTGTTCCCCCCAAAACCCAAGGACACT 901 CTCATGATCTCCCGGACCCCTGAGGTCACGTGCGTGGTGGTGGACGTGAG 951 CCAGGAAGACCCCGAGGTCCAGTTCAACTGGTACGTGGATGGCGTGGAGG 1001 TGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTTCAACAGCACGTAC 1051 CGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAACGGCAA 1101 GGAGTACAAGTGCAAGGTCTCCAACAAAGGCCTCCCGTCCTCCATCGAGA 1151 AAACCATCTCCAAAGCCAAAGGTGGGACCCACGGGGTGCGAGGGCCACAT 1201 GGACAGAGGTCAGCTCGGCCCACCCTCTGCCCTGGGAGTGACCGCTGTGC 1251 CAACCTCTGTCCCTACAGGGCAGCCCCGAGAGCCACAGGTGTACACCCTG 1301 CCCCCATCCCAGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCT 1351 GGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATG 1401 GGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGAC 1451 GGCTCCTTCTTCCTCTACAGCAGGCTAACCGTGGACAAGAGCAGGTGGCA 1501 GGAGGGGAATGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACC 1551 ACTACACACAGAAGAGCCTCTCCCTGTCTCTGGGTAAA SEQIDNo:14:TheaminoacidsequenceofthewildtypeC.sub.Hregionof humanIgG4 1 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGV 51 skstsggtaalgclvkdyfpepvtvswnsgaltsgv 51