MODIFIED MICROORGANISMS EXPRESSING SAGA AS ANTI-INFECTIVE AGENTS, PROBIOTICS AND FOOD COMPONENTS
20190211067 ยท 2019-07-11
Inventors
- Howard Hang (New York, NY, US)
- Kavita Rangan (New York, NY, US)
- Daniel Mucida (New York, NY, US)
- Virginia Pedicord (New York, NY, US)
Cpc classification
A61K2035/11
HUMAN NECESSITIES
A23C9/1234
HUMAN NECESSITIES
A61K35/744
HUMAN NECESSITIES
A23V2002/00
HUMAN NECESSITIES
A23L33/135
HUMAN NECESSITIES
International classification
A23C9/123
HUMAN NECESSITIES
A23L33/135
HUMAN NECESSITIES
A23C9/12
HUMAN NECESSITIES
Abstract
Provided are compositions and methods based in part on the discovery that Enterococcus faecium heterologous secreted antigen A (SagA)-produced peptidoglycan fragments are protective against enteric bacterial infections. Modified bacteria that are engineered to express heterologous SagA are provided, and are included a nutraceutical, pharmaceutical, and probiotic formulations, and as components of food products, including dairy products. The modified bacteria include modified Lactobacillus bacteria that express heterologous SagA. The disclosure includes a method that involves introducing into an individual modified bacteria of that express and secrete heterologous SagA. The disclosure provides isolated peptidoglycan fragment preparations made by a exposing a composition that contains peptidoglycan to an isolated or recombinant SagA, or to modified bacteria expressing a heterologous SagA, allowing SagA to generate the peptidoglycan fragments, and separating the peptidoglycan fragments from the composition to obtain the isolated peptidoglycan fragments or a preparation that contains them.
Claims
1. Modified bacteria that express heterologous secreted antigen A (SagA), wherein the modified bacteria are not E. coli.
2. The modified bacteria of claim 1, wherein the modified bacteria are gram positive bacteria.
3. The modified bacteria of claim 2, wherein the gram positive bacteria are Lactobacillus bacteria.
4. The modified bacteria of claim 3, wherein the Lactobacillus bacteria are L. plantarum, L. casei or L. acidophilus.
5. The modified bacteria of claim 1, wherein the heterologous SagA is Enterococcus faecium SagA.
6. The modified bacteria of claim 1, wherein the modified bacteria are present in a gastrointestinal system of a human.
7. A food product for human or non-human animal consumption comprising live modified bacteria of claim 1.
8. The food product of claim 7 wherein the food product is a dairy product.
9. The food product of claim 8, wherein the dairy product is a yogurt.
10. A probiotic formulation comprising the modified bacteria of claim 1.
11. A method comprising introducing into an individual modified bacteria of claim 1, wherein the modified bacteria express and secrete heterologous secreted antigen A (SagA).
12. The method of claim 11, wherein the modified bacteria are introduced as a component of a food product, a probiotic formulation, or a pharmaceutical formulation.
13. The method of claim 11, wherein the individual is at risk for contracting an enteric bacterial infection, or the individual is suspected of having or has been diagnosed with an enteric bacterial infection.
14. Isolated peptidoglycan fragments made by a process comprising the steps of exposing a composition comprising peptidoglycan to an isolated or recombinant SagA, or to modified bacteria expressing a heterologous SagA, allowing SagA to generate the peptidoglycan fragments, and separating the peptidoglycan fragments from the composition to obtain the isolated peptidoglycan fragments.
15. A composition comprising isolated peptidoglycan fragments made by the process of claim 14.
16. The method of claim 12, wherein the individual is at risk for contracting an enteric bacterial infection, or the individual is suspected of having or has been diagnosed with an enteric bacterial infection.
Description
DESCRIPTION OF THE FIGURES
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
DETAILED DESCRIPTION OF THE INVENTION
[0035] The present disclosure is based in part on our discovery that Enterococcus faecium can inhibit pathogenesis by various strains of bacteria, including Salmonella enterica serovar Typhimurium and Clostridium difficile. Inhibition of pathogenesis is shown in Caenorhabditis elegans, which has historically been used as a model organism to study evolutionarily conserved aspects of innate immunity and microbial pathogenesis, but the inhibition of pathogenesis is also demonstrated in mice. In particular, it is demonstrated that C. elegans survival can be dramatically increased by feeding the worms E. faecium prior to infection with S. Typhimurium, as compared to worms fed control bacterial strains, and that this protective effect is unexpectedly mediated by E. faecium secreted antigen A (SagA). We determined that SagA exhibits peptidoglycan hydrolase activity and generates cell wall fragments which, without intending to be constrained by any particular theory, are believed to activate host immunity to inhibit pathogenesis. We further show that recombinant expression of SagA in non-protective commensal bacteria is sufficient for mediating host protection against pathogenic bacteria, not only in C. elegans, but also in a mouse model, wherein engineered microbes that express heterologous SagA recombinantly can extend survival of the mice after challenge with S. Typhimurium. Thus, SagA itself, and modified microorganisms which have been engineered to express SagA heterologously, are provided for use in prophylaxis and/or therapy of infections caused by a variety of enteric microbial pathogens. Microorganisms engineered to express SagA are also provided as probiotic microbes. Such microbes include but are not necessarily limited to members of the Lactobacillus genus. The probiotic microbes can be provided as pharmaceutical or nutraceutical formulations, as components of human or non-human animal food items. Moreover, we demonstrate that introducing SagA producing E. faecium into mice limits Clostridium difficile pathogenesis. The disclosure also includes preparations of cell wall fragments produced by the enzymatic activity of SagA. Thus, the disclosure encompasses or SagA-generated metabolites as further described below.
[0036] In one aspect the present disclosure provides a modified microorganism, wherein the organism expresses a heterologous SagA. A modified microorgism means that the microorganism has been changed relative to its naturally occurring form, such as having been engineered to express a heterologous protein. A heterologous SagA protein is a SagA protein that is not normally encoded by the genome of the microorganism. Accordingly, heterologous SagA production involves introducing a SagA-encoding DNA sequence into the microorganism. The modified microorganism comprises a heterologous SagA coding sequence, the expression of which is driven by a promoter operative in the microorganism. The SagA protein can be expressed from any suitable expression vector or other construct introduced into the microorganism. In embodiments the heterologous SagA is encoded by a plasmid introduced into the modified microorganism, or is encoded by a segment of DNA introduced into a bacterial chromosome. Many reagents and methods for introducing and expressing any heterologous gene in a wide variety of microorganisms are known in the art and are suitable for use with the present invention. In general, the disclosure contemplates microorganisms that are modified to express and secrete heterologous SagA that retains the ability to generate peptidoglycan fragments from a suitable peptidoglycan-containing substrate. In one embodiment, the recombinantly produced SagA protein comprises the E. faecium amino acid sequence:
[0037] MKKSLISAVMVCSMTLTAVASPIAAAADDFDSQIQQQDQKIADLKNQQADAQS QIDALESQVSEINTQAQDLLAKQDTLRQESAQLVKDIADLQERIEKREDTIQKQAREAQ VSNTSSNYIDAVLNADSLADAIGRVQAMTTMVKANNDLMEQQKQDKKAVEDKKAEN DAKLKELAENQAALESQKGDLLSKQADLNVLKTSLAAEQATAEDKKADLNRQKAEAE AEQARIREQQRLAEQARQQAAQEKAEKEAREQAEAEAQATQASSTAQSSASEESSAAQ SSTTEESSSAAQSSTTEESTTAPESSTTEESTTAPESSTTEE STTVPESSTTEESTTVPESSTT EESTTVPES STTEESTTVPETSTEESTTPAPTTPSTDQSVDPGNSTGSNATNNTTNTTPTPT P SGSVNGAAIVAEAYKYIGTPYVWGGKDPSGFDCSGFTRYVYLQVTGRDIGGWTVPQE SAGTKISVSQAKAGDLLFWGSPGGTYHVAIALGGGQYIHAPQPGESVKVGSVQWFAPD FAVSM (SEQ ID NO:1), or a sequence that has at least 90% identity to this sequence, provided such non-identical sequences retain N1pC/p60-type hydrolase activity, which is described further below. As can be seen from
[0038] In embodiments, the SagA protein is modified so that it has, for example, additional or fewer amino acids than in the sequence presented above. In non-limiting examples, the SagA protein is modified to include additional amino acids used for isolation, purification, or detection, including but not necessarily limited to a series of histidine residues at the C-terminus, or a polypeptide sequence that is capable of producing a detectable signal, such as a fluorescent signal.
[0039] In embodiments, the disclosure includes modified gram negative bacteria that expresses heterologous SagA protein, with the proviso that the gram negative bacteria do not include Escherichia coli. In embodiments, the disclosure includes modified bacteria that are facultative anaerobes. In embodiments the modified bacteria are gram positive bacteria that expresses heterologous SagA protein. In embodiments the gram positive bacteria are members the
[0040] Lactobacillus genus, and in particular Lactobacillus species that are active in the production of food products intended for human and/or non-human animal consumption. In non-limiting embodiments the modified bacteria are Lactobacillus species that are active in the production of dairy products, such as yogurt, milk, milk-based creams, ice cream products, and cheese, or fermented drinks, such as wine, cider and beer, or fermented foods, or combinations of the foregoing. In certain embodiments the modified bacteria are L. plantarum, L. casei, L. acidophilus, L. salivarius, or L. reuteri as well as probiotic strains of Bifidobacterium (i.e. B. longum). Data demonstrating successful heterologous production of SagA in several distinct microorganisms are provided.
[0041] In embodiments the disclosure includes combinations of modified bacteria described herein, and further comprises combinations of the modified bacteria with other microorganisms, such as yeasts. Those skilled in the art will recognize that such combinations are useful for production of certain foods.
[0042] In another aspect the disclosure comprises a food product comprising a modified bacteria that expresses a heterologous SagA protein. Such products include all of the aforementioned types of food and modified bacteria, and may further include modified E. coli that expresses a heterologous SagA. In embodiments the food product is a dairy product, including but not necessarily limited to yogurt, milk, milk-based creams, and cheese. Use of microorganisms in making foods that intentionally contain live cultures, such as yogurts, are well known in the art and can be adapted for use with the presently provided modified microorganisms. In one aspect the food product is a non-human animal feed, such as food intended for consumption by a bovine, equine, canine, porcine, feline, avian or reptilian animal, or by aquatic animals such as fish. In certain aspects the food product comprises packaging, such as a paper or cardboard carton, plastic container, bottle, bag, etc., that are well known for containing foods. The packaging can provide printed material which includes information that identifies the modified bacteria present in the food product.
[0043] In another aspect the disclosure includes a supplement product, such as a nutraceutical product, a dietary supplement, a food ingredient, etc., including but not limited to a probiotic formulation or functional food that contains one or more live modified bacteria as described herein. The supplement product can be provided in the form of, for example, a liquid, capsules, tablets, softgels, powders, freeze-dried compositions, and the like.
[0044] In another aspect the disclosure provides a pharmaceutical composition comprising modified microorganisms and/or isolated or purified recombinant SagA as described herein. The pharmaceutical composition can include any suitable diluent, carrier, excipient, buffer, etc., intended for use with the microorganisms for prophylactic and/or therapeutic human or veterinary purposes. Some examples of compositions suitable for preparing pharmaceutical compositions can be found in: Remington: The Science and Practice of Pharmacy (2005) 21st Edition, Philadelphia, Pa. Lippincott Williams & Wilkins. Such compositions may also be included in supplement products.
[0045] In an embodiment the disclosure includes making modified bacteria that express heterologous SagA for use in inhibiting bacterial infections, or for maintaining or modifying the intestinal flora of an individual. The method comprises introducing into bacteria a heterologous SagA encoding DNA sequence, and culturing the bacteria for use as a probiotic, nutraceutical or pharmaceutical agent. In embodiments, the disclosure comprises such bacterial cultures themselves, and further includes such cultures scaled for use in producing nutraceutical, probiotic and/or pharmaceutical preparations. In embodiments, the cultures are propagated as, for example, a yogurt culture.
[0046] In another aspect the present disclosure comprises a composition comprising isolated or purified cell wall fragments generated by SagA. In certain embodiments the disclosure includes isolated and/or purified cell wall fragments (i.e, SagA-generated metabolites) made by a process that comprises exposing a peptidoglycan containing composition of matter, such as gram negative bacteria, or a composition comprising gram negative bacteria cell walls, or another peptidoglycan containing material, to SagA, allowing SagA to generate peptidoglycan fragments, and separating the peptidoglycan fragments from the composition and the SagA to obtain an isolated peptidoglycan fragment preparation. In embodiments the SagA-generated metabolites/peptidoglycan fragment preparation comprise muramyl peptides, i.e., muropeptides. Separating the peptidoglycan fragments can be achieved using any suitable approach, including but not necessarily limited to filtration, size exclusion and column-based separation, affinity separation, etc. As is demonstrated in the Examples of this disclosure, peptidoglycan fragments can protect worms and mice from distinct types of bacterial pathogenesis. Thus, the disclosure provides a process for producing peptidoglycan fragments, and a peptidoglycan fragment preparation comprising or consisting of peptidoglycan fragments produced by that process, wherein such peptidoglycan fragment preparations are useful for the prophylaxis and/or therapy of bacterial infections.
[0047] In another aspect the disclosure includes a method comprising introducing into an individual modified bacteria wherein the modified bacteria expresses a heterologous SagA. The modified bacteria can be introduced as a component of a food product, a probiotic formulation, or a pharmaceutical formulation. In an aspect the disclosure includes a method for prophylaxis and/or therapy of a bacterial infection in an individual. The method comprises administering to an individual in need a composition comprising isolated SagA, or a bacterial population wherein at least some members of the population have been modified to produce SagA. In another approach, the composition can comprise peptidoglycan fragments generated by SagA. Compositions and uses thereof comprising combinations of peptidoglycan fragments generated by SagA, modified bacteria that express SagA and isolated SagA are also encompassed by this disclosure. Compositions of the disclosure may be used prophylactically when they are given to an individual prior to exposure to pathologic bacteria, or within a short time, i.e., several hours, after exposure to pathologic bacteria. Therapeutic approaches comprise administering the engineered bacteria to an individual who has or is suspected of having a bacterial infection, wherein the severity of the infection is lessened subsequent to the administration.
[0048] In embodiments, administering a composition to an individual for, for instance, prophylaxis and/or therapy of a bacterial infection according to this disclosure can be performed using any suitable approach. In one embodiment, the composition is consumed by the individual as a probiotic formulation, or as a component of a food item and is thus introduced orally. In another embodiment the composition is administered as a pharmaceutical formulation. The pharmaceutical formulation can be administered using any suitable route, including but not necessarily limited to parenteral, intraperitoneal, intrapulmonary, oral, intra-abdominal, and others. Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, and subcutaneous administration.
[0049] The amount of modified bacteria, SagA, peptidoglycan fragments, and any other active agent to be included in a composition and/or to be used in the method can be determined by those skilled in the art, given the benefit of the present disclosure. Thus, in one embodiment, an effective amount of a composition is administered. An effective amount can be an amount of the composition that inhibits growth of bacterial cells in the individual, or reduces a sign or symptom of bacterial infection. In embodiments, the individual to whom a composition of the invention is administered has, is suspected of having, or is at risk for development of a bacterial infection. In embodiments, the bacterial infection is an infection by enteric pathogens such as strains of Salmonella, Escherichia coli, Shigella, Campylobacter, Helicobacter, Francisella, Vibrio, Yersinia, Enterococcus, and pathogenic strains of microbiota. In embodiments, a composition of this disclosure is administered to an individual such that the growth of enteric pathogens in the individual is inhibited, and/or the amount of enteric pathogens is reduced, or the enteric pathogens are eradicated.
[0050] Suitable dosages for either therapeutic or prophylactic purposes can be determined by those skilled in the art and will be based, at least in part, on consideration of the individual's age, sex, size, and health, the type of bacterial infection, and other factors as will be apparent to the skilled artisan. In embodiments, a composition of the invention can be administered in combination with an antibiotic.
[0051] The following description and specific Example is provided to illustrate the invention, but are not intended to be limiting in any way.
EXAMPLE 1
[0052] This Example uses Caenorhabditis elegans to reconstitute Enterococcus faecium probiotic activity and identify a specific factor that enhances host resistance against enteric pathogens. Through biochemical, proteomic, and genetic approaches, we show that secreted SagA from E. faecium is sufficient to protect animals against Salmonella pathogenesis. Secreted SagA is also protective against other pathogenic microorganisms. Without intending to be constrained by any particular theory, the data show that SagA does not affect pathogen growth or virulence, but instead engages tol-1 -dependent signaling to enhance host resistance to enteric pathogens. Biochemical studies demonstrate that the N1pC/p60 peptidoglycan hydrolase activity of SagA is required, and peptidoglycan fragments, i.e., muramyl-peptide fragments, generated by SagA are sufficient to protect C. elegans against Salmonella pathogenesis in a tol1-dependent manner. This Example thus describes discovery of probiotic factors that can be used to enhance host resistance to pathogens. Such probiotic factors include but are not necessarily limited to SagA, catalytically active fragments of it, and muramyl-peptide fragments generated by SagA.
[0053] To facilitate our discovery and characterization of specific protective factors from intestinal bacteria and to develop compositions and methods of using them as described above, we employed C. elegans as a model organism, which has been widely used to study evolutionarily conserved aspects of innate immunity and microbial pathogenesis. We focused on Enterococci lactic acid bacteria that are commonly associated with the intestinal microbiome of diverse animal species ranging from humans to flies. Drug-resistant strains of E. faecium have emerged as nosocomial pathogens, but non-pathogenic strains of E. faecium can attenuate host susceptibility to enteric pathogens, including Salmonella, and have been employed as probiotics in humans and other animals (C. M. Franz, M. Huch, H. Abriouel, W. Holzapfel, A. Galvez, Enterococci as probiotics and their implications in food safety. Int J Food Microbiol 151, 125 (Dec 2, 2011)). Nevertheless, the protection mechanisms of E. faecium are unclear, which limits their utility as probiotics. Interestingly, E. faecium can colonize the C. elegans intestine without causing apparent disease, which provided a unique opportunity to characterize the protective factors and conserved mechanisms underlying E. faecium probiotic activity. To investigate whether E. faecium can attenuate the pathogenesis of enteric bacteria in C. elegans we developed a treatment-infection assay with Salmonella enterica serovar Typhimurium (
[0054] To evaluate the mechanism of E. faecium-mediated protection, we first analyzed the effect of E. faecium treatment on S. Typhimurium colonization and persistence. Fluorescence imaging of mCherry-S. Typhimurium 3 days post-infection showed comparable S. Typhimurium colonization of animals with or without E. faecium treatment (
[0055] We next explored whether specific factors produced by E. faecium were sufficient for protection against S. Typhimurium pathogenesis. Using a liquid-treatment infection assay (
[0056] Analysis of sequenced E. faecium strains suggests they all encode a sagA ortholog in their genomes. In contrast, sequenced E. faecalis strains do not encode a clear sagA ortholog in their genomes and have not been reported to inhibit S. Typhimurium pathogenesis. For example, E. faecalis OG1RF encodes three putative N1pC/p60-type peptidoglycan hydrolases (Uniprot accession: F2MNS9, F2MN84, F2MNY6) with less than 40 percent protein sequence identity to SagA (
[0057] The protective activity of E. faecium against multiple enteric pathogens indicated that SagA may engage host pathways to limit pathogenesis. In response to intestinal infection, C. elegans mounts both general and pathogen-specific immune responses, which can lead to behavioral changes as well as the expression of antimicrobial and stress response effectors. The C. elegans innate immune system comprises both constitutive and induced signaling pathways, many with homology to mammalian pathways. Literature regarding C. elegans immunity-associated mutants indicates no major roles for the p38 MAPK/Pmk-1 pathway, the TGF--like/Db1-1 pathway, the insulin-like receptor/Daf-2 pathway, or the Npr-1 mediated pathogen avoidance pathway in E. faecium-mediated protection against S. Typhimurium infection (
[0058] To determine the mechanism by which SagA enhances host resistance, we evaluated the N1pC/p60 hydrolase activity of SagA. SagA contains a type-1 signal sequence, an uncharacterized N-terminal coiled-coil domain, a linker region of Ser/Thr-rich repeats, and a C-terminal N1pC/p60-type hydrolase domain (M. Firczuk, M. Bochtler, Folds and activities of peptidoglycan amidases. FEMS Microbiol Rev 31, 676 (Nov, 2007)); (
[0059] Although SagA is suggested to be essential for E. faecium viability, no hydrolase activity has been described. To determine if the N1pC/p60-type hydrolase domain of SagA is required for protection of C. elegans, we generated an active site (AS) mutant as well as a C-terminal N1pC/p60-type hydrolase domain deletion (Ctrunc) mutant of SagA (
[0060] We analyzed whether SagA could hydrolyze peptidoglycan fragments derived from digested bacteria in the C elegans intestine, and whether these fragments may be responsible for enhancing host resistance. We found that the flow-thru from 5 kDa-MWCO column-filtered culture supernatants of E. coli expressing SagA, but not the active site mutant, protected C. elegans from S. Typhimurium pathogenesis (
[0061] C. elegans treated with the SagA peptidoglycan digests survived similarly to SagA-treated animals, whereas active site mutant digests failed to attenuate S. Typhimurium pathogenesis (
[0062] To identify the peptidoglycan fragment(s) generated by SagA, we analyzed filtered bacterial culture supernatants by ANTS labeling and gel-based profiling using established techniques. From E. coli expressing SagA, we detected a SagA-specific ANTS-labeled product that migrated similarly to the ANTS-labeled synthetic peptidoglycan components MurNAc-L-Ala and GlcNAc, but not to MurNAc-L-Ala-D-Glu (MDP) or MurNAc (
[0063] It will be recognized from the foregoing that the N1pC/p60 hydrolase activity of SagA generates unique peptidoglycan fragments in vivo that activate host immune signaling to enhance epithelial barrier integrity and confine pathogens to the intestinal lumen (
[0064] Materials and Methods.
[0065] Strains. C. elegans were maintained as described (I). C. elegans strains npr-1(ad609), daf-16(mu86), daf-2(e1370); daf-16(mgDf47), pmk-1(km25), dbl-1(nk3), and tol-1(nr2033) were all provided by the Caenorhabditis Genetics Center. E. coli OP50, E. coli DH5, E. coli BL21-RIL(DE3) (Agilent Technologies), and Salmonella enterica serovar Typhimurium strain IR715 were grown in LB (BD Difco). Enterococcus faecium strains NCTC 7171 (ATCC 19434), Com15, Com12, and TX0016 (DO, ATCC BAA- 472), Enterococcus faecalis strains OG1RF (ATCC 47077) and V583 (ATCC 700802), and Bacillus subtilis strain 168 were grown in BHI (BD BBL). When necessary, ampicillin was used at 100 g/mL, gentamicin was used at 125 g/mL, and chloramphenicol was used at 25 g/mL for E. coli, 10 g/mL for E. faecium, and 8 g/mL for E. faecalis.
[0066] Plasmids Described in This Study.
[0067] SagA hydrolase domain prediction was determined using Phyre 2 software. Coiled coil domain prediction were determined using COILS software. Signal sequence prediction was determined using SignalP v4.1 software.
TABLE-US-00001 Name Backbone Description pET21a-SagA pET21a (Novagen) Amp.sup.R, SagA-His.sub.6 pET21a-AS pET21a Amp.sup.R, AS-His.sub.6; C443A, H494A, H506A pET21a-Cterm pET21a Amp.sup.R, Cterm-His.sub.6; 390-529 pET21a-SagA-SS pET21a Amp.sup.R, SagA-SS-His.sub.6; 2-27 pAM401-SagA pAM401 Cam.sup.R, psagA:SagA-His.sub.6 (ATCC 37429) pAM401-psagA:mcherry pAM401 Cam.sup.R, psagA:mcherry pTEX5501ts-OG1RF-sagA pTEXC5501ts Cam.sup.R, Gen.sup.R, *see below p67MC1 Amp.sup.R, mcherry
[0068] Cloning strategies: All cloning was done in E. coli DH5. pET21a constructs were transformed into E. coli BL21-RIL (DE3) for expression. pAM401 constructs were transformed into E. faecium for expression.
[0069] pET21a-SagA:
[0070] sagA was PCR amplified from the E. faecium Com15 genome using the following primers:
TABLE-US-00002 FW: (SEQIDNO:2) GGACATATGAAAAAGAGTTTAATATCAGCAGTAATGG RV: (SEQIDNO:3) GGACTCGAGCATGCTGACAGCAAAGTCAGGTGCAAAC
[0071] Restriction sites for Nde1 and Xho1 are italicized. The PCR product was gel purified and subcloned into pGEMTeasy (Promega) for sequencing. Then, an internal Nde1 site was mutated using the Quikchange multi-site directed mutagenesis kit (Stratagene) using the following primer:
TABLE-US-00003 (SEQIDNO:4) AAATATATCGGTACTCCtTATGTTTGGGGCGG
[0072] The site mutated is indicated in lowercase, resulting in a synonymous mutation in the SagA protein sequence. sagA was then excised from pGEMTeasy with Nde1 and Xho1 and was ligated into cut pET21a (Novagen).
[0073] pET21a-AS: pET21a-SagA was mutagenized with the following primers to generate the indicated cysteine to alanine and histidine to alanine mutations in the SagA protein sequence:
TABLE-US-00004 C443A: (SEQIDNO:5) CCAAGTGGATTTGACgcCTCAGGATTCACACG H494A: (SEQIDNO:6) TCACCAGGCGGAACTTACgcCGTAGCGATTGC H506A: (SEQIDNO:7) GGAGGACAATATATCgcTGCTCCTCAACCAGG
[0074] The mutated sites are indicated in lowercase.
[0075] pET21a-Cterm: pet21a-SagA was mutagenized with the following primers to insert BamH1 sites flanking the hydrolase domain:
TABLE-US-00005 (SEQIDNO:8) AACAGATCAAAGTGTgGATCCTGGGAACAGTACTGG (SEQIDNO:9) TGCACCTGACTTTGCgGatccCATGCTCGAGCACCAC
[0076] The BamH1 sites are italicized. The mutated sites are indicated in lowercase. The plasmid was then cut with BamH1 and re-ligated to form pET21a-Cterm, resulting in an in-frame excision of residues 390 through 529 in the SagA protein sequence.
[0077] pET21a-SagA-SS: SagA-SS was PCR amplified from pET21a-SagA BamH1 (see pAM401-SagA section below) using the following primers:
TABLE-US-00006 FW: (SEQIDNO:10) CATCACCATATGGACGATTTTGATTCTCAGATA RV: (SEQIDNO:11) CATCACGGATCCTTTCGGGCTTTGTTA
[0078] The Nde1 and BamH1 sites are italicized. This PCR product was cut and ligated back into cut pET21a-SagA BamH1, resulting in an in-frame excision of residues 2 through 27 in the SagA protein sequence.
[0079] pAM401-psagA:mcherry: The promoter region of sagA (psagA) was PCR amplified from the E. faecium Com15 genome using following primers:
TABLE-US-00007 FW: (SEQIDNO:12) AAAGTCGACACGATGGTGGTCCAATTGAT RV: (SEQIDNO:13) TTTCATATGTCATTCCTCCGACTGGCTTA
[0080] Restriction sites for Sal1 and Nde1 are italicized. The PCR product was gel purified and subcloned into pGEMTeasy for sequencing. psagA was excised with Sal1 and Nde1, and ligated into cut pAM401-padd9:mcherry (**see below) to replace paad9 with psagA.
[0081] pAM401-SagA:
[0082] pET21a-SagA was mutagenized to insert a BamH1 site after the 6X-His using the following primer to generate pET21a-SagA_BamH1:
TABLE-US-00008 (SEQIDNO:14) TAACAAAGCCCGAAAGGAtccTGAGTTGGCTGCTGC
[0083] The BamH1 site is italicized. The mutated sites are indicated in lowercase. sagA-his6 was then excised with Nde1 and BamH1, and ligated into cut pAM401-psagA:mcherry to replace mcherry with SagA-His.sub.6. pAM401-SagA was transformed into E. faecium Com15 as described below in this Example.
[0084] *Generating E. faecalis-sagA: pTEX5501ts-OG1RF-sagA:
[0085] pTEX5501ts 986 bp of sequence upstream (on the minus strand) of the intended SagA insertion site was PCR amplified using the following primers:
TABLE-US-00009 FW: (SEQIDNO:15) AAACGGCCGAGTGGGGCGTGTTATTGAAG RV: (SEQIDNO:16) TTTGTCGACGGGTAAGCTTCTCATCGTTTTG
[0086] The Eag1 and Sal1 sites are italicized. 1013 bp of sequence downstream (on the minus strand) of the intended SagA insertion site was PCR amplified using the following primers:
TABLE-US-00010 FW: (SEQIDNO:17) AAACTGCAGTGGAGCCTTGAAGAAAGTTG RV: (SEQIDNO:18) TTTGGTACCATTGGCTGCTTTTGTTGCTT
[0087] The Pst1 and Kpn1 sites are italicized. The upstream and downstream PCR products were subcloned into pGEMTeasy and sequenced, then were excised and ligated into cut pTEX5501ts sequentially. (Note: For the Eag1/Sal1 double digest of pTEX4401ts, Sal1 was added first, then Eag1 because the restriction sites overlap in the vector, and Eag1 can cut more efficiently at the end of a linear DNA fragment). psagA:sagA-his.sub.6 was excised from pAM401-SagA with Sal1 and BamH1 and inserted into the cut vector, generating pTEX5501ts-OG1RF-sagA. OG1RF-sagA- his.sub.6 was generated using an established protocol. Briefly, OG1RF was transformed with pTEX5501ts-OG1RF-sagA and single recombinants were selected after plasmid curing at 37 C. Then colonies were passaged at 37 C. and screened for gentamicin sensitivity and chloramphenicol resistance until such a clone was identified. Chromosomal insertion was verified by PCR and sequencing.
[0088] **pAM401-paad9:mcherry: paad9:mcherry was designed by us into pUC57. It encodes the synthetic promoter to aad9 flanked by Sal1 and Nde1 restriction sites, driving mcherry flanked by Nde1 and BamH1 restriction sites. paad9:mcherry was excised from pUC57 with Sal1 and BamH1 and ligated into cut pAM401, inserting into the Tet.sup.R gene.
[0089] Electroporation of Enterococcus: Protocol for preparation of electrocompetent cells and electroporation was adapted from Briefly, Enterococcus were grown for 18 hours in M9YE (M9 media, 0.1% casamino acids, 0.3% yeast extract)+2% glycine. Cultures were diluted in half with M9YE+3% glycine, and grown for an additional 3 hours. Cultures were chilled, pelleted, and washed 3 times in sucrose wash buffer (0.625 M sucrose, 1 mM MgCl.sub.2, pH 4 with HCl), reducing the original culture volume by , 1/10, then 1/100 successively with each wash. Finally, cells were aliquoted, flash frozen in liquid nitrogen, and stored at 80 C. Cells were electroporated in 2 mm cuvettes, 25 F, 400 ohm, 2.5 kV. Cells were allowed to recover for 2 hours at room temperature without shaking in Todd-Hewitt Broth (BD Bacto) then with shaking at 37 C. for an additional 2 hours before plating on selective media.
[0090] Protein purification: For E. faecium Com15 protein expression, plasmid-carrying strains were grown in BHI with appropriate antibiotics overnight. For E. coli BL21-RIL (DE3), LB cultures were inoculated with overnight cultures with appropriate antibiotics, grown for 2 hours or until OD6000.4, induced with 1 mM IPTG, then grown for an additional 2 hours. His.sub.6-tagged proteins were purified from culture supernatants using Ni-NTA agarose (Qiagen). Native purifications were performed as recommended in the manufacturer's protocol. Purified protein was dialyzed into PBS at 4 C. overnight using 5 kDa or 7 kDa MWCO Slide-a-lyzers (Pierce Protein Biology). Protein concentration was estimated by BCA assay (Pierce Protein Biology) and protein was stored at 20 C.
[0091] Protein gel methods and Western blotting: Proteins were separated by SDS-PAGE on 4-20% Criterion Tris-HCl or Criterion TGX precast gels (Bio-Rad). Protein was visualized either by Coomassie blue (Bio-Rad) staining or stain-free imaging on a ChemiDoc MP system (Bio-Rad). Glycoproteins were visualized using the Pierce Glycoprotein staining kit (Thermo Scientific) as per the manufacturer's protocol. For Western blotting, proteins were transferred to nitrocellulose membrane. HRP conjugated polyclonal anti- His.sub.6 (abcam ab1187) and monoclonal anti-actin (abcam ab14128) were used for His.sub.6 and actin Western blots respectively. Western blots were visualized either by developing film or imaging on a ChemiDoc MP system.
[0092] Bacterial growth curves: Growth of E. coli expressing SagA, AS, or SagA-SS: Cultures were grown as described for protein purification, except that OD600 was monitored at given time points using a Spectromax M2e spectrophotometer.
[0093] Growth of E. coli and S. Typhimurium in the presence of SagA: LB media was inoculated with overnight cultures 1:100. Protein was added at 10 g/mL and volumes were normalized across all conditions with PBS. OD.sub.600 was measured at given time points. Growth of OG1RF-sagA: BHI media was inoculated with overnight cultures 1:100. Chloramphenicol was added at 10 g/mL as indicated. OD600 was measured at given time points.
[0094] Salmonella protein secretion assay: For each condition, 2 mL of LB was inoculated with overnight cultures 1:30. Protein was added to media at 10 g/mL and volumes were normalized across all conditions with PBS. Cultures were grown for 4 hours, shaking at 37 C., the pelleted at 7000 g for 5 minutes. 1 mL of culture supernatant was precipitated with trichloro acetic acid (TCA) at a final concentration of 10% overnight at 4 C. Precipitated proteins were pelleted at 20,800 g for 30 minutes, rinsed 2 times in acetone, then air-dried. Proteins were then separated by SDS-PAGE and visualized by Coomassie staining.
[0095] C. elegans infection assays: For each condition, 3 plates of 30 worms each (total 90 worms) were scored, unless otherwise noted. Mean percent survival and standard deviation of the triplicate plates for a representative experiment are shown for extended data figures. Mean percent survival and statistical comparisons by log rank test after Bonferroni correction for multiple comparisons using OASIS software are shown in the figures. E. faecium refers to strain Com15 unless otherwise noted in the figure legends. Worms were handled using a Leica M60 microscope and imaged using a Leica IC80 HD camera.
[0096] Pulsed infection assay: Worms were synchronized using established techniques. Synchronized young adult worms were washed in S buffer (129 mL 0.05 M K.sub.2HPO.sub.4, 871 mL 0.05 M KH.sub.2PO.sub.4, 5.85 g NaCl) and transferred to bacterial lawns grown on 2% agar BHI plates for colonization for 1 day. Then, worms were washed and transferred to lawns of OP50 or IR715 grown on BHI plates for infection for another day. Finally, worms were washed and transferred to lawns of OP50 grown on NGM plates (Day 0). Worms were maintained on OP50-NGM plates and survival was scored using established techniques.
[0097] Liquid-treatment pulsed infection assay: Synchronized young adult worms were transferred to 96-well plate wells containing 32% BHI media, culture supernatant, or live cultures. For protein treatments, 10-20 g/mL of protein in PBS was included in each well. For treatment with peptidoglycan digests, 100 L of each digest was added to each well. For treatment with defined peptidoglycan fragments, 50 M of each fragment in a mixture of PBS and water was included in each well. MDP, GlcNAc, and MurNAc were purchased from Sigma-Aldrich. MurNAc-L-Ala was synthesized as described below in Scheme 51. After 2 hours, worms were washed and transferred to lawns of IR715 grown on BHI plates for 1 day. Then, worms were washed and transferred to lawns of OP50 grown on NGM plates (Day 0). Worms were maintained on OP50-NGM plates and survival was scored.
[0098] Continuous infection assay: Synchronized young adult worms were washed and transferred to bacterial lawns grown on 2% agar BHI plates for colonization for 1 day. Then, worms were washed and transferred to lawns of OP50 or IR715 grown on NGM plates (Day 0). Worms were maintained on OP50 or IR715 NGM plates and survival was scored.
[0099] OG1RF pathogenesis assay: This assay was performed using known techniques. Briefly, synchronized young adult worms were washed and transferred to Com15, OG1RF, or OG1RF-sagA bacterial lawns grown on BHI plates (Day 0). Worms were maintained on Com15, OG1RF, or OG1RF-sagA BHI plates, and survival was scored.
[0100] Worm CFU measurements: Protocol for CFU measurements was adapted from previous protocol. Briefly, 5-20 worms were rinsed in drops of S buffer, and allowed to crawl free of bacteria on a sterile plate. These worms were then mechanically lysed in PBS using microtubes and pestles (Kimble-Chase). Serial dilutions of worm homogenate were plated on Salmonella-Shigella agar (BD BBL) or Enterococcosel (BD BBL) agar plates, and plates were incubated at 37 C. overnight.
[0101] Treatment of culture supernatants: Proteinase K treatment: Culture supernatant or media was digested with 0.1 mg/mL of proteinase K in the presence of 1 mM CaCl.sub.2 for 2 hours at 37 C. Then, 1 mM EGTA was added, and digestions were used in the liquid-treatment pulsed infection assay.
[0102] Trichloroacetic acid precipitation: Culture supernatant or media was precipitated with TCA (final concentration of 10%) overnight at 4 C. Precipitated proteins were pelleted and rinsed 2 times in acetone, then air-dried and resuspended in BHI media before use in the liquid-treatment pulsed infection assay. 10-kDa MWCO column filtration: E. faecium culture supernatant or media was filtered through 10-kDa MWCO columns (Vivaspin GE Healthcare), and the flow-thru was used in the liquid- treatment pulsed infection assay.
[0103] 5-kDa MWCO column filtration of E. coli culture supernatants: E. coli BL21-RIL(DE3) expressing SagA-His or AS-His were induced in BHI media instead of LB as described above. Portions of the culture supernatants were filtered through 5-kDa MWCO columns (Vivaspin GE Healthcare), and the unfiltered supernatants, column concentrate, and column flow-thru were used in the liquid-treatment pulsed infection assay.
[0104] Peptidoglycan Digests: 100 g of E. coli peptidoglycan (Invivogen) was digested with 20 g lysozyme (Sigma) and 20 g of SagA-His or AS-His overnight in a mixture of PBS and water at 37 C. Digests were then filtered through 5-kDa MWCO columns (Vivaspin GE Healthcare), and the flow-thru was used in the liquid-treatment pulsed infection assay.
[0105] Synthesis of N-acetylmuramic acid-L-alanine:
##STR00001##
[0106] Compound S1-2. S1-2 was synthesized from commercially available N-acetylglucosamine (S1-1) by following and adapting published protocols.
[0107] Compound S1-3. NaH (0.16 g, 6.67 mmol) was added to a suspension of compound S1-2 (0.358 g, 1.02 mmol) in 1,4-dioxane (9 mL). The mixture was stirred at 40 C. for 1 h. (S)-2-chloropropionic acid (0.27 mL, 2.95 mmol) in 1,4-dioxane (3 mL) was added to the reaction mixture dropwise. The mixture was stirred at 45 C. for 16 h. The solvent was removed under vacuum. H.sub.2O (20 mL) and 1MHCl.sub.(aq) (20 mL) was added. The mixture was extracted with CH.sub.2Cl.sub.2 (325 mL) and the combined organic layers were dried with MgSO.sub.4 and concentrated by rotary evaporation. The resulting solid was washed with cold Et.sub.2O several times and dried in vacuum to yield S1-3 as a white solid (95 mg, 22%). Crude compound (S1-3) was used without further purification.
[0108] .sup.1H NMR (400 MHz, CD.sub.3OD): 7.47 (d, J=4.1 Hz, 2H), 7.37 (d, J=5.0 Hz, 3H), 5.88 (m, 1H), 5.64 (s, 1H), 5.28 (d, J=17.2 Hz, 1H), 5.15 (d, J=10.4 Hz, 1H), 4.63 (d, J=7.7 Hz, 1H), 4.40 (q, J=6.9 Hz, 1H), 4.31 (d, J=4.9 Hz, 1H), 4.28 (t, J=4.6 Hz, 1H), 4.07 (m, 1H), 3.76 (m, 3H), 3.67 (t, J=4.2 Hz, 1H), 3.49 (m, 3H), 1.99 (s, 3H), 1.34 (d, J=6.9 Hz, 3H). ESI-MS [M+H.sup.+]: m/z calc. for C.sub.21H.sub.28NO.sub.8.sup.+: 422.1809; found: 422.1807.
[0109] Compound S1-4. L-alanine benzyl ester hydrochloride (68 mg, 0.315 mmol) and N,N- diisopropylethylamine (0.118 mL, 0.677 mmol) were added to a suspension of compound S1-2 (0.95 mg, 0.225 mmol) in CH.sub.2Cl.sub.2. 6-Chloro-1-hydroxybenzotriazole (57 mg, 0.336 mmol) in DMF (0.7 mL) was added to the reaction mixture. N,N-diisopropylcarbodiimide (45 uL, 0.291 mmol) was added to the reaction mixture. The mixture was stirred at room temperature for 16 h. 1M HCl.sub.(ag) (40 mL) was added to quench the reaction. The mixture was extracted with CH.sub.2Cl.sub.2 (225 mL) and the combined organic layers were dried with MgSO.sub.4 and concentrated by rotary evaporation. The resulting solid was washed with cold MeOH several times and dried in vacuum to yield S1-4 as a white solid (93 mg, 71%). Crude compound (S1-4) was used in the next step without further purification.
[0110] .sup.1H NMR (400 MHz, DMSO-d.sub.6): 7.41 (m, 10H), 5.84 (m, 1H), 5.69 (s, 1H), 5.25 (dd, J=17.4, 1.8 Hz, 1H), 5.15 (d, J=12.8 Hz, 2H), 5.09 (d, 12.6 Hz, 1H),
[0111] 4.53 (d, J=8.4 Hz, 1H), 4.31 (t, 7.4 Hz, 1H), 4.23 (m, 2H), 4.04 (m, 2H), 3.80 (m, 2H), 3.65 (t, 8.7 Hz, 2H), 3.42 (m, 1H), 1.79 (s, 3H), 1.34 (d, 7.8 Hz, 3H), 1.21 (d, 6.6 Hz, 3H). .sup.13C NMR (600 MHz, DMSO-d.sub.6): 172.56, 172.40, 170.27, 138.01, 136.37, 134.93, 129.27, 128.87, 128.61, 128.49, 128.20, 126.32, 116.76, 101.25, 100.58, 80.45, 79.71, 77.70, 69.55, 68.23, 66.41, 66.09, 55.20, 47.97, 23.77, 23.47, 19.32, 17.28. ESI-MS [M+H.sup.+]: m/z calc. for C.sub.31H.sub.39N.sub.2O.sub.9.sup.+: 583.2650; found: 583.2650.
[0112] Compound S1-5. Tetrakis(triphenylphosphine)palladium(0) (95 mg, 0.082 mmol) was added to a suspension of compound S1-4 (93 mg, 0.160 mmol) in AcOH (1.5 mL). The mixture was stirred at 40 C. for 16 h. The solution was purified by silica gel column chromatography (MeOH/EtOAc/hexanes=0.5/7/7)) to yield S1-5 as a light yellow solid (57 mg, 66%).
[0113] .sup.1H NMR (600 MHz, CD.sub.3OD): 7.50 (d, J=4.2 Hz, 2H), 7.34 (m, 8H), 5.65 (s, 1H), 5.21 (d, J=3.6 Hz, 1H), 5.19 (s, 2H), 4.44 (q, J=7.2 Hz, 1H), 4.27 (q, J=6.6 Hz, 1H), 4.21 (dd, J=10.2, 4.8 Hz, 1H), 4.04 (m, 2H), 3.82 (m, 2H), 3.69 (t, J=9.6 Hz, 1H), 1.97 (s, 3H), 1.42 (d, J=7.2 Hz, 3H), 1.31 (d, J=6.6 Hz, 3H). .sup.13C NMR (600 MHz, CD.sub.3OD): 174.50, 172.34, 172.20, 137.79, 135.81, 128.52, 128.20, 127.93, 127.86, 127.74, 125.92, 101.40, 101.25, 91.73, 82.08, 77.04, 76.16, 68.73, 66.61, 62.35, 54.21, 21.49, 18.34, 15.91. ESI-MS [M+H.sup.+]: m/z calc. for C.sub.28H.sub.35N.sub.2O.sub.9.sup.+: 543.2337; found: 543.2338.
[0114] Compound S1-6. Compound S1-5 was suspended in AcOH (0.6 mL) and H.sub.2O (0.4 mL). The mixture was stirred at 50 C. for 1 h and 40 C. for 30 min. The solvent was removed under vacuum. The resulting solid was dissolved in MeOH (2 mL). 10% palladium on carbon (21 mg) was added to the solution. The mixture was stirred under 1 atm. of H.sub.2 at room temperature for 5 h. After filtration, the solution was concentrated by rotary evaporation. The resulting oil was purified by silica gel column chromatography (MeOH/CHCl.sub.3=3:7 to 4:6) to yield compound S1-6 (-anomer).
[0115] .sup.1H NMR (600 MHz, CD.sub.3OD): 5.13 (d, J=3.6 Hz, 1H), 4.39 (q, J=7.2 Hz, 1H), 4.34 (q, J=6.6 Hz, 1H), 3.94 (dd, J=10.2, 3.0 Hz, 1H), 3.82 (m, 2H), 3.73 (m, 1H), 3.68 (m, 1H), 3.50 (m, 1H), 1.97 (s, 3H), 1.45 (d, J=7.6 Hz, 3H), 1.41 (d, J=7.1 Hz, 3H). .sup.13C NMR (600 MHz, CD.sub.3OD): 174.55, 174.36, 172.07, 95.88, 91.15, 79.38, 77.14, 71.83, 70.10, 61.27, 53.96, 21.46, 18.10, 16.27. ESI-MS [M+H.sup.+]: m/z calc. for C.sub.14H.sub.25N.sub.2O.sub.9.sup.+: 365.1555; found: 365.1555.
[0116] Proteomics: In-gel digestion: 1 mL of culture supernatant was precipitated with TCA as described above, resuspended in loading buffer and separated by SDS-PAGE. Proteins were processed for in-gel digestion with sequencing grade trypsin (Promega) using known techniques except that dried samples were resuspended in 5% acetonitrile, 2% formic acid in water.
[0117] In-Solution Digestion:
[0118] 1 mL of culture supernatant was precipitated with TCA as described above, and proteins were digested with 0.2 g of trypsin in 50 mM ammonium bicarbonate buffer overnight at 37 C. Samples were dried by speed-vac, then resuspended in 5% acetonitrile, 2% formic acid in water. LC-MS was performed on digested peptides and peptide spectra were analyzed against the E. faecium Com15 proteome using Mascot v2.3 and Proteome Discoverer software.
[0119] 8-aminonaphthalene 1,3,6 trisulfonic acid (ANTS) labeling assay:
[0120] E. coli supernatants were prepared by inoculating cultures 1:50 with an overnight culture of E. coli BL21-RIL(DE3) expressing SagA-His.sub.6 or AS-His.sub.6. Cultures were grown for 2 hours, then induced with 1 mM IPTG, and grown for an additional 2 hours. Enterococcus supernatants were prepared by growing cultures overnight. Cultures were pelleted, and supernatant was filtered through 10 kDa MWCO columns (Millipore Microcon). For peptidoglycan digests, 100 g of E. coli peptidoglycan wasdigested with 20 g lysozyme and 20 g of SagA-His or AS-His overnight in a mixture of PBS and water at 37 C. Digests were filtered through 10 kDa MWCO columns. Culture supernatants, peptidoglycan digests, and defined peptidoglycan fragments were dried by speed-vac before ANTS labeling. ANTS labeling was using established techniques. 10 l of ANTS reaction mix was added to each tube of dried material (1:1 mixture of 0.2 M ANTS (in 3:17 acetic acid:water): 1 M NaCNBH.sub.3 (in DMSO)). Reactions were incubated overnight at 37 C. 0.5-3.5 L of the ANTS labeled mixtures were mixed 1:1 with 40% glycerol and samples were separated by native PAGE on a hand-cast 37-40% Tris-glycine acrylamide gel (19:1 polyacrylamide:bisacrylamide, with a 20% acrylamide stack) at 150 V for 3 hours or 80 V for
[0121] 6 hours. Empty lanes adjacent to sample lanes were loaded with samples of ANTS labeled Ala-D--Glu-Lys-D-Ala-D-Ala (Sigma). Remaining lanes were loaded with 20% glycerol. Gels were imaged on the ChemiDoc MP system (Bio-Rad) using the Sybr-safe UV imaging setting.
[0122] Epifluorescence:
[0123] For imaging of mcherry-Salmonella, worms were treated as described for the pulsed infection assays except worms were infected with S. Typhimurium carrying the plasmid p67MC1. For imaging of E. faecium psagA:mcherry, worms were fed E. faecium carrying the plasmid pAM401-mcherry for 1 day on BHI plates. Worms were mounted as described (18), except that worms were paralyzed in 1 mM tetramisole (Sigma) instead of sodium azide. Worms were imaged on a Nikon Eclipse TS100 and pictures were taken using a Nikon Digital Sight DS-Fi1.
[0124] Electron Microscopy:
[0125] Animals were prepared for electron microscopy using standard methods. Ultrathin serial sections (70 nm) were collected by using a Leica Ultracut UCT Ultramicrotome. Sections at two regions, 120 m and 200 m away from the head region, were examined for each condition. EM images were acquired using an FEI Tecnai G2 Spirit BioTwin transmission electron microscope operating at 80 kV with a Gatan 4K4K digital camera.
TABLE-US-00011 TABLE 1 Proteins identified from E. faecium Com15 culture supernatant by mass spectrometry, after in-gel digestion. Proteins listed have at least 2 unique peptides identified. Proteins involved in peptidoglycan remodeling are italicized and bolded. # Uniprot Gene Unique # Accession name Description Peptides PSMs
C9AQS4 Extracellular solute-binding protein 18 92 C9AQL4 Basic membrane lipoprotein 24 85
C9AKY1 Periplasmic solute binding protein 21 68 C9AQT6 Periplasmic binding protein 16 63
C9APB3 Putative uncharacterized protein 16 56 C9ALQ1 eno Enolase 23 55
C9AMB1 Sulfatase 20 45 C9ALP8 Glyceraldehyde-3-phosphate dehydrogenase 10 43 C9AQM8 tuf Elongation factor Tu 2 13 41
C9ARZ3 Extracellular solute-binding protein 12 41 C9AMG6 arcA Arginine deiminase 17 39 C9AML5 Amino acid ABC transporter 8 36 C9ASF9 ErfK/YbiS/YcfS/YnhG family protein 16 34 C9AS22 FMN-binding protein 10 34 C9API8 Pyruvate kinase 19 33 C9ALP9 pgk Phosphoglycerate kinase 13 31 C9AMK8 dnaK Chaperone protein DnaK 23 31 C9AMB7 pgi Glucose-6-phosphate isomerase 15 29 C9ALB5 Sulfatase 16 29 C9AMH5 tsf Elongation factor Ts 11 27 C9AQB2 Fructose-bisphosphate aldolase class-II 10 25 C9ARP7 Glycine betaine/L-proline ABC transporter 9 25
23 C9APP4 Transcriptional regulator 10 23 C9ANA8 Extracellular solute-binding protein 17 23 C9AL01 Extracellular solute-binding protein 17 21 C9ANQ7 Peptidyl-prolyl cis-trans isomerase 7 20 C9ARQ9 groEL 60 kDa chaperonin 15 19 C9ANB6 Extracellular solute-binding protein 9 19 C9ATA9 ATP-dependent Clp protease 14 18 C9AME5 Iron compound ABC transporter 11 18 C9AQM7 fusA Elongation factor G 10 16 C9AS40 ABC transporter substrate binding protein 10 16 C9ANN9 NADH oxidase 10 15 C9AMN8 tig Trigger factor 11 14 C9APM7 Phosphoenolpyruvate-protein phosphotransferase 11 12 C9AGM7 Ornithine carbamoyltransferase 7 12 C9AP95 Ribosomal protein S1 10 12 C9ARE8 prsA PpiC-type peptidyl-prolyl cis-trans isomerase 8 12 C9ALQ0 tpiA Triosephosphate isomerase 6 12 C9ASG0 Idh L-lactate dehydeogenase 2 8 11 C9APR1 Predicted protein 5 11 C9AQP2 rpIE 50S ribosomal protein L5 4 10 C9ANQ4 Glyceraldehyde-3-phosphate dehydrogenase 7 10 C9APA2 Peeptidase M20A 8 10 C9ANB3 Putative uncharacterized protein 5 10 C9AR88 Peptidase S1 6 10 C9APC1 tuf Elongation factor Tu 1 7 9 C9API4 6-phosphogluconate-dehydrogenase, decarboxylating 8 9 C9AQB4 Glutamine synthetase 8 9 C9AN26 Heat shock protein 3 9 C9ARH9 Acyltransferase 6 8 C9AL54 NLPA lipoprotein 4 8 C9APP1 Chitin-binding protein 6 8 C9ALX9 Phosphoglucomutase/phosphomannomutase 7 7 C9AR81 Peptidase M20A 5 7 C9ASX8 Putative uncharcatreized protein 4 7 C9ATI6 Extracellular solute-binding protein 5 7 C9ART9 Sulfastase 6 7 C9AQP7 rpsE 30S ribosomal protein S5 4 6 C9AQK7 guaA GMP synthase [glutamine-hydrolyzing] 5 6 C9AS47 Ferritin 4 6 C9ANE7 Putative uncharacterized protein 2 6 C9ATD5 Intracellular protease 4 6 C9AQP5 rpIF 50S ribosomal protein L6 5 6 C9AQI8 Oligopeptide binding protein 5 6 C9ARL2 rpIK 50S ribosomal protein L11 4 5 C9ASH2 lysS Lysine--tRNA ligase 4 5 C9AMH7 frr Ribosome-recycling factor 5 5 C9AMC8 Predicted protein 5 5 C9AQQ1 adk Adenylate kinase 5 5 C9ARL5 rpIL 50S ribosomal protein L7/L12 4 5 C9AKW7 NAD(FAD)dependent dehydrogenase 5 5 C9AM30 Putative uncharacterized protein 4 5 C9ALT5 Sigma 54 modulation protein/ribosomal protein S30EA 4 5 C9AN78 Putative uncharacterized protein 5 5 C9AL85 prsA PpiC-type peptidyl-prolyl cis-trans isomerase 4 5 C9AN90 Cell envelope transcriptional attenuator 4 5 C9ASN4 Putative uncharacterized protein 3 5 C9AQM6 rpsG 30S ribosomal protein S7 2 4 C9APQ3 Superoxide dismutase 3 4 C9AP93 DNA binding protein HU 4 4 C9AQP4 rpsH 30S ribosomal protein S8 3 4 C9AS49 rpsI 30S ribosomal protein S9 2 4 C9API9 pfkA 6-phosphofructokinase 3 4 C9ASN2 Pyridoxal-dependent decarboxylase 3 4 C9AQQ7 rpIQ 50S ribosomal protein L7 4 4 C9ANY2 Transketolase 4 4 C9ARX0 Signal peptidase I 3 4 C9AQP1 rpIX 50S ribosomal protein L24 4 4 C9AQB3 pyrG CTP synthase 4 4 C9ALR9 atpD ATP synthase F1 4 4 C9AQM2 gpmA 2,3-bisphosphopglycerate-dependent phosphoglycerate 2 4 mutase 2 C9ARX9 upp Uracil phosphoribosyltransferase 3 4 C9APR6 Putative uncharacterized protein 4 4 C9ATB9 Cupin domain-containing protein 2 4 C9ASG5 Septum formation initiator 3 4 C9AKX7 Putative uncharacterized protein 2 4 C9ANY1 Dihydrolipoamide S-succinyltransferase 3 3 C9ALN5 Glyoxalase/bleomycin resistance protein/dioxygenase 3 3 C9ANP3 Transketolase 2 3 C9ARQ8 groES 10 kDa chaperonin 3 3 C9AQF3 guaB Inosine-5-monophosphate dehydrogenase 2 3 C9ARL3 rpIA 50S ribosomal protein L1 3 3 C9AQN1 rpID 50S ribosomal protein L4 2 3 C9ALV5 UTP-glucose-1-phosphate uridyltransferase 2 3 C9ARL4 rpIJ 50S ribosomal protein L10 3 3 C9AMD1 Putative uncharacterized protein 2 3 C9APR5 freA Transcription elongation factor greA 2 3 C9AS03 metG Methionyl-tRNA synthetase 2 3 C9AP54 ppaC Probable manganese-dependent inorganic 2 3 pyrophosphatase C9ARH5 Aldo-keto reductase 2 3 C9AR84 Glutamyl aminopeptidase 3 3 C9ALL0 Putative uncharacterized protein 3 3 C9AQN6 rpsC 30S ribosomal protein S3 3 3 C9ALV7 Putative uncharacterized protein 3 3 C9ANI8 HD domain-containing protein 3 3 C9AN38 prsA Foldase protein prsA 2 2 3 C9AP35 Putative uncharacterized protein 3 3 C9AQM9 rpsJ Ribosomal protein S10 2 2 C9AMH4 rpsB 30S ribosomal protein S2 2 2 C9AMN9 clpX ATP-dependent Clp protease ATP-binding subunit ClpX 2 2 C9ASA9 gltX Glutamate--tRNA ligase 2 2 C9AQZ1 pnp Polyribonucleotide nucleotidyltransferase 2 2 C9AQP6 rpIR 50S ribosomal protein L18 2 2 C9AL22 M13 family peptidase 2 2 C9ARB8 Predicted protein 2 2 C9ARX7 glyA Pyridoxal-phosphate-dependent serine 2 2 hydroxymethyltransferase C9AQ30 ftsZ Cell dividion protein ftsZ 2 2 C9AP56 Formate acetyltransferase 2 2 C9APC4 2,5-didehydrogluconate reductase 2 2 C9ALP6 3-oxoacyl-[acyl-carrier-protein] synthase 2 2 2 C9AQA9 rpmE2 50S ribosomal protein L31 type B 2 2 C9AM29 D-alanyl-D-alanine carboxypeptidase 2 2 C9ASN3 tyrS Tyrosine--tRNA ligase 2 2 C9ANP1 Cysteine synthase 2 2 C9AQ59 rpmA 50S ribosomal protein L27 2 2 C9AQN5 rpIV 50S ribosomal protein L22 2 2 C9AQ61 rpIU 50S ribosomal protein L21 2 2 C9ALP9 acpP Acyl carrier protein 1 2 2 C9AMM5 Putative uncharacterized protein 2 2 C9ARS4 nadE NH(3)-dependent NAD(+) synthetase 2 2 C9ALC7 Putative uncharacterized protein 2 2 C9AP38 ABC transporter 2 2 C9ASJ8 Putative uncharacterized protein 2 2 C9ALI4 Putative uncharacterized protein 2 2 C9AN28 Predicted protein 2 2 C9ALC4 Lipoprotein YaeC 2 2 C9ASP9 Cell wall surface adhesion protein 2 2 C9APR0 Putative uncharacterized protein 2 2 PSM = peptide spectrum match.
TABLE-US-00012 TABLE 2 # PSMs # PSMs Uniprot Gene MW Unique Top Bottom Accession Name Description (kDa) Peptides Band band C9ASF4, sagA Secreted lipase 53.6 17 104 13 C9ASF5 C9ALL0 Putative uncharacterized protein 84.5 11 19 C9APJ5 Penicillin-binding protein 78.3 10 18 C9AQM7 fusA Elongation factor G 76.7 9 17 C9ASJ4 N-acetylmuramoyl-L-alanine amidase 77.3 8 12 C9AQZ1 pnp Polyribonucleotide nucleotidyltransferase 76.9 3 4 C9ANP3 Transketolase 72.4 2 3 C9ANY1 Dihydrolipoamide S-succinyltransferase 57.0 2 2 C9ANA8 Extracellular solute-binding protein 45.7 12 25 C9AS94 Mannosyl-glycoprotein endo-beta-N- 46.6 9 20 acetylglucosamidase C9ALQ1 eno Enolase 46.5 10 18 C9APP4 Transcriptional regulator 42.5 9 13 C9AQB4 Glutamine synthetase 50.6 7 11 C9AQM8 tuf Elongation factor Tu 2 43.2 6 11 C9ATH2 Beta-1,4-N-acetylmuramoylhydrolase 71.0 4 9 C9AMB7 pgi Glucose-6-phosphate isomerase 49.7 6 9 C9API4 6-phosphogluconate dehydeogenase, 52.7 4 7 decarboxylating C9ALB5 Sulfatase 79.1 3 6 C9AP95 Ribosomal protein S1 45.7 3 5 C9AMG6 arcA Arginine deiminase 46.1 4 5 C9ART9 Sulfatase 70.9 3 5 C9ALR9 atpD ATP synthatase F1 51.0 2 4 C9AMB1 Sulfatase 80.4 3 4 C9ANE Putative uncharacterized protein 36.7 2 3 A9AQL4 Basic membrane lipoprotein 37.8 2 2 Proteins identified by mass spectrometry from the top and bottom bands as indicated in FIG. 3A.
TABLE-US-00013 TABLE 3 E. faecalis E.faecalis-sagA # # Uniprot Gene Unique # Unique # Accession Name Description peptides PSMs Peptides PSMs F2MNY6 Secreted antigen 5 48 4 36 F2MPG2 pgk Phosphoglycerate kinase 10 24 10 13 F2MPG0 eno Enolase 9 22 8 15 F2MR31 Uncharacterized protein 8 16 14 47 F2MQS5 ptsI Phosphoenolpyruvate-protein phosphotransferase 7 16 7 15 F2MPK1 Peptide ABC superfamily ABC transporter, binding 7 15 12 23 protein F2MNH6 gelE Gelatinase 7 15 9 22 F2MQ41 npr NADH peroxidase 4 15 4 4 F2MNQ3 htrA Serine protease HtrA 4 13 3 4 F2MQL1 rpoC DNA-directed RNA polymerase subunit beta 7 12 5 7 F2MM76 ABC superfamily ABC transporter, binding protein 6 11 10 23 F2MNH5 sprE SprE protein 4 11 5 20 F2MQ69 ackA Acetate kinase 5 11 5 14 F2MR21 dnaK Chaperone protein DnaK 9 11 8 11 F2MTS3 groEL 60 kDa chaperonin 7 11 7 10 F2MMD6 pepQ Xaa-Pro dipeptidase 4 11 4 9 F2MSU5 pgi Glucose-6-phosphate isomerase 4 11 4 9 F2MT66 oppA Oligopeptide ABC superfamily ABC transporter, 7 11 6 8 binding protein F2MRX7 pdhA Pyruvate dehydrogenase complex E1 component 3 11 2 5 alpha subunit F2MM98 tuf Elogation factor Tu 7 10 5 6 F2MPU3 Transcriptional regulator 3 9 6 10 F2MQA4 ABC superfamily ABC transporter, binding protein 2 9 4 10 F2MST4 trxA Thioredoxin 2 9 2 10 F2MQC6 glnA Glutamine synthetase 5 9 4 7 F2MN33 ldh L-lactate dehydrogenase 4 9 3 6 F2MR74 ABC superfamily ABC transporter, binding protein 3 8 9 15 F2MRQ5 lys16 Cell wall lysis protein 5 8 5 8 F2MPV9 tyrS Tyrosine--tRNA ligase 5 8 2 7 F2MQH3 ubiD2 UbiD family decarboxylase 6 8 4 6 F2MQK7 dps DNA starvation/stationary phase protection protein 5 8 4 4 Dps F2MML0 gnd 6-phosphogluconate dehydeogenase, 6 8 2 3 decarboxylating F2MSU4 gdhA Glutamate dehydeogenase 4 7 6 10 F2MQH5 WxL domain surface protein 3 7 3 6 F2MQ03 fdaB Fructose-bisphosphate aldolase 3 7 3 5 F2MRX1 Sugar ABC superfamily ABC transporter, sugar- 5 7 3 5 binding protein F2MMC3 adk Adenylate kinase 3 7 2 4 F2MQX6 Sulfatase domain protein 5 6 8 15 F2MRL8 glnP Amino acid ABC superfamily ABC transporter- 3 6 4 8 binding/permease protein F2MRY0 1pd Dihydrolipoyl dehydrogenase 4 6 3 7 F2MN60 fabF 3-oxoacryl-1-[acryl-carrier-protein] synthase 2 3 6 3 5 F2MMK6 pfkA 6-phosphofructokinase 4 6 3 4 F2MQT2 fruK2 Tagatose-6-phosphate kinase 2 6 2 4 F2MTK3 ndh NADH dehydrogenase 3 6 2 4 F2MMR7 ccpA Catabolite control protein A 4 6 3 3 F2MTG7 hup DNA-binding protein HU 3 6 2 2 F2MM84 deoB Phosphopentomutase 3 5 4 6 F2MRY7 Hydoxymethylglutaryl-CoA synthase 2 5 2 5 F2MTV6 pflB Formate acetyltransferase 4 5 3 4 F2MM91 adh3 Putative alcohol dehydeogenase (NADP(+)) 2 4 3 7 F2MTA8 pta Phosphate acetyltransferase 3 4 3 4 F2MRX8 pdhB Pyruvate dehydrogenase complex E1 component 3 4 2 2 beta subunit F2MS34 frr Ribosome-recycling factor 4 4 2 2 F2MS37 rpsB 30S ribosomal protein S2 3 4 2 2 F2MTE1 Uncharacterized protein 2 3 4 10 F2MRB6 Pheromone cAD1 lipoprotein 2 3 3 3 F2MT59 aad Aldehyde-alcohol dehydrogenase 2 3 10 18 F2MRB5 Thiamine biosynthesis lipoprotein 2 3 3 5 F2MTQ5 atpA2 ATP synthase subunit alpha 2 3 2 3 F2MU99 ahpC Peroxiredoxin 2 3 2 3 F2MM92 gpmA 2,3-bisphosphoglycerate-dependent 2 3 2 2 phosphoglycerate mutase F2MNI5 WxL domain surface protein 0 0 5 69 F2MNH1 Phosphatidylglycerol--membrane- 0 0 9 28 oligosaccharide glycerophosphotransferase F2MMF2 pbpC Penicllin-binding protein C 0 0 9 19 F2MNV6 Chitin-binding protein/carbohydrate- 0 0 6 17 binding protein F2MUF4 penA Penicillin-binding protein 2B 0 0 11 15 F2MRA7 Cell-envelope associated acid phosphatase 0 0 5 8 F2MTN5 pmi Mannose-6-phosphate isomerase 0 0 4 8 F2MSL7 opuCC Glycine/betaine/carnitine/choline ABC superfamily 0 0 3 7 ABC transporter, binding protein F2MU67 Transcriptional regulator 0 0 6 6 F2MS22 proS Proline--tRNA ligase 0 0 2 5 F2MMR4 pbp1B Penicillin-binding protein 1B 0 0 3 4 F2MMV9 ABC superfamily ABC transporter, substrate- 0 0 3 4 binding protein xxxxxx SagA-His6 0 0 3 4 F2MTQ3 atpD2 ATP synthase subunit beta 0 0 2 4 F2MMX1 pabC Aminodeoxychorismate lyase 0 0 3 3 F2MNF9 Uncharacterized protein 0 0 3 3 F2MQM9 pepV Dipeptidase PepV 0 0 3 3 F2MTH6 Uncharacterized protein 0 0 3 3 F2MP85 dkgB 2,5-diketo-D-gluconate reductase 0 0 2 3 F2MQ25 Uncharacterized protein 0 0 2 3 F2MRN8 Acyltransferase 0 0 2 3 F2MTE4 gap Glyceraldehyde-3-phosphate dehydrogenase 0 0 2 3 F2MU19 S41A family carboxy-terminal peptidase 0 0 2 3 F2MM97 fusA Elongation factor G 0 0 2 2 F2MNV5 chiC Chitinase C1 0 0 2 2 F2MPG1 tpiA Triosephosphate isomerase 0 0 2 2 F2MSG8 arcA Arginine deiminase 0 0 2 2 F2MT41 glyA Serine hydroxymethyltransferase 0 0 2 2 F2MPW0 Decarboxylase 10 28 0 0 F2MR04 Uncharacterized protein 9 17 0 0 F2MMN0 pstS Phosphate ABC superfamily ABC transporter, 6 13 0 0 binding protein F2MT47 Fumarate reductase 6 9 0 0 F2MMK7 pyk Pyruvate kinase 5 7 0 0 F2MQL2 rpoB DNA-directed RNA polymerase subunit beta 4 7 0 0 F2MTJ8 tkt Transketolase 3 7 0 0 F2MMA5 rplB 50S ribosomal protein L2 3 6 0 0 F2MP87 gloA5 Lactoylglutathione lyase 3 6 0 0 F2MQH1 ubiD UbiD family decarboxylase 2 6 0 0 F2MU24 coaC Phosphopantothenoylcysteine decarboxylase 2 6 0 0 F2MRI2 rplI 50S ribosomal protein L9 4 5 0 0 F2MRM7 ClpP ATP-dependent Clp protease proeolytic subunit 4 5 0 0 F2MRQ6 leuS Leucine--tRNA ligase 3 5 0 0 F2MMX0 greA Transcription elongation factor GreA 2 5 0 0 F2MNZ2 pcp Pyrrolidone-carboxylate peptidase 2 5 0 0 F2MU79 rplK 50S ribosomal protein L11 2 5 0 0 F2MMN1 aspC2 Aminotransferase 3 4 0 0 F2MQK0 Choline binding protein 3 4 0 0 F2MQK6 rplM 50S ribosomal protein L13 2 4 0 0 F2MQV8 Gfo/Idh/MocA family oxidoreductase 2 4 0 0 F2MT73 infC Translation initiation factor IF-3 2 4 0 0 F2MMA3 rplD 50S ribosomal protein L4 3 3 0 0 F2MQQ0 prsA Foldase protein PrsA 3 3 0 0 F2MR57 pepS Aminopeptidase PepS 2 3 0 0 F2MSC3 purR Purine operon repressor 2 3 0 0 F2MM66 guaA GMP synthase [glutamine-hydrolyzing] 2 2 0 0 F2MM95 rpsL 30S ribosomal protein S12 2 2 0 0 F2MMA1 rpsJ 30S ribosomal protein S10 2 2 0 0 F2MMA2 rplC 50S ribosomal protein L3 2 2 0 0 F2MMA6 rpsS 30S ribosomal protein S19 2 2 0 0 F2MMA8 rpsC 30S ribosomal protein S3 2 2 0 0 F2MMB9 rpsE 30S ribosomal protein S5 2 2 0 0 F2MMD3 rpmA 50S ribosomal protein L27 2 2 0 0 F2MNV0 pepC Aminopeptidase C 2 2 0 0 F2MPA1 rplS 50S ribosomal protein L19 2 2 0 0 F2MQT1 fruA PTS family fructose porter, IIABC component 2 2 0 0 F2MRX9 accF Pyruvate dehydrogenase complex E2, 2 2 0 0 dihydrolipoamide acetyltransferase F2MTV4 ppaC Probable manganese-dependent inorganic 2 2 0 0 pyrophosphatase F2MU40 pepF Oligoendopeptidase F 2 2 0 0 F2MUA4 celM M42 family glutamyl aminopeptidase 2 2 0 0 Proteins in E. faecalis OG1RF and E. faecalis-sagA culture supernatants identified by mass spectrometry, after in-solution digestion. Proteins listed have at least 2 unique peptides. Proteins involved in cell wall remodeling are italicized and enlarged. F2MNY6 and SagA-His6 are bold. PSM = peptide spectrum match.
TABLE-US-00014 TABLE 4 Proteins identified from E. faecium Com15 culture supernatant by mass spectrometry, after in-gel digestion. Proteins listed have at least 2 unique peptides identified. Proteins involved in peptidoglycan remodeling are italicized and bolded. # Gene Unique # Uniprot Accession Name Description Peptides PSMs C9ALQ1 eno Enolase 20 57 C9ASF4/C9ASF5 sagA Secreted lipase 21 54 C9AKY1 Periplasmic solute binding protein 19 43 A9AQS4 Extracellular solute-binding protein 20 41 C9AMB1 Sulfatase 14 39 C9AQT6 Periplasmic binding protein 12 37 A9ARQ9 groEL 60 kDa chaperonin 17 36 C9APJ5 Penicillin-binding protein 16 31 C9API8 Pyruvate kinase 15 31 C9AQM7 fusA Elongation factor G 11 30 C9ATH2 Beta-1,4-N-acetylmuramoylhydrolase 13 29 C9AQM8 tuf Elongation factor Tu 13 27 C9ATA9 ATP-dependent Clp protease 15 26 C9AS94 Mannosyl-glycoprotein endo-beta-N- 11 26 acetylglucosamidase C9AMK8 dnaK Chaperone protein 18 25 C9AMB7 pgi Glucose-6-phosphate isomerase 11 25 C9ALP9 pgk Phosphoglycerate kinase 11 24 C9ALP8 Glyceraldehyde-3-phosphate dehydrogenase 11 23 C9AMG7 Ornithine carbamoyltransferase 10 22 C9AMH5 tsf Elongation factor TS 12 19 C9APB3 Putative uncharacterized protein 9 18 C9AQB2 Fructose-bisphosphate adolase class-II 8 18 C9AMN8 tig Trigger factor 10 17 C9APW8 Putative uncharacterized protein 9 17 C9ASN3 tyrS Tyrosine--tRNA ligase 7 17 C9AP18 D-alanyl-D-alanine carboxypeptidase 7 16 C9ASJ4 N-acetylmuramoyl-L-alanine amidase 9 15 C9AML5 Amino acid ABC transporter 6 15 C9ALB5 Sulfatase 8 14 C9ASF9 ErfK/YbiS/YcfS/YnhG family protein 7 14 C9AKY4 Peptidoglycan-binding protein LysM 6 14 C9ANA8 Extracellular solute-binding protein 8 13 C9ARE8 prsA Foldase protein PrsA 6 13 C9APM7 Phosphoenolpyruvate-protein phosphottransferase 9 12 C9AQN3 rplB 50S ribosomal protein L2 5 12 C9AS40 ABC transporter substrate binding protein 7 11 C9ANB6 Extracellular solute-binding protein 6 11 C9AL01 Extracellular solute-binding protein 5 11 C9ARP7 Glycine betaine/L-proline ABC transporter 4 11 C9AQZ1 pnp Polyribonucleotide nucleotidyltransferase 4 11 C9AQB4 Glutamine synthetase 6 10 C9APW3 Putative uncharacterized protein 5 10 C9APC1 tuf Elongation factor Tu 5 10 C9APP1 Chitin-binding protein 4 10 C9ANY2 Transketolase 4 10 C9ATC6 Uncharcatreized protein 3 10 C9ANP2 N-acetylmiramoyl-L-alanine amidase 5 9 C9ARY2 Cell wall surface adhesion protein 6 8 C9ATC3 Uncharacterized protein 6 8 C9ALV5 UTP-glucose-1-phosphate uridyltransferase 4 8 C9AQ24 ileS Isoleucine--tRNA ligase 3 8 C9ALL0 Putative uncharacterized protein 6 7 C9ASG0 Idh L-lactate dehydrogenase 5 7 C9ANG6 arcA Arginine deimiase 5 7 C9AQK7 guaA GMP synthase [glutamine-hydrolyzing] 5 7 C9ARS4 nadE NH(3)-dependent NAD(+) synthtase 5 7 C9APR1 Predicted protein 4 7 C9ARL2 rplK 50S ribosomal protein L11 4 7 C9AS47 Ferritin 4 7 C9ALR9 atpD ATP synthetase subunit beta 4 7 C9APW2 Predicted protein 3 7 C9APL9 acpP Acyl carrier protein 3 7 C9ATD5 Intracellular protease 3 7 C9AS03 metG Methionine--tRNA ligase 2 7 C9ANN9 NADH oxidase 2 7 C9AL85 prsA Foldase protein PrsA 6 6 C9AQL4 Basic membrane lipoprotein 5 6 C9AS42 rpoC DNA-directed RNA polymerase subunit beta 5 6 C9AS49 rpsI 30S ribosomal protein S9 4 6 C9APA2 Peptidase M20A 4 6 C9ANY3 Pyruvate dehydrogenase 3 6 C9AQP6 rplR 50S ribosomal protein L18 3 6 C9AKW7 NAD(FAD)-dependent dehydrogenase 3 6 C9AR84 Glutamyl aminopeptidase 3 6 C9ALQ0 tpiA Triosephosphate isomerase 3 6 C9ALX9 Phosphoglucomutase/phosphomannomutase 3 6 C9ATF4 Citrate lyase alpha subunit 3 6 C9AQP9 rplO 50S ribosomal protein L15 2 6 C9AN96 Alkyl hydroperoxide reductase 2 6 C9APR5 greA Transcription elongation factor GreA 2 6 C9ALV9 Catabolite control protein A 4 5 C9ASA9 gltX Glutamate--tRNA ligase 4 5 C9ANQ4 Glyceraldehyde-3-phosphate dehydrogenase 3 5 C9API9 pfkA 6-phosphofructokinase 3 5 C9ASH2 lysS Lysine--tRNA ligase 3 5 C9AQ07 Predicted protein 3 5 C9ANY1 Dehydrolipoamide S-succinyltransferase 2 5 C9ASN4 Putative uncharacterized protein 2 5 C9ARP9 DegV family protein 2 5 C9ARL5 rplL 50S ribosomal protein L7/L12 4 4 C9ARQ8 groES 10 kDa chaperonin 4 4 C9AS41 rpoB DNA-directed RNA polymerase subunit beta 4 4 C9AQF3 guaB Inosine-5-monophosphate dehydrogenase 4 4 C9AT02 Uncharacterized protein 3 4 C9AP93 DNA binding protein HU 3 4 C9AMH4 rpsB 30S ribosomal protein S2 3 4 C9ANQ7 Peptidyl-prolyl cis-trans isomerase 3 4 C9ART9 Sulfatase 3 4 C9AQ23 zwf Glucose-6-phosphate 1-dehydrogenase 3 4 C9AQM2 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate 2 4 nutase C9AL78 Cell wall surface anchor family protein 2 4 C9AQN6 rpsC 30S ribosomal protein S3 2 4 C9APL6 3-oxoacryl-[acyl-carrier-protein] synthase 2 2 4 C9APQ3 Superoxide dismutase 2 4 C9AQP1 rplX 50S ribosomal protein L24 2 4 C9AR81 Peptidase M20A 2 4 C9AR88 Peptidase S1 2 4 C9AM29 D-alanyl-D-alanine carboxypeptidase 2 4 C9AP08 xpt Xanthine phosphoribosyltransferase 2 4 C9AKX7 Putative uncharacterized protein 3 3 C9AP14 6-phosphogluconate dehydrogenase, decarboxylating 3 3 C9ALU9 Putative uncharacterized protein 3 3 C9AP54 ppaC Probable manganese-dependent inorganic 3 3 pyrophosphatase C9AQR6 Dak phosphatase 3 3 C9APV0 N-acetylmuramoyl-L-alanine amidase 2 3 C9ARH9 Acyltransferase 2 3 C9ANY0 Dihydrolipoyl dehydrogenase 2 3 C9ANP3 Transketolase 2 3 C9AS48 rplM 50S ribosomal protein L13 2 3 C9APV4 Putative uncharacterized protein 2 3 C9AP95 Ribosomal protein S1 2 3 C9AM30 Putative uncharacterized protein 2 3 C9AQ25 DivIVA protein 2 3 C9ANX7 GTP-binding protein TypA 2 3 C9APW1 Predicted protein 2 3 C9AS27 Cell surface protein (Fragment) 2 3 C9AQ61 rplU 50S ribosomal protein L21 2 2 C9AQZ7 rplY 50S ribosomal protein L25 2 2 C9AQQ1 adk Adenylate kinase 2 2 C9ALR7 atpA ATP synthase subunit alpha 2 2 C9ALT5 Sigma 54 modulation protein/ribosomal protein S30EA 2 2 C9AQN4 rpsS 30S ribosomal protein S19 2 2 C9ARJ0 Peptidase M3B 2 2 C9AMQ2 gatB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 2 2 subunit B PSM = peptide spectrum match.
EXAMPLE 2
[0126] This Example expands on Example 1, and provides an analysis of how colonization of mice with a human commensal Enterococcus faecium strain affects susceptibility to Salmonella infection. The data demonstrate that E. faecium improves host intestinal epithelial barrier function and limits Salmonella pathogenesis. This protection requires host antimicrobial peptide (AMP) production and innate immune receptor expression in epithelial cells. Ectopic expression of SagA by non-protective bacteria is sufficient to induce AMP expression and confer enhanced activity against Salmonella pathogenesis. This Example demonstrates that a specific factor produced by E. faecium triggers a protective program in the mammalian intestinal epithelium, revealing both host and bacterial mechanisms for commensal bacteria-mediated pathogen resistance.
[0127] To analyze protective capacity of E. faecium (human isolate, strain Com15), we compared it to E. faecalis (strain OG1RF), in a non-typhoidal Salmonella enterica serotype Typhimurium infection model. Mice treated with a single dose of streptomycin are rendered highly susceptible to S. Typhimurium infection. As expected, streptomycin-treated control and E. faecalis-colonized mice showed severe S. Typhimurium-induced pathogenesis, as evidenced by rapid weight loss and mortality within 10 days of infection (
[0128] To investigate host mechanisms involved in E. faecium-mediated protection against S. Typhimurium pathogenesis in vivo, we analyzed intestinal lymphocytes after E. faecium colonization. E. faecium colonization did not induce significant changes in the relative frequency or cytokine profile of intestinal intraepithelial lymphocyte subsets (
[0129] Given the preservation of intestinal barrier integrity upon E. faecium colonization, we next examined E. faecium-induced changes in intestinal epithelial cell (IEC) gene expression. In the presence of microbial colonization, IECs produce numerous proteins that function to restrict bacterial contact with the epithelium and prevent bacterial overgrowth, including antimicrobial peptides (AMPs), such as a-defensins (cryptdins in mice) and the C-type lectins RegIII and RegIII, and mucous components like mucins. Expression of many AMP and mucin genes is markedly reduced in response to antibiotic treatment; however, we observed that E. faecium colonization after broad-spectrum antibiotic treatment restored expression to pre-antibiotic levels and increased expression of the C-type lectin Reg3g (RegII) (
[0130] The expression of Reg3g has been shown to play an important role in excluding bacteria from the epithelial surface, although neither RegIII nor RegIII are bactericidal to S. Typhimurium. To determine the relevance of the observed increase in expression of Reg3g to E. faecium-mediated protection, we colonized antibiotic-treated Reg3g-deficient(Reg3g.sup./) mice and infected them with S. Typhimurium. Absence of Reg3g significantly abrogated E. faecium-mediated protection against S. Typhimurium pathogenesis compared to Reg3g.sup.+/ controls (
[0131] S. Typhimurium dissemination to peripheral organs like the liver can occur by invasion across IECs, disruption of tight junctions, or by unimpeded transport through microfold (M) cells. However, bacteria that are sampled through M cells are likely to be taken up by mononuclear phagocytes in the underlying Peyer's patches (PPs) and transported to the mesenteric lymph nodes (mLN). In Reg3g.sup.+/ mice, colonization with E. faecium prevented early S. Typhimurium invasion into the liver, whereas Reg3g-deficient mice suffered liver invasion comparable to untreated mice (
[0132] Expression of AMPs in the intestinal epithelium is upregulated in response to signaling through a number of pattern recognition receptors (PRRs). Specifically, toll-like receptors (TLRs) and their signaling adapter, MyD88, have are known to be required for IEC expression of Muc2, Reg3b, and Reg3g. We therefore examined the requirement for MyD88 signaling in E. faecium-mediated protection by generating a tamoxifen-inducible, IEC-specific conditional MyD88 knockout mouse (Villin.sup.CreERT2xMyd88.sup.f/f (iVillMyd88)). We administered tamoxifen to i VillMyd88 and Cre.sup. littermate controls one week prior to streptomycin treatment and followed this with E. faecium colonization and subsequent S. Typhimurium infection. We observed no significant difference in early weight loss or pathogen burden between iVillMyd88 and Cre.sup. mice (
[0133] To investigate the contribution of NOD2 to E. faecium-induced protection and AMP expression, we compared the efficacy of E. faecium colonization in streptomycin-treated Nod2-deficient mice (Nod2.sup./) and heterozygous littermate controls. E. faecium-mediated protection was absent in Nod2.sup./ animals in terms of early weight loss, pathogen burden, and survival (
[0134] In Example 1 in C. elegans, we identified that E. faecium-derived secreted antigen A (SagA) is a secreted N1pC/p60 peptidoglycan hydrolase that is sufficient for protection against S. Typhimurium in worms. Deletion of sagA has been shown to render E. faecium non-viable, and it is encoded in the genomes of all sequenced E. faecium strains; however, sagA is absent in E. faecalis and other known commensal species (K. L. Palmer et al., High-quality draft genome sequences of 28 Enterococcus sp. isolates. J Bacteriol 192, 2469 (May, 2010)). To determine if SagA also mediates protection against S. Typhimurium pathogenesis in mammals, we introduced its expression into our non-protective Enterococcus control, E. faecalis, and used it to mono-colonize gnotobiotic mice prior to S. Typhimurium infection. Similar to E. faecium, E. faecalis-sagA significantly improved early weight loss and survival compared to wild-type E. faecalis, without affecting pathogen burden (
[0135] Although Enterococcus strains have been used as probiotics in livestock, their pathogenic capacity makes them potentially problematic for use in humans. We thus introduced sagA into a known non-pathogenic probiotic, Lactobacillus plantarum (L. M. Dicks, M. Botes, Probiotic lactic acid bacteria in the gastro-intestinal tract: health benefits, safety and mode of action. Benef Microbes 1, 11 (Mar, 2010)), and confirmed that it was expressed and secreted (
[0136] The intestinal microbiota may have several beneficial modes of action that can potentially prevent or limit pathogenic infection, including niche competition with pathogenic bacteria, activation of immune cells and augmentation of epithelial barrier function. The present results indicate that commensal E. faecium does not hinder the growth of enteric pathogens in the gut, but instead utilizes a unique secreted peptidoglycan hydrolase, SagA, to increase epithelial expression of AMPs through MyD88 and NOD2 signaling pathways and enhance barrier integrity. These observations are consistent with our studies of E. faecium in C. elegans in Example 1, which also showed improved epithelial barrier integrity and SagA-mediated host resistance to S. Typhimurium pathogenesis. Thus, the results demonstrate a novel and conserved mechanism of pathogen resistance facilitated by bacterial peptidoglycan hydrolases and host pattern recognition receptors.
[0137] The following is a description of materials and methods used to obtain the data presented in this Example 2.
[0138] Animals. C57BL/6J (000664), Lyz2.sup.CRE (004781), MyD88.sup.f/f (008888), Nod2.sup./ (005763), Rag I.sup./ (002216) and Reg3g.sup./ (017480) mice were purchased from Jackson Laboratories and maintained in our facilities. Villin.sup.CreERT2 mice were developed by Silvie Robine and provided by David Artis. Several of these lines were interbred in our facilities to obtain the final strains described in this disclosure. Genotyping was performed according to the protocols established for the respective strains by Jackson Laboratories. Mice were maintained at the Rockefeller University animal facilities under specific pathogen-free (SPF) or germ-free (GF) conditions. Germ-free mice were obtained from Sarkis Mazmanian and bred and maintained in germ-free isolators in our facilities. Germ-free status was confirmed by plating feces as well as by qPCR analysis (16S rRNA). Mice were used at 8-10 weeks of age for most experiments. Animal care and experimentation were consistent with the NIH guidelines and were approved by the Institutional Animal Care and Use Committee at the Rockefeller University.
[0139] Bacteria. E. faecium (strain Com15) was provided by Michael Gilmore, and E. faecalis (strain OG1RF) and L. plantarum (strain WCFS1) were provided by Balfour Sartor. E. faecium and E. faecalis were cultured in BHI broth (BD 237500), S. Typhimurium (strain 14028) was cultured in Luria Broth (LB) and L. plantarum was cultured in de Man, Rogosa and Sharpe (MRS) broth. E. faecium, Efaecalis, and L. plantarum were grown overnight at 37 C. at 230 rpm shaking to stationary phase growth prior to colonization. S. Typhimurium was grown overnight followed by a 3.5 h subculture at 37 C. at 230 rpm to log phase growth prior to infection.
[0140] Colonization and infection of mice. Specific pathogen-free (SPF) mice were gavaged with either a single dose of 20 mg streptomycin or a daily dose of AMNV antibiotic cocktail (4 mg ampicillin, 2 mg metronidazole, 4 mg neomycin, and 2 mg vancomycin) for 7-14 days as indicated in the figure legends. Bacterial cultures were washed and resuspended in sterile PBS at 10.sup.9/mL for E. faecium, E.faecalis, and L. plantarum or at 10.sup.7/mL (SPF) or 10.sup.3/mL (GF) for S. Typhimurium. Mice were colonized by gavage with 100 uL of the indicated bacterial suspension 4 hours before infection (for streptomycin-treated mice) or 2-7 days before infection (for AMNV and GF gnotobiotic mono-colonized mice). Colonization was followed by infection with S. Typhimurium by oral gavage at the doses indicated above and in the figure legends. Weight loss was monitored from just before infection, and mice were euthanized when they reached 80% baseline weight or when they appeared hunched or moribund, whichever occurred first. Death was not used as an end-point. Colony-forming units (CFU) in the feces were determined by plating 5 serial dilutions of feces suspended in sterile PBS on selective agars: Salmonella Shigella Agar (BD 211597) for S. Typhimurium, Enterococcosel Agar (BD 212205) for E. faecium and E. facealis, and MRS Agar with 8 ug/mL chloramphenicol for L. plantarum-vector and -SagA. Resulting quantities were normalized to feces weight.
[0141] Pathological scoring. Representative portions of ileum, cecum and colon were fixed in Methacarn (methanol-Carnoy) solution and embedded in paraffin according to standard protocols (see 16S FISH below). 5-m sections were mounted on glass slides and stained withhematoxylin and eosin (H&E) for blinded histologic evaluation. Quantitative measures of inflammation were then recorded according to known methods. Briefly, each tissue section was microscopically assessed for the extent of submucosal edema, preservation of epithelial integrity and goblet cell retention (each category scored from 0-3), as well as for polymorphonuclear cell infiltration into the lamina propria (scored from 0-4). The sum of these scores represents the combined pathological score reported for each tissue. Scores 9 are indicative of severe inflammation, while scores of 5-8 are consistent with moderate inflammation. Scores 4 are associated with minimal to mild inflammation and frequently appear histologically normal.
[0142] Intestinal permeability and peripheral organ invasion. At 48 h post-infection, mice were gavaged with FITC-dextran 4 kDa (600 g/kg body weight) dissolved in sterile PBS. Serum was harvested by cardiac puncture after 4 h, and FITC fluorescence (excitation 488 nm and emission 518 nm) was measured in triplicate on a FLUOstar Omega microplate reader (BMG Labtech) to assess intestinal permeability. Concentration of FITC in serum was determined using a standard curve and expressed as ng/mL serum. To measure invasion, whole livers or mesenteric lymph nodes (mLN) were homogenized in PBS with 0.1% Triton X-100 to release intracellular bacteria. 3 serial dilutions were plated on Salmonella Shigella Agar, and resulting quantities were normalized to organ weight prior to homogenization.
[0143] 16S FISH. 16S rRNA FISH was performed with a universal probe (EUB388, Cy3-GCTGCCTCCCGTAGGAGT-Cy3) on sections fixed with Methacarn solution according to known techniques. In brief, intestinal tissues (about 1 cm) including intestinal contents were fixed in Methacarn solution (60% methanol, 30% chloroform, 10% glacial acetic acid) for 6 hours at 4 C. After 3 washes with 70% ethanol tissues were embedded in paraffin. 5-m sections were cut, mounted on glass slides, and de-paraffinized with xylene and subsequently dehydrated. Probe was diluted (5 ng/L) in hybridization buffer (0.9 M NaCl, 20 mM Tris-HCl (pH 7.2), 0.1% SDS) and hybridization was carried out at 50 C. for 3 hours. After hybridization, tissues were washed with wash buffer (0.9 M NaCl, 20 mM Tris-HCl (pH 7.2)) and nuclei were stained with Hoechst stain. Tissues were imaged on an Inverted LSM 780 laser scanning confocal microscope (Zeiss).
[0144] Intestinal cell isolation. Small intestine and large intestine were excised and freed of mesentery and fat. Feces were removed and Peyer's Patches were excised from the small intestine. Both small and large intestine were opened longitudinally and washed in HBSS, followed by HBSS+1 mM DTT (Sigma-Aldrich). Tissue was cut into 1 cm pieces and incubated with 25 mL of HBSS+2% FBS+5 mM EDTA for 15 minutes at 37 C. at 230 rpm. Supernatant containing intraepithelial lymphocytes was decanted and spun down (for RNA isolation from epithelial cells, see below). Tissue was washed with 10 mL of HBSS+2% FBS for 15 minutes at 37 C. at 230 rpm. The gut tissues were then finely chopped and digested in HBSS+2% FBS+1 Sodium Pyruvate+25 mM HEPES+50 g/mL DNasel+0.05 mg/mL Collagenase VIII for 40 min. at 37 C. at 90 rpm. Cells were separated by discontinuous Percoll gradient (70%/35%) centrifugation. Hematopoietic cells were isolated from the interphase and stained for analysis by flow cytometry.
[0145] Antibodies and flow cytometry analysis. Fluorescent-dye-conjugated antibodies were purchased from BD-Pharmingen (anti-CD4, 550954; anti-CD45R, 557683) or eBioscience (anti-CD8 56-0081; anti-TCR-47-5961; anti-IFN-, 25-7311; anti-TCR, 46-5711; anti-CD8, 46-0083; anti-TNF-, 17-7321). Flow cytometry data were acquired on an LSR-II flow cytometer (Becton Dickinson) and analyzed using FlowJo software (Tree Star). For analysis of cytokine-secreting cells, cells were incubated in the presence of 100 ng/ml PMA (Sigma), 500 ng/ml ionomycin (Sigma) and 10 g/ml brefeldin A (BFA) (Sigma) for the 3 h prior to staining. Cell populations were first stained with antibodies against cell surface markers, followed by permeabilization in Fix/Perm buffer and intracellular staining in Perm/Wash buffer (BD Pharmingen).
[0146] Quantitative PCR. Epithelial cells were resuspended in Trizol (Invitrogen), RNA was isolated according to the manufacturer's protocol, and cDNA was generated using iScript (BioRad). qPCR was performed using Power SYBR Green Master Mix (Agilent) in an ABI 7900HT system. Primers used were:
TABLE-US-00015 SEQID SEQID Forward NO Reverse NO cryptdin1 CTAGTCCTACTCTTTGCCCT 19 TTGCAGCCTCTTGATCTACA 20 cryptdin2 CTATTGTAGAACAAGAGGCT 21 TCTCCATGTTCAGCGACAGC 22 cryptdin3 GCGTTCTCTTCTTTTGCAGC 23 AAACTGAGGAGCAGCCAGG 24 cryptdin4 GTCCAGGCTGATCCTATCCA 25 GGGGCAGCAGTACAAAAATC 26 cryptdin5 GTCCAGGCTGATCCTATCCA 27 GATTTCTGCAGGTCCCAAAA 28 cryptdin6 GTCCCATTCATGCGTTCTCT 29 AGGACCAGGCTGTGTCTGTC 30 Muc1 TGCTCCTACAAGTTGGCAGA 31 TACCAAGCGTAGCCCCTATG 32 Muc2 ACAAAAACCCCAGCAACAAG 33 GAGCAAGGGACTCTGGTCTG 34 Muc4 GGACATGGGTGTCTGTGTTG 35 CTCACTGGAGAGTTCCCTGG 36 Muc13 CTTTGTACTGTGGTGGGAGGA 37 TCAAGCAAGAGCAGCTACCA 38 Muc17 ATTCAGAGGCCCCAGGTAGT 39 TGGCTAAACACGCTTCTCCT 40 Muc20 CAGGAAGGACATGTGGACAA 41 TTCCTCCTTGTACGGCTGAC 42 Reg3g TCCACCTCTGTTGGGTTCAT 43 AAGCTTCCTTCCTGTCCTCC 44
[0147] Generation of E. faecalis-sagA and L. plantarum-sagA.
[0148] L. plantarum-sagA:
[0149] pAM401-SagA was generated as in Example 1 and transformed into L. plantarum WCFS1 by electroporation. Protocol for preparation of electrocompetent cells and electroporation was adapted from known approaches. Briefly, Lactobacillus were grown for 18 hours in M9YE (M9 media, 0.1% casamino acids, 0.3% yeast extract)+2% glycine. Cultures were diluted in half with M9YE+3% glycine, and grown for an additional 3 hours. Cultures were chilled, pelleted, and washed 3 times in sucrose wash buffer (0.625 M sucrose, 1 mM MgC12, pH 4 with HCl), reducing the original culture volume by , 1/10, then 1/100 successively with each wash. Finally, cells were aliquoted, flash frozen in liquid nitrogen, and stored at 80 C. Cells were electroporated in 2 mm cuvettes, 25 F, 400 ohm, 2.5 kV. Cells were allowed to recover for 2 hours at room temperature without shaking in MRS broth (BD Bacto), then with shaking at 37 C. for another 2 hours before plating on selective media.
[0150] E. faecalis-sagA:
[0151] E. faecalis-sagA was generated as described in Example 1.
[0152] Statistics. Statistical analysis was performed in GraphPad Prism software. Data were analyzed by applying the tests indicated in each figure legend. A P value of less than 0.05 was considered significant.
[0153] While the invention has been described through specific embodiments, routine modifications will be apparent to those skilled in the art and such modifications are intended to be within the scope of the present invention.